--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:19:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/infA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -303.52 -306.08
2 -303.50 -307.06
--------------------------------------
TOTAL -303.51 -306.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890491 0.089379 0.357834 1.450558 0.861597 1501.00 1501.00 1.000
r(A<->C){all} 0.175594 0.021595 0.000028 0.468498 0.136179 256.06 278.35 1.004
r(A<->G){all} 0.167800 0.020565 0.000022 0.466997 0.128678 260.89 333.21 1.000
r(A<->T){all} 0.177869 0.021833 0.000016 0.464189 0.141986 108.65 162.27 1.000
r(C<->G){all} 0.155976 0.017933 0.000047 0.419823 0.119620 98.19 190.19 1.001
r(C<->T){all} 0.156044 0.018969 0.000049 0.444687 0.119999 302.67 355.49 1.001
r(G<->T){all} 0.166718 0.020690 0.000021 0.457738 0.125185 219.04 253.73 1.005
pi(A){all} 0.228060 0.000752 0.173844 0.281068 0.226669 1288.55 1317.50 1.001
pi(C){all} 0.242829 0.000795 0.190293 0.298981 0.242005 1308.65 1328.65 1.000
pi(G){all} 0.305093 0.000935 0.244333 0.362181 0.304650 1272.00 1334.79 1.001
pi(T){all} 0.224018 0.000789 0.164568 0.276338 0.223365 1273.73 1292.29 1.000
alpha{1,2} 0.412990 0.234887 0.000172 1.402079 0.242913 989.60 1245.30 1.000
alpha{3} 0.442468 0.237230 0.000166 1.417934 0.278182 1277.69 1316.37 1.000
pinvar{all} 0.992151 0.000092 0.973930 0.999999 0.995274 1191.55 1203.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -286.585722
Model 2: PositiveSelection -286.585683
Model 0: one-ratio -286.585739
Model 7: beta -286.585729
Model 8: beta&w>1 -286.585683
Model 0 vs 1 3.400000002784509E-5
Model 2 vs 1 7.799999991675577E-5
Model 8 vs 7 9.1999999995096E-5
>C1
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C2
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C3
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C4
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C5
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C6
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=73
C1 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C2 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C3 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C4 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C5 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C6 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
**************************************************
C1 EDRVVVELSPYDLSRGRIVYRYK
C2 EDRVVVELSPYDLSRGRIVYRYK
C3 EDRVVVELSPYDLSRGRIVYRYK
C4 EDRVVVELSPYDLSRGRIVYRYK
C5 EDRVVVELSPYDLSRGRIVYRYK
C6 EDRVVVELSPYDLSRGRIVYRYK
***********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2190]--->[2190]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.446 Mb, Max= 30.592 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C2 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C3 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C4 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C5 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C6 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
**************************************************
C1 EDRVVVELSPYDLSRGRIVYRYK
C2 EDRVVVELSPYDLSRGRIVYRYK
C3 EDRVVVELSPYDLSRGRIVYRYK
C4 EDRVVVELSPYDLSRGRIVYRYK
C5 EDRVVVELSPYDLSRGRIVYRYK
C6 EDRVVVELSPYDLSRGRIVYRYK
***********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C2 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C3 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C4 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C5 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C6 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
**************************************************
C1 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C2 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C3 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C4 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C5 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C6 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
**************************************************
C1 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C2 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C3 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C4 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C5 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C6 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
**************************************************
C1 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C2 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C3 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C4 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C5 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C6 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
**************************************************
C1 CATTGTGTACCGATACAAG
C2 CATTGTGTACCGATACAAG
C3 CATTGTGTACCGATACAAG
C4 CATTGTGTACCGATACAAG
C5 CATTGTGTACCGATACAAG
C6 CATTGTGTACCGATACAAG
*******************
>C1
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C2
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C3
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C4
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C5
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C6
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C1
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C2
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C3
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C4
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C5
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C6
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 219 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792664
Setting output file names to "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1479376292
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0787225561
Seed = 1162261910
Swapseed = 1579792664
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -490.132470 -- -24.965149
Chain 2 -- -490.132498 -- -24.965149
Chain 3 -- -490.132498 -- -24.965149
Chain 4 -- -490.132470 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -490.132470 -- -24.965149
Chain 2 -- -490.132498 -- -24.965149
Chain 3 -- -490.132498 -- -24.965149
Chain 4 -- -490.132498 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-490.132] (-490.132) (-490.132) (-490.132) * [-490.132] (-490.132) (-490.132) (-490.132)
500 -- (-316.602) [-312.519] (-309.508) (-311.948) * [-309.763] (-311.354) (-319.247) (-310.692) -- 0:00:00
1000 -- (-313.267) (-314.624) [-310.829] (-315.566) * (-313.426) [-307.856] (-308.238) (-307.870) -- 0:00:00
1500 -- (-313.548) (-310.610) [-313.388] (-314.162) * (-315.723) [-317.301] (-315.710) (-311.994) -- 0:00:00
2000 -- [-310.653] (-313.025) (-311.606) (-325.476) * (-310.494) [-312.309] (-314.953) (-311.591) -- 0:00:00
2500 -- (-318.491) (-311.813) (-318.571) [-309.601] * (-310.477) (-315.008) [-318.017] (-325.077) -- 0:00:00
3000 -- (-318.592) [-314.325] (-322.228) (-308.779) * (-312.267) (-313.040) (-314.535) [-310.263] -- 0:00:00
3500 -- (-312.945) [-314.159] (-310.345) (-319.843) * (-315.762) (-314.242) [-312.387] (-310.094) -- 0:00:00
4000 -- (-314.000) [-315.327] (-317.580) (-310.416) * (-311.434) (-312.248) [-319.935] (-320.862) -- 0:00:00
4500 -- (-307.370) [-311.682] (-313.292) (-308.476) * [-309.638] (-319.718) (-312.295) (-314.274) -- 0:00:00
5000 -- (-317.195) [-315.869] (-315.694) (-313.298) * (-317.854) [-312.958] (-315.391) (-315.507) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- [-316.233] (-313.135) (-314.722) (-318.986) * (-310.926) [-317.504] (-308.857) (-323.128) -- 0:00:00
6000 -- (-315.412) [-310.646] (-312.936) (-315.530) * [-318.090] (-307.507) (-309.232) (-321.987) -- 0:00:00
6500 -- (-324.620) [-311.333] (-308.432) (-321.525) * (-310.636) (-309.010) (-313.265) [-311.444] -- 0:00:00
7000 -- (-315.687) (-312.307) (-321.984) [-311.289] * [-313.149] (-317.383) (-313.532) (-317.675) -- 0:02:21
7500 -- [-312.195] (-307.583) (-317.839) (-315.857) * [-312.933] (-318.603) (-312.710) (-315.168) -- 0:02:12
8000 -- [-317.615] (-313.013) (-330.280) (-314.854) * (-322.819) (-320.944) (-313.070) [-309.678] -- 0:02:04
8500 -- (-318.383) [-312.453] (-315.418) (-314.325) * [-309.350] (-313.403) (-316.314) (-318.052) -- 0:01:56
9000 -- (-315.906) [-322.027] (-320.881) (-316.396) * (-309.585) (-312.294) [-309.664] (-320.431) -- 0:01:50
9500 -- (-318.064) (-315.466) (-337.483) [-309.006] * (-311.015) [-315.397] (-310.323) (-326.113) -- 0:01:44
10000 -- [-314.348] (-316.702) (-329.561) (-310.887) * [-315.157] (-319.688) (-313.079) (-327.767) -- 0:01:39
Average standard deviation of split frequencies: 0.061872
10500 -- [-311.945] (-312.435) (-326.535) (-310.565) * (-321.214) (-314.310) [-317.754] (-305.512) -- 0:01:34
11000 -- [-302.928] (-329.509) (-312.999) (-312.481) * (-312.500) (-311.513) (-313.573) [-303.320] -- 0:01:29
11500 -- (-305.359) (-315.360) (-310.373) [-312.670] * (-309.086) [-306.917] (-315.641) (-306.203) -- 0:01:25
12000 -- (-304.786) (-322.364) (-304.168) [-310.560] * (-312.434) [-306.637] (-309.653) (-305.706) -- 0:01:22
12500 -- [-303.339] (-313.806) (-302.748) (-316.650) * (-312.742) (-303.305) (-314.640) [-306.551] -- 0:01:19
13000 -- [-305.050] (-331.685) (-307.480) (-314.661) * (-315.680) (-304.219) (-313.469) [-303.955] -- 0:01:15
13500 -- [-302.611] (-317.656) (-301.891) (-330.685) * [-304.828] (-306.329) (-317.622) (-305.530) -- 0:01:13
14000 -- (-302.995) (-314.944) [-306.342] (-313.427) * [-311.268] (-304.854) (-318.961) (-307.198) -- 0:01:10
14500 -- (-305.180) (-317.422) (-308.758) [-323.529] * (-318.377) (-302.138) (-318.070) [-303.375] -- 0:01:07
15000 -- [-305.148] (-325.293) (-304.795) (-318.195) * (-319.150) (-301.996) (-313.403) [-302.767] -- 0:01:05
Average standard deviation of split frequencies: 0.041868
15500 -- [-305.617] (-318.601) (-305.639) (-314.119) * [-313.567] (-303.097) (-319.055) (-304.398) -- 0:01:03
16000 -- [-303.606] (-304.588) (-305.288) (-322.712) * (-313.299) (-302.949) (-310.809) [-303.265] -- 0:01:01
16500 -- (-303.772) [-305.084] (-306.639) (-319.071) * [-309.494] (-303.208) (-317.148) (-303.779) -- 0:00:59
17000 -- [-306.217] (-310.572) (-303.556) (-322.808) * (-319.047) [-302.781] (-312.749) (-308.878) -- 0:00:57
17500 -- (-305.818) [-302.592] (-307.546) (-326.234) * (-318.290) [-302.903] (-312.137) (-307.866) -- 0:00:56
18000 -- [-305.958] (-303.068) (-304.759) (-327.877) * [-315.597] (-304.788) (-311.376) (-303.086) -- 0:00:54
18500 -- [-302.318] (-304.592) (-302.867) (-327.102) * (-313.089) (-303.977) (-311.763) [-302.381] -- 0:00:53
19000 -- (-303.771) (-306.909) (-303.597) [-321.360] * (-321.843) [-302.464] (-320.312) (-304.719) -- 0:00:51
19500 -- [-302.533] (-304.670) (-309.016) (-323.613) * (-322.072) (-304.685) (-310.833) [-306.533] -- 0:00:50
20000 -- [-304.765] (-303.860) (-304.830) (-319.756) * (-317.063) (-303.067) [-312.651] (-303.234) -- 0:00:49
Average standard deviation of split frequencies: 0.051956
20500 -- (-310.522) [-304.462] (-302.190) (-312.885) * [-309.205] (-303.415) (-310.848) (-302.783) -- 0:00:47
21000 -- (-304.487) (-304.272) (-302.011) [-302.263] * (-319.628) (-304.707) (-316.444) [-303.177] -- 0:00:46
21500 -- (-306.372) (-304.169) [-302.234] (-303.980) * (-317.662) [-302.849] (-318.502) (-306.663) -- 0:00:45
22000 -- (-303.528) (-304.344) (-305.286) [-302.925] * [-310.315] (-303.924) (-314.036) (-305.467) -- 0:01:28
22500 -- (-306.687) (-303.534) (-306.535) [-302.827] * (-313.337) [-306.188] (-319.072) (-304.707) -- 0:01:26
23000 -- (-308.809) (-303.971) [-305.920] (-304.175) * (-307.544) [-302.338] (-312.240) (-304.749) -- 0:01:24
23500 -- (-306.918) [-305.097] (-303.775) (-304.207) * [-312.546] (-304.877) (-324.198) (-303.141) -- 0:01:23
24000 -- [-303.853] (-303.814) (-304.117) (-303.063) * (-308.704) [-304.030] (-313.308) (-303.701) -- 0:01:21
24500 -- (-304.716) [-302.052] (-303.372) (-303.685) * (-313.370) (-303.923) (-310.181) [-303.730] -- 0:01:19
25000 -- (-304.851) [-303.370] (-303.073) (-302.993) * [-309.464] (-305.350) (-316.100) (-304.846) -- 0:01:18
Average standard deviation of split frequencies: 0.044145
25500 -- [-303.188] (-304.027) (-302.504) (-305.554) * (-317.057) [-305.363] (-316.533) (-303.331) -- 0:01:16
26000 -- (-308.527) (-304.906) (-303.135) [-306.110] * (-312.241) (-302.663) [-309.555] (-304.784) -- 0:01:14
26500 -- (-304.433) [-304.932] (-306.197) (-303.428) * (-318.524) (-304.581) (-310.663) [-308.255] -- 0:01:13
27000 -- [-304.819] (-304.460) (-302.244) (-302.243) * (-315.759) (-304.756) (-314.109) [-308.142] -- 0:01:12
27500 -- (-305.508) [-302.357] (-303.662) (-304.586) * [-311.042] (-305.678) (-315.979) (-303.705) -- 0:01:10
28000 -- (-303.034) (-302.093) [-304.502] (-306.961) * [-310.039] (-304.700) (-319.297) (-306.986) -- 0:01:09
28500 -- (-305.180) [-303.662] (-305.009) (-302.617) * (-311.633) (-304.602) (-317.792) [-305.332] -- 0:01:08
29000 -- (-306.481) [-305.904] (-304.879) (-313.061) * (-310.323) (-305.999) (-315.874) [-302.496] -- 0:01:06
29500 -- (-307.351) (-305.763) [-304.524] (-304.402) * [-313.892] (-303.174) (-326.205) (-305.422) -- 0:01:05
30000 -- (-303.573) (-308.268) [-307.452] (-303.865) * [-316.972] (-302.450) (-309.692) (-304.732) -- 0:01:04
Average standard deviation of split frequencies: 0.036124
30500 -- (-302.751) [-308.789] (-306.320) (-302.095) * [-312.686] (-305.373) (-310.908) (-304.407) -- 0:01:03
31000 -- [-303.673] (-307.372) (-302.842) (-303.450) * (-314.525) (-309.185) [-312.549] (-302.884) -- 0:01:02
31500 -- [-303.642] (-308.056) (-303.066) (-302.199) * (-316.545) (-304.615) (-317.739) [-306.725] -- 0:01:01
32000 -- (-306.065) (-305.429) (-306.347) [-304.185] * (-332.045) [-305.738] (-319.496) (-305.937) -- 0:01:00
32500 -- (-305.035) (-304.752) [-302.930] (-308.847) * (-316.612) (-305.111) (-313.342) [-306.233] -- 0:00:59
33000 -- [-304.077] (-304.087) (-308.133) (-304.539) * [-305.172] (-307.368) (-315.733) (-306.667) -- 0:00:58
33500 -- [-302.692] (-308.495) (-305.699) (-305.720) * (-305.728) (-305.556) (-318.927) [-304.390] -- 0:00:57
34000 -- (-302.596) (-307.946) (-307.489) [-305.318] * [-306.410] (-305.313) (-302.671) (-302.032) -- 0:00:56
34500 -- (-305.793) [-302.665] (-305.628) (-304.441) * (-305.225) (-307.524) [-303.109] (-307.422) -- 0:00:55
35000 -- [-305.858] (-303.475) (-302.150) (-305.786) * (-303.473) (-303.882) [-302.414] (-307.607) -- 0:00:55
Average standard deviation of split frequencies: 0.042730
35500 -- (-306.286) [-302.274] (-303.406) (-310.289) * [-302.757] (-302.970) (-304.336) (-303.613) -- 0:00:54
36000 -- (-306.479) (-303.132) (-303.000) [-303.928] * (-306.264) (-304.532) [-304.217] (-304.090) -- 0:00:53
36500 -- (-303.364) [-302.183] (-302.859) (-302.654) * (-302.925) [-304.363] (-302.519) (-303.822) -- 0:01:19
37000 -- (-304.668) (-302.611) (-308.959) [-303.452] * (-306.558) [-305.320] (-306.103) (-302.179) -- 0:01:18
37500 -- (-304.566) [-303.058] (-307.140) (-303.092) * [-303.869] (-303.452) (-305.783) (-305.156) -- 0:01:17
38000 -- (-304.530) [-305.116] (-304.035) (-306.476) * [-306.076] (-311.107) (-302.784) (-302.850) -- 0:01:15
38500 -- [-305.589] (-303.465) (-303.952) (-308.106) * (-304.228) (-308.859) [-303.482] (-304.853) -- 0:01:14
39000 -- [-304.884] (-303.990) (-303.733) (-305.677) * [-302.103] (-305.572) (-303.408) (-310.403) -- 0:01:13
39500 -- (-306.757) (-303.283) [-303.494] (-304.085) * [-303.146] (-303.167) (-303.935) (-307.516) -- 0:01:12
40000 -- (-302.921) (-305.335) (-305.124) [-305.676] * (-306.209) (-303.816) [-306.331] (-304.472) -- 0:01:12
Average standard deviation of split frequencies: 0.038253
40500 -- (-306.128) (-306.024) [-303.069] (-303.004) * [-307.515] (-304.450) (-304.810) (-304.468) -- 0:01:11
41000 -- (-302.834) (-303.253) (-304.055) [-305.253] * [-303.275] (-303.038) (-305.468) (-302.783) -- 0:01:10
41500 -- (-304.350) (-303.878) (-303.433) [-305.434] * [-303.852] (-308.012) (-303.054) (-304.153) -- 0:01:09
42000 -- (-310.631) (-303.562) (-304.507) [-306.361] * (-304.840) (-304.987) [-305.454] (-303.804) -- 0:01:08
42500 -- (-304.166) (-302.540) [-307.385] (-303.934) * (-303.028) (-303.446) (-308.218) [-304.336] -- 0:01:07
43000 -- (-305.686) (-304.603) (-309.231) [-303.619] * [-305.502] (-308.004) (-306.247) (-305.278) -- 0:01:06
43500 -- (-303.693) [-304.462] (-305.045) (-304.142) * (-307.458) (-304.889) (-316.002) [-304.009] -- 0:01:05
44000 -- (-302.283) (-303.693) [-306.307] (-302.127) * (-302.932) (-304.250) (-310.860) [-302.232] -- 0:01:05
44500 -- [-303.592] (-304.742) (-306.645) (-303.216) * (-303.630) [-303.602] (-303.472) (-303.531) -- 0:01:04
45000 -- (-304.944) (-305.430) (-305.381) [-305.219] * (-303.146) [-302.998] (-303.627) (-304.393) -- 0:01:03
Average standard deviation of split frequencies: 0.034936
45500 -- [-303.354] (-306.215) (-303.250) (-302.570) * [-303.890] (-305.907) (-304.214) (-302.225) -- 0:01:02
46000 -- [-305.555] (-303.032) (-303.702) (-303.996) * (-304.116) (-303.695) (-309.902) [-305.040] -- 0:01:02
46500 -- (-309.340) (-302.395) [-303.522] (-304.126) * [-303.055] (-308.459) (-302.590) (-303.197) -- 0:01:01
47000 -- (-302.951) (-303.851) [-303.149] (-303.148) * (-305.417) (-305.740) (-302.473) [-303.762] -- 0:01:00
47500 -- [-302.150] (-305.789) (-304.446) (-308.289) * (-308.091) (-304.090) (-302.276) [-305.424] -- 0:01:00
48000 -- (-304.511) (-302.606) (-305.524) [-303.662] * (-307.731) [-303.980] (-302.928) (-304.767) -- 0:00:59
48500 -- (-305.669) [-303.717] (-307.417) (-307.675) * (-309.086) [-303.441] (-304.160) (-304.994) -- 0:00:58
49000 -- (-311.406) (-304.566) [-302.627] (-305.816) * (-302.562) (-303.871) (-310.483) [-303.407] -- 0:00:58
49500 -- (-308.283) (-302.363) [-304.155] (-302.786) * (-304.532) (-303.436) (-304.767) [-302.293] -- 0:00:57
50000 -- [-306.757] (-304.601) (-302.956) (-303.426) * (-304.830) (-305.346) [-305.283] (-305.161) -- 0:00:57
Average standard deviation of split frequencies: 0.032564
50500 -- (-304.219) [-305.805] (-303.884) (-302.229) * (-303.010) (-303.203) (-302.106) [-303.463] -- 0:00:56
51000 -- (-304.422) [-302.428] (-308.356) (-303.504) * (-306.314) [-304.570] (-303.002) (-305.190) -- 0:00:55
51500 -- (-305.574) (-302.177) [-305.928] (-304.009) * (-302.065) [-305.519] (-303.399) (-303.928) -- 0:01:13
52000 -- (-305.226) [-304.705] (-304.267) (-305.323) * [-305.586] (-306.544) (-302.989) (-307.318) -- 0:01:12
52500 -- (-303.985) (-303.457) [-306.336] (-302.763) * (-304.942) (-302.470) (-304.268) [-306.133] -- 0:01:12
53000 -- (-307.007) (-305.679) [-309.392] (-302.303) * (-305.267) (-304.225) [-304.208] (-303.455) -- 0:01:11
53500 -- (-302.289) (-304.557) [-304.246] (-302.657) * (-303.858) (-306.970) (-303.061) [-303.400] -- 0:01:10
54000 -- (-302.360) (-305.346) [-302.643] (-302.357) * (-303.300) [-302.279] (-305.496) (-303.448) -- 0:01:10
54500 -- [-303.498] (-303.723) (-303.726) (-309.785) * (-304.686) [-303.691] (-308.861) (-302.892) -- 0:01:09
55000 -- [-304.631] (-303.574) (-302.968) (-306.350) * (-302.620) [-309.004] (-303.845) (-302.725) -- 0:01:08
Average standard deviation of split frequencies: 0.029845
55500 -- (-305.679) [-303.073] (-303.598) (-308.830) * [-302.797] (-304.154) (-304.245) (-304.581) -- 0:01:08
56000 -- (-303.985) (-303.535) [-304.930] (-307.485) * (-302.688) (-304.108) (-303.758) [-304.089] -- 0:01:07
56500 -- (-308.053) (-304.448) [-303.093] (-305.932) * [-303.336] (-307.474) (-304.113) (-301.889) -- 0:01:06
57000 -- (-308.893) [-303.085] (-302.499) (-307.808) * (-305.744) (-306.592) (-304.446) [-306.610] -- 0:01:06
57500 -- (-302.832) [-307.656] (-309.631) (-302.992) * (-303.528) (-304.628) [-303.349] (-309.298) -- 0:01:05
58000 -- (-304.438) [-304.177] (-306.879) (-306.052) * (-305.354) (-302.716) [-305.326] (-303.858) -- 0:01:04
58500 -- (-304.719) (-302.778) [-304.415] (-303.636) * [-304.446] (-303.255) (-303.927) (-302.887) -- 0:01:04
59000 -- (-305.538) (-304.918) (-303.393) [-304.410] * [-302.225] (-305.531) (-303.327) (-304.410) -- 0:01:03
59500 -- (-302.897) (-303.062) [-303.329] (-307.292) * [-304.562] (-302.843) (-304.055) (-303.595) -- 0:01:03
60000 -- [-303.542] (-306.466) (-304.182) (-308.755) * (-303.080) (-302.823) (-302.615) [-304.182] -- 0:01:02
Average standard deviation of split frequencies: 0.026419
60500 -- (-307.829) (-306.055) [-305.074] (-303.768) * (-306.346) [-303.237] (-304.160) (-304.957) -- 0:01:02
61000 -- (-304.780) (-304.726) (-304.028) [-303.516] * (-309.247) (-303.120) [-305.494] (-302.641) -- 0:01:01
61500 -- (-303.388) [-302.131] (-305.202) (-303.540) * (-303.392) (-303.698) (-302.932) [-302.616] -- 0:01:01
62000 -- (-302.757) [-303.046] (-302.540) (-305.731) * [-303.287] (-303.550) (-305.737) (-305.987) -- 0:01:00
62500 -- (-305.968) (-304.412) [-303.238] (-305.058) * [-305.361] (-306.645) (-304.135) (-302.355) -- 0:01:00
63000 -- (-306.003) (-304.046) [-306.551] (-303.611) * (-303.008) (-305.261) [-304.089] (-303.632) -- 0:00:59
63500 -- (-308.082) (-303.453) (-308.607) [-304.059] * [-302.295] (-305.340) (-304.576) (-303.442) -- 0:00:58
64000 -- (-308.884) (-305.069) (-306.139) [-304.344] * [-302.312] (-302.910) (-303.603) (-302.813) -- 0:00:58
64500 -- [-309.439] (-304.118) (-306.039) (-305.514) * (-305.403) (-302.054) (-304.867) [-304.238] -- 0:00:58
65000 -- (-305.687) (-306.345) (-308.012) [-302.964] * [-303.401] (-304.437) (-304.378) (-304.812) -- 0:00:57
Average standard deviation of split frequencies: 0.025713
65500 -- (-307.398) [-303.765] (-307.307) (-304.709) * (-303.104) [-304.917] (-303.202) (-306.879) -- 0:00:57
66000 -- (-305.112) (-305.080) [-304.843] (-303.591) * (-302.761) (-303.203) [-304.976] (-307.089) -- 0:00:56
66500 -- (-305.707) (-303.866) (-306.381) [-306.278] * (-304.964) [-303.005] (-316.393) (-304.504) -- 0:00:56
67000 -- (-305.323) (-304.918) [-302.057] (-307.287) * [-305.636] (-305.034) (-304.235) (-302.586) -- 0:01:09
67500 -- (-304.951) [-304.227] (-302.998) (-304.755) * (-304.491) (-309.172) (-302.200) [-305.600] -- 0:01:09
68000 -- [-305.685] (-304.341) (-306.288) (-303.969) * (-304.051) (-303.917) [-302.363] (-304.993) -- 0:01:08
68500 -- (-303.062) (-306.421) (-308.946) [-303.535] * (-304.393) (-305.268) (-302.791) [-302.735] -- 0:01:07
69000 -- (-304.161) (-308.410) [-302.507] (-306.723) * (-308.406) [-305.120] (-304.019) (-307.003) -- 0:01:07
69500 -- (-303.861) (-303.693) [-304.800] (-304.358) * (-305.922) (-306.613) (-304.374) [-306.185] -- 0:01:06
70000 -- [-305.282] (-305.590) (-308.266) (-304.149) * [-305.664] (-304.220) (-303.989) (-302.544) -- 0:01:06
Average standard deviation of split frequencies: 0.025730
70500 -- (-305.224) [-305.474] (-303.329) (-305.280) * (-307.984) (-304.347) (-302.916) [-303.672] -- 0:01:05
71000 -- (-305.175) (-306.291) [-301.968] (-303.019) * (-303.523) (-304.111) [-303.920] (-302.730) -- 0:01:05
71500 -- [-303.136] (-301.952) (-302.587) (-302.848) * (-303.017) [-308.237] (-302.713) (-303.241) -- 0:01:04
72000 -- (-304.789) (-304.929) (-303.211) [-308.049] * (-303.724) (-305.328) (-304.691) [-302.149] -- 0:01:04
72500 -- (-302.752) [-302.897] (-304.989) (-305.366) * [-302.817] (-306.204) (-302.854) (-304.212) -- 0:01:03
73000 -- (-303.751) (-302.122) (-302.466) [-304.530] * [-307.786] (-303.168) (-304.476) (-303.405) -- 0:01:03
73500 -- [-305.774] (-303.874) (-304.077) (-303.092) * (-302.691) [-304.060] (-303.177) (-303.858) -- 0:01:03
74000 -- [-303.044] (-305.598) (-305.820) (-303.574) * (-304.602) (-304.437) [-303.147] (-305.944) -- 0:01:02
74500 -- (-305.253) (-303.483) [-305.071] (-306.588) * [-307.388] (-305.625) (-304.813) (-307.240) -- 0:01:02
75000 -- (-303.654) (-303.069) (-304.796) [-303.506] * (-303.240) (-303.902) (-302.499) [-303.598] -- 0:01:01
Average standard deviation of split frequencies: 0.031340
75500 -- (-304.249) [-302.288] (-305.845) (-304.478) * (-307.701) (-304.054) (-307.051) [-302.031] -- 0:01:01
76000 -- (-305.603) [-303.941] (-303.801) (-305.789) * (-303.188) (-303.428) [-306.118] (-307.326) -- 0:01:00
76500 -- (-303.839) [-307.154] (-303.525) (-303.124) * [-306.756] (-304.016) (-305.148) (-306.170) -- 0:01:00
77000 -- (-304.966) (-305.417) (-302.653) [-305.695] * (-309.169) (-307.160) (-308.179) [-303.195] -- 0:00:59
77500 -- [-302.838] (-306.626) (-305.374) (-305.688) * [-303.154] (-304.759) (-305.651) (-303.924) -- 0:00:59
78000 -- (-305.008) (-303.699) [-302.181] (-305.918) * (-304.882) (-305.313) [-305.191] (-302.421) -- 0:00:59
78500 -- (-303.528) [-304.273] (-303.705) (-303.227) * [-304.602] (-308.001) (-304.306) (-303.985) -- 0:00:58
79000 -- (-304.758) [-303.824] (-306.372) (-306.410) * (-304.269) [-306.106] (-305.746) (-308.703) -- 0:00:58
79500 -- (-304.356) [-304.002] (-304.288) (-302.283) * (-309.146) (-303.499) [-305.485] (-308.387) -- 0:00:57
80000 -- [-304.736] (-304.194) (-304.292) (-302.547) * [-305.268] (-304.439) (-303.599) (-310.812) -- 0:01:09
Average standard deviation of split frequencies: 0.029219
80500 -- (-303.492) [-306.660] (-304.039) (-305.518) * (-306.748) [-304.816] (-305.578) (-302.921) -- 0:01:08
81000 -- (-305.139) [-303.552] (-308.257) (-302.199) * [-303.056] (-303.355) (-310.042) (-304.588) -- 0:01:08
81500 -- (-308.855) [-305.392] (-303.060) (-302.728) * [-302.653] (-304.162) (-303.993) (-303.521) -- 0:01:07
82000 -- (-306.270) (-306.713) (-302.427) [-302.575] * (-304.837) (-303.289) (-302.935) [-305.817] -- 0:01:07
82500 -- (-305.193) [-305.534] (-303.677) (-304.276) * (-302.651) (-304.310) [-306.545] (-303.186) -- 0:01:06
83000 -- (-304.441) [-303.443] (-302.960) (-303.026) * [-303.413] (-303.476) (-304.826) (-304.284) -- 0:01:06
83500 -- [-308.115] (-305.594) (-302.062) (-307.021) * (-304.734) (-303.072) (-302.369) [-303.509] -- 0:01:05
84000 -- (-308.725) (-306.002) [-305.823] (-311.478) * [-304.517] (-305.990) (-306.641) (-306.918) -- 0:01:05
84500 -- (-313.001) (-306.379) (-302.884) [-307.642] * (-303.126) (-303.078) (-305.793) [-308.894] -- 0:01:05
85000 -- (-306.453) [-303.396] (-305.995) (-306.257) * (-304.069) (-305.011) [-306.622] (-302.527) -- 0:01:04
Average standard deviation of split frequencies: 0.025912
85500 -- [-304.310] (-304.584) (-305.288) (-308.561) * [-302.820] (-306.254) (-303.878) (-302.107) -- 0:01:04
86000 -- (-309.428) (-305.242) [-303.053] (-303.255) * (-304.313) (-305.935) [-307.281] (-303.686) -- 0:01:03
86500 -- (-309.336) [-304.376] (-305.635) (-304.078) * [-304.903] (-303.120) (-304.994) (-302.224) -- 0:01:03
87000 -- (-306.721) [-305.511] (-310.638) (-306.431) * (-305.131) [-303.872] (-306.364) (-306.380) -- 0:01:02
87500 -- [-304.137] (-304.014) (-306.832) (-303.727) * [-302.899] (-303.517) (-304.497) (-304.584) -- 0:01:02
88000 -- [-304.812] (-304.859) (-303.170) (-303.399) * (-306.225) (-302.293) [-303.865] (-303.505) -- 0:01:02
88500 -- (-303.042) (-303.655) [-304.257] (-303.756) * (-305.792) (-305.163) [-302.510] (-306.131) -- 0:01:01
89000 -- (-302.668) [-303.961] (-307.144) (-307.742) * [-306.323] (-303.650) (-305.564) (-305.643) -- 0:01:01
89500 -- (-304.184) (-304.381) (-304.775) [-304.689] * (-302.095) (-303.464) (-303.124) [-304.444] -- 0:01:01
90000 -- (-304.956) (-308.355) (-304.266) [-305.106] * (-304.677) [-303.959] (-305.806) (-302.847) -- 0:01:00
Average standard deviation of split frequencies: 0.025997
90500 -- (-304.160) (-303.120) [-301.883] (-304.385) * (-305.859) [-304.968] (-302.991) (-304.023) -- 0:01:00
91000 -- (-303.967) (-304.952) [-302.252] (-305.782) * (-305.846) (-304.692) (-303.421) [-302.807] -- 0:00:59
91500 -- (-302.960) (-303.504) (-305.456) [-303.907] * [-302.604] (-303.180) (-304.262) (-306.291) -- 0:00:59
92000 -- [-303.153] (-304.869) (-303.411) (-304.835) * (-304.168) (-305.131) [-302.542] (-303.433) -- 0:00:59
92500 -- [-302.845] (-303.026) (-305.074) (-301.997) * (-303.515) [-303.380] (-303.280) (-302.942) -- 0:00:58
93000 -- (-305.265) (-302.641) [-303.189] (-302.828) * (-304.601) [-304.033] (-307.877) (-304.951) -- 0:01:08
93500 -- (-306.206) [-304.436] (-303.345) (-303.188) * (-303.418) [-303.679] (-311.688) (-305.157) -- 0:01:07
94000 -- [-302.521] (-303.279) (-302.595) (-306.024) * (-303.240) (-308.103) (-309.101) [-305.659] -- 0:01:07
94500 -- (-303.090) (-302.366) (-305.030) [-303.675] * [-303.381] (-303.283) (-303.106) (-302.498) -- 0:01:07
95000 -- (-305.089) [-304.390] (-306.020) (-304.491) * (-302.458) (-302.798) [-303.253] (-304.534) -- 0:01:06
Average standard deviation of split frequencies: 0.024307
95500 -- (-307.779) (-302.014) (-304.204) [-302.882] * [-308.859] (-303.682) (-302.545) (-306.074) -- 0:01:06
96000 -- (-302.786) (-304.557) [-303.988] (-305.260) * (-302.997) (-303.823) [-304.568] (-302.507) -- 0:01:05
96500 -- (-303.564) [-302.331] (-304.643) (-306.476) * (-307.037) (-304.937) (-303.110) [-302.511] -- 0:01:05
97000 -- (-303.599) (-303.920) (-304.442) [-302.889] * (-302.883) (-307.875) (-303.229) [-303.975] -- 0:01:05
97500 -- [-303.725] (-304.099) (-305.117) (-307.127) * (-302.799) (-302.381) [-302.768] (-303.060) -- 0:01:04
98000 -- (-304.587) [-305.277] (-305.221) (-305.718) * (-302.244) (-304.274) (-307.339) [-302.599] -- 0:01:04
98500 -- [-303.585] (-301.997) (-303.310) (-305.622) * [-304.688] (-305.377) (-307.950) (-304.951) -- 0:01:04
99000 -- [-303.434] (-302.678) (-304.111) (-305.452) * (-303.773) [-303.791] (-307.258) (-306.834) -- 0:01:03
99500 -- (-302.140) (-305.208) (-306.710) [-303.941] * [-303.346] (-304.357) (-304.397) (-306.378) -- 0:01:03
100000 -- (-303.495) (-302.358) (-302.492) [-308.065] * (-309.346) (-303.813) (-303.858) [-303.136] -- 0:01:02
Average standard deviation of split frequencies: 0.023168
100500 -- (-304.750) [-305.609] (-303.920) (-305.411) * (-304.110) (-304.712) [-305.281] (-304.123) -- 0:01:02
101000 -- (-303.509) (-305.682) [-305.379] (-308.874) * (-306.573) [-303.009] (-304.047) (-304.053) -- 0:01:02
101500 -- (-304.349) [-303.500] (-305.407) (-303.848) * (-303.758) (-303.352) (-306.930) [-308.164] -- 0:01:01
102000 -- (-305.110) (-303.940) (-304.569) [-303.273] * (-302.586) (-303.844) (-303.805) [-303.750] -- 0:01:01
102500 -- [-305.494] (-303.376) (-306.938) (-303.507) * [-304.308] (-303.674) (-308.402) (-304.406) -- 0:01:01
103000 -- (-307.317) (-303.334) [-305.550] (-304.565) * [-304.088] (-304.833) (-308.743) (-305.410) -- 0:01:00
103500 -- (-304.608) [-307.338] (-304.312) (-303.145) * (-305.610) (-302.855) (-306.348) [-305.125] -- 0:01:00
104000 -- (-303.442) [-304.030] (-304.358) (-301.922) * (-302.489) (-302.932) [-305.072] (-304.053) -- 0:01:00
104500 -- (-303.682) (-304.714) (-302.690) [-302.736] * (-302.545) (-308.559) (-304.112) [-302.808] -- 0:00:59
105000 -- [-304.889] (-304.724) (-303.076) (-303.986) * (-303.797) (-305.146) [-303.834] (-303.016) -- 0:00:59
Average standard deviation of split frequencies: 0.021813
105500 -- [-303.108] (-307.870) (-302.482) (-304.120) * (-304.882) [-310.789] (-304.695) (-303.482) -- 0:00:59
106000 -- [-303.706] (-304.076) (-302.819) (-302.726) * (-302.873) [-302.747] (-306.129) (-303.395) -- 0:00:59
106500 -- (-308.953) (-306.183) (-304.425) [-302.726] * [-303.036] (-304.475) (-302.854) (-303.606) -- 0:01:07
107000 -- (-308.818) (-302.680) (-305.850) [-303.759] * [-305.754] (-306.310) (-303.120) (-301.967) -- 0:01:06
107500 -- (-305.279) (-303.015) (-305.347) [-302.565] * (-307.135) (-307.146) (-306.718) [-302.490] -- 0:01:06
108000 -- (-310.205) (-304.198) [-302.567] (-306.127) * [-302.412] (-304.336) (-305.162) (-304.978) -- 0:01:06
108500 -- (-304.962) [-304.494] (-303.227) (-302.918) * [-302.974] (-302.328) (-305.066) (-302.499) -- 0:01:05
109000 -- (-303.369) [-305.152] (-305.257) (-301.999) * [-302.146] (-303.943) (-304.208) (-308.528) -- 0:01:05
109500 -- (-304.519) (-308.419) [-303.349] (-305.996) * (-311.135) (-303.768) (-306.119) [-304.674] -- 0:01:05
110000 -- (-305.938) (-307.472) [-303.049] (-302.128) * (-303.917) [-309.547] (-305.980) (-304.949) -- 0:01:04
Average standard deviation of split frequencies: 0.020872
110500 -- (-310.807) (-302.727) [-302.380] (-302.798) * (-302.264) (-305.053) [-302.948] (-306.464) -- 0:01:04
111000 -- [-303.114] (-303.370) (-308.664) (-304.452) * (-303.449) (-306.163) [-304.079] (-305.444) -- 0:01:04
111500 -- (-304.843) (-309.160) [-304.920] (-305.251) * [-303.948] (-307.241) (-305.964) (-305.942) -- 0:01:03
112000 -- [-302.292] (-305.844) (-305.151) (-304.052) * (-303.221) [-304.356] (-305.875) (-302.713) -- 0:01:03
112500 -- (-303.533) (-303.403) [-305.354] (-304.368) * [-304.254] (-304.426) (-306.174) (-304.823) -- 0:01:03
113000 -- (-302.595) [-303.908] (-302.875) (-308.005) * (-302.871) (-303.572) (-303.822) [-305.438] -- 0:01:02
113500 -- (-305.840) [-302.586] (-306.333) (-304.078) * (-303.291) (-309.583) [-304.131] (-306.939) -- 0:01:02
114000 -- (-307.149) [-304.419] (-304.817) (-309.503) * (-302.618) (-303.364) (-303.773) [-302.713] -- 0:01:02
114500 -- [-303.670] (-303.078) (-305.222) (-305.754) * (-303.122) (-304.070) [-303.613] (-304.347) -- 0:01:01
115000 -- (-303.317) (-306.331) (-302.723) [-302.629] * [-305.490] (-303.692) (-304.271) (-303.817) -- 0:01:01
Average standard deviation of split frequencies: 0.021945
115500 -- (-303.752) (-304.607) [-305.200] (-301.971) * (-303.465) [-303.555] (-304.512) (-305.013) -- 0:01:01
116000 -- [-307.786] (-302.528) (-303.386) (-304.064) * (-302.020) (-305.060) [-307.368] (-303.187) -- 0:01:00
116500 -- (-305.857) (-303.829) [-303.076] (-305.413) * (-302.890) (-303.117) (-305.282) [-304.223] -- 0:01:00
117000 -- (-303.748) (-306.008) (-302.591) [-306.291] * (-305.220) (-310.039) (-304.842) [-305.111] -- 0:01:00
117500 -- (-303.929) [-304.404] (-305.948) (-307.907) * [-310.696] (-308.748) (-303.028) (-303.871) -- 0:01:00
118000 -- [-302.720] (-302.429) (-304.117) (-304.833) * [-301.924] (-303.206) (-305.849) (-305.161) -- 0:00:59
118500 -- [-305.835] (-307.212) (-302.390) (-305.923) * (-304.028) (-307.295) [-304.716] (-304.347) -- 0:00:59
119000 -- (-304.507) (-308.059) [-304.396] (-303.460) * (-305.671) (-310.038) (-304.121) [-306.292] -- 0:00:59
119500 -- (-303.206) [-303.358] (-304.292) (-304.397) * (-308.988) (-303.504) [-305.950] (-312.771) -- 0:00:58
120000 -- [-302.068] (-307.534) (-304.529) (-303.860) * (-306.082) [-303.018] (-303.032) (-306.875) -- 0:00:58
Average standard deviation of split frequencies: 0.021580
120500 -- (-301.967) (-306.354) (-303.468) [-305.380] * (-304.918) (-303.805) (-302.724) [-302.604] -- 0:00:58
121000 -- (-307.536) (-302.387) (-304.237) [-303.947] * (-304.571) [-302.750] (-303.172) (-304.727) -- 0:00:58
121500 -- (-307.305) [-305.983] (-302.149) (-302.899) * (-302.846) (-306.524) [-304.441] (-303.162) -- 0:00:57
122000 -- (-303.172) [-309.974] (-302.962) (-303.721) * [-302.537] (-303.770) (-302.516) (-304.121) -- 0:00:57
122500 -- [-304.699] (-302.494) (-302.892) (-306.212) * (-304.400) (-302.650) (-304.732) [-303.544] -- 0:00:57
123000 -- (-303.542) (-303.624) (-303.425) [-306.711] * (-303.066) (-305.177) [-302.495] (-303.899) -- 0:01:04
123500 -- (-303.963) (-302.411) [-302.573] (-305.264) * [-306.469] (-306.238) (-301.964) (-304.080) -- 0:01:03
124000 -- (-303.792) (-304.091) [-302.708] (-307.027) * [-302.969] (-306.398) (-303.509) (-304.447) -- 0:01:03
124500 -- [-302.975] (-304.627) (-304.153) (-306.080) * [-305.080] (-302.941) (-302.054) (-304.034) -- 0:01:03
125000 -- (-303.963) (-305.262) (-303.217) [-302.714] * (-304.230) [-302.555] (-303.622) (-304.728) -- 0:01:03
Average standard deviation of split frequencies: 0.018885
125500 -- (-304.853) [-303.682] (-304.953) (-305.249) * (-303.122) [-303.459] (-304.692) (-303.941) -- 0:01:02
126000 -- (-308.454) (-303.790) [-302.019] (-307.985) * [-305.126] (-302.751) (-304.292) (-304.725) -- 0:01:02
126500 -- [-303.167] (-305.075) (-307.566) (-302.979) * (-303.306) (-305.891) [-311.748] (-305.749) -- 0:01:02
127000 -- [-303.762] (-303.279) (-304.882) (-302.564) * (-309.510) (-305.887) (-305.507) [-302.943] -- 0:01:01
127500 -- [-303.661] (-303.445) (-306.722) (-302.080) * (-302.813) (-305.192) (-307.570) [-304.392] -- 0:01:01
128000 -- (-305.306) [-304.029] (-302.414) (-302.414) * (-303.140) [-303.525] (-302.532) (-303.532) -- 0:01:01
128500 -- (-302.628) (-305.787) (-304.329) [-303.180] * (-309.486) (-306.352) (-302.489) [-304.808] -- 0:01:01
129000 -- [-305.491] (-303.545) (-303.469) (-303.722) * [-306.153] (-304.380) (-302.056) (-302.935) -- 0:01:00
129500 -- (-304.107) (-302.160) (-305.736) [-303.251] * (-304.202) (-302.431) (-303.592) [-304.182] -- 0:01:00
130000 -- (-307.598) [-302.032] (-304.420) (-302.519) * [-303.259] (-302.713) (-307.275) (-303.526) -- 0:01:00
Average standard deviation of split frequencies: 0.015118
130500 -- (-306.105) (-304.362) (-306.926) [-303.808] * [-303.490] (-302.426) (-303.394) (-305.356) -- 0:00:59
131000 -- (-305.086) (-304.963) [-304.010] (-309.021) * (-304.167) (-302.593) [-302.259] (-305.357) -- 0:00:59
131500 -- (-304.729) [-302.760] (-303.403) (-304.641) * (-304.803) (-303.617) (-303.176) [-303.671] -- 0:00:59
132000 -- (-303.697) [-302.718] (-304.305) (-307.684) * (-302.630) [-303.421] (-304.041) (-303.886) -- 0:00:59
132500 -- [-302.019] (-303.301) (-302.572) (-302.745) * (-302.593) [-303.997] (-302.151) (-305.251) -- 0:00:58
133000 -- [-302.770] (-306.818) (-307.202) (-307.144) * [-303.860] (-303.920) (-302.334) (-302.225) -- 0:00:58
133500 -- [-303.085] (-307.733) (-306.245) (-302.996) * (-305.236) (-303.788) [-303.491] (-303.146) -- 0:00:58
134000 -- (-307.520) [-302.292] (-303.894) (-305.720) * (-305.861) (-305.598) [-302.189] (-303.214) -- 0:00:58
134500 -- (-304.223) [-302.678] (-311.210) (-305.008) * (-303.611) [-304.165] (-305.609) (-304.035) -- 0:00:57
135000 -- (-304.973) [-302.569] (-304.158) (-306.365) * (-303.981) [-306.053] (-303.624) (-305.636) -- 0:00:57
Average standard deviation of split frequencies: 0.015142
135500 -- (-304.067) [-303.307] (-304.556) (-312.291) * (-304.606) (-302.386) (-304.277) [-304.639] -- 0:00:57
136000 -- (-303.422) (-302.664) (-303.945) [-303.705] * (-305.057) (-305.531) (-302.528) [-303.830] -- 0:00:57
136500 -- (-304.933) (-304.373) (-302.822) [-303.655] * (-303.502) [-303.926] (-302.727) (-304.771) -- 0:00:56
137000 -- (-305.391) (-310.841) (-305.089) [-302.593] * [-302.922] (-305.841) (-303.716) (-303.289) -- 0:00:56
137500 -- (-302.931) [-305.531] (-303.945) (-304.550) * (-304.772) (-303.176) (-306.184) [-303.291] -- 0:00:56
138000 -- (-303.131) [-305.117] (-304.557) (-304.464) * (-302.960) (-304.061) (-303.369) [-303.703] -- 0:00:56
138500 -- (-307.084) [-303.818] (-303.433) (-303.441) * (-304.263) [-302.812] (-307.292) (-303.911) -- 0:00:55
139000 -- (-310.234) (-306.027) (-303.935) [-303.683] * [-306.754] (-306.807) (-303.582) (-304.005) -- 0:00:55
139500 -- (-303.780) (-307.609) [-303.246] (-302.290) * [-303.920] (-305.090) (-306.885) (-305.205) -- 0:00:55
140000 -- [-302.673] (-303.139) (-305.310) (-305.495) * (-302.108) (-302.393) (-304.434) [-304.199] -- 0:00:55
Average standard deviation of split frequencies: 0.014992
140500 -- [-305.075] (-308.437) (-306.687) (-305.340) * (-305.753) [-304.551] (-304.751) (-304.804) -- 0:01:01
141000 -- (-302.553) (-304.184) [-303.012] (-303.157) * (-305.581) (-306.091) [-302.680] (-305.607) -- 0:01:00
141500 -- (-302.752) (-303.948) (-303.968) [-304.755] * (-308.242) (-304.390) (-303.419) [-304.648] -- 0:01:00
142000 -- [-304.120] (-306.803) (-307.929) (-305.173) * (-303.805) (-306.890) (-303.602) [-303.953] -- 0:01:00
142500 -- [-302.625] (-307.346) (-305.045) (-309.643) * (-305.453) [-303.412] (-306.095) (-304.916) -- 0:01:00
143000 -- (-302.493) (-305.484) (-306.415) [-304.082] * [-302.005] (-306.035) (-305.646) (-302.518) -- 0:00:59
143500 -- [-303.161] (-303.521) (-306.034) (-304.180) * (-303.152) [-307.026] (-304.323) (-307.426) -- 0:00:59
144000 -- (-303.238) (-306.923) (-302.254) [-304.000] * (-304.460) [-303.275] (-304.480) (-304.341) -- 0:00:59
144500 -- (-303.054) [-305.565] (-303.549) (-302.767) * [-303.267] (-304.382) (-304.553) (-302.351) -- 0:00:59
145000 -- (-304.977) (-303.747) [-302.935] (-302.290) * (-304.862) [-303.769] (-302.928) (-304.648) -- 0:00:58
Average standard deviation of split frequencies: 0.015124
145500 -- (-306.061) (-303.584) [-303.264] (-302.535) * (-305.274) (-304.469) (-306.657) [-302.699] -- 0:00:58
146000 -- (-306.589) (-303.998) (-303.339) [-302.398] * (-306.254) [-306.253] (-307.070) (-304.415) -- 0:00:58
146500 -- (-303.648) (-302.093) (-302.568) [-304.269] * (-305.802) (-302.412) [-304.792] (-306.186) -- 0:00:58
147000 -- (-302.718) (-303.401) [-303.607] (-303.280) * (-302.506) [-303.912] (-302.967) (-303.415) -- 0:00:58
147500 -- (-303.614) (-304.909) (-305.557) [-303.853] * [-303.062] (-302.967) (-304.949) (-304.969) -- 0:00:57
148000 -- (-306.438) (-306.403) (-304.875) [-306.597] * [-302.254] (-302.590) (-305.096) (-309.220) -- 0:00:57
148500 -- (-306.305) [-303.712] (-303.066) (-304.161) * (-306.168) (-301.860) [-303.421] (-305.471) -- 0:00:57
149000 -- (-303.518) (-305.893) [-307.817] (-306.858) * [-305.696] (-302.574) (-302.362) (-305.855) -- 0:00:57
149500 -- (-305.025) [-303.680] (-306.239) (-301.876) * [-303.644] (-303.974) (-302.942) (-304.522) -- 0:00:56
150000 -- [-307.468] (-306.943) (-308.496) (-302.351) * (-302.285) (-302.623) [-302.850] (-303.991) -- 0:00:56
Average standard deviation of split frequencies: 0.014253
150500 -- (-302.991) (-305.765) [-303.810] (-302.803) * (-303.742) [-302.396] (-302.139) (-303.575) -- 0:00:56
151000 -- (-307.015) [-305.071] (-310.787) (-306.484) * (-303.261) (-304.322) [-302.447] (-305.029) -- 0:00:56
151500 -- [-303.212] (-306.007) (-303.050) (-307.577) * (-303.911) [-306.430] (-303.544) (-302.458) -- 0:00:56
152000 -- (-306.149) [-302.854] (-302.691) (-302.741) * (-309.665) [-305.400] (-303.479) (-305.593) -- 0:00:55
152500 -- (-304.085) (-303.341) [-302.221] (-305.188) * (-304.546) (-304.263) [-302.873] (-303.393) -- 0:00:55
153000 -- (-302.964) (-302.684) [-305.386] (-305.037) * (-304.898) (-305.410) [-302.724] (-304.740) -- 0:00:55
153500 -- (-304.853) (-302.660) (-308.186) [-304.844] * (-308.759) [-304.769] (-305.072) (-304.318) -- 0:00:55
154000 -- (-303.100) (-303.093) [-307.631] (-303.830) * [-305.813] (-304.873) (-303.077) (-302.121) -- 0:00:54
154500 -- [-304.086] (-302.429) (-306.750) (-304.590) * (-303.472) [-303.802] (-304.090) (-302.178) -- 0:00:54
155000 -- (-302.966) (-303.859) (-304.822) [-302.517] * [-305.618] (-306.392) (-302.056) (-303.661) -- 0:00:54
Average standard deviation of split frequencies: 0.015109
155500 -- (-302.511) (-302.290) (-303.944) [-302.113] * (-303.556) (-305.426) [-303.086] (-306.932) -- 0:00:54
156000 -- (-304.611) [-304.525] (-311.080) (-302.383) * (-304.196) [-306.017] (-306.638) (-305.683) -- 0:00:54
156500 -- (-302.810) (-303.538) [-304.094] (-306.167) * (-302.892) (-305.489) [-303.453] (-303.447) -- 0:00:53
157000 -- (-302.042) (-304.842) (-302.889) [-303.286] * (-304.123) [-304.163] (-306.482) (-305.791) -- 0:00:59
157500 -- (-302.098) [-304.779] (-305.274) (-305.789) * [-304.218] (-305.677) (-307.289) (-305.749) -- 0:00:58
158000 -- [-306.505] (-305.773) (-306.111) (-304.242) * (-303.111) (-303.237) (-305.340) [-302.609] -- 0:00:58
158500 -- (-303.037) (-304.601) (-304.122) [-303.725] * (-304.074) (-304.789) [-303.733] (-306.477) -- 0:00:58
159000 -- [-303.189] (-304.734) (-302.830) (-305.443) * (-303.687) (-303.818) (-304.356) [-304.152] -- 0:00:58
159500 -- (-302.310) (-304.404) [-303.927] (-305.395) * (-303.750) [-302.129] (-308.716) (-302.079) -- 0:00:57
160000 -- [-303.113] (-305.060) (-304.470) (-305.371) * (-304.368) (-302.702) (-303.953) [-302.053] -- 0:00:57
Average standard deviation of split frequencies: 0.014825
160500 -- [-303.158] (-304.546) (-303.784) (-305.017) * [-303.035] (-305.778) (-304.559) (-302.991) -- 0:00:57
161000 -- (-304.673) (-302.080) (-302.412) [-304.582] * (-304.139) (-304.976) (-304.598) [-303.187] -- 0:00:57
161500 -- (-308.521) (-302.366) (-302.404) [-302.967] * (-302.849) [-303.672] (-305.606) (-303.073) -- 0:00:57
162000 -- (-304.022) [-304.608] (-303.048) (-304.197) * (-302.740) [-303.855] (-303.326) (-303.158) -- 0:00:56
162500 -- [-303.368] (-303.968) (-304.863) (-302.931) * (-303.022) (-304.624) [-302.823] (-305.674) -- 0:00:56
163000 -- [-305.284] (-304.990) (-302.566) (-303.059) * (-302.986) (-303.822) (-305.405) [-303.018] -- 0:00:56
163500 -- (-309.488) (-302.431) (-304.197) [-303.226] * [-302.645] (-304.118) (-305.092) (-304.183) -- 0:00:56
164000 -- (-303.352) (-302.378) [-303.847] (-302.703) * (-303.692) [-305.219] (-305.899) (-303.617) -- 0:00:56
164500 -- (-303.097) (-302.146) (-306.944) [-302.174] * (-301.991) (-304.600) [-302.858] (-307.552) -- 0:00:55
165000 -- (-305.152) (-304.512) (-305.314) [-305.527] * (-302.575) (-303.508) [-303.812] (-305.464) -- 0:00:55
Average standard deviation of split frequencies: 0.015544
165500 -- (-305.385) (-304.844) [-303.853] (-304.774) * [-303.259] (-304.069) (-304.110) (-304.247) -- 0:00:55
166000 -- (-303.311) [-302.321] (-302.549) (-302.742) * (-302.616) (-302.133) [-303.824] (-307.150) -- 0:00:55
166500 -- (-303.752) (-305.712) (-302.716) [-302.264] * (-303.217) [-303.532] (-303.772) (-308.594) -- 0:00:55
167000 -- (-303.555) [-305.124] (-303.320) (-305.258) * [-302.468] (-305.867) (-304.212) (-303.035) -- 0:00:54
167500 -- [-304.968] (-302.301) (-303.513) (-303.593) * (-302.972) [-305.736] (-309.735) (-305.865) -- 0:00:54
168000 -- (-307.059) (-307.200) [-306.658] (-305.011) * (-303.255) (-302.366) (-305.396) [-304.521] -- 0:00:54
168500 -- [-303.558] (-303.680) (-304.373) (-307.287) * (-302.420) (-303.015) (-303.551) [-304.588] -- 0:00:54
169000 -- (-304.029) (-306.155) (-303.574) [-302.731] * (-304.938) (-304.177) (-301.961) [-304.659] -- 0:00:54
169500 -- (-302.346) [-307.212] (-305.517) (-303.215) * (-309.433) (-303.505) (-304.883) [-305.134] -- 0:00:53
170000 -- [-305.511] (-302.660) (-305.726) (-304.424) * (-308.209) (-306.614) (-308.072) [-305.712] -- 0:00:53
Average standard deviation of split frequencies: 0.016158
170500 -- [-304.333] (-302.496) (-308.266) (-303.500) * (-306.379) (-305.630) [-303.671] (-305.954) -- 0:00:53
171000 -- (-303.541) (-302.057) [-306.671] (-303.317) * (-305.687) (-304.012) [-301.989] (-306.286) -- 0:00:53
171500 -- (-306.840) (-305.038) [-303.121] (-303.293) * [-302.753] (-304.408) (-302.947) (-309.408) -- 0:00:57
172000 -- (-302.956) (-306.264) [-303.093] (-305.882) * [-304.104] (-307.480) (-306.999) (-310.528) -- 0:00:57
172500 -- (-303.014) (-304.716) (-304.627) [-310.649] * (-305.169) (-303.627) (-303.226) [-303.186] -- 0:00:57
173000 -- (-304.582) (-303.609) [-307.994] (-305.068) * [-304.429] (-303.514) (-305.620) (-306.243) -- 0:00:57
173500 -- (-302.195) (-307.990) (-312.375) [-303.838] * [-304.578] (-302.857) (-306.142) (-304.624) -- 0:00:57
174000 -- (-302.572) (-307.647) (-309.868) [-304.069] * (-303.531) (-302.818) (-303.470) [-304.644] -- 0:00:56
174500 -- (-302.489) (-302.123) (-304.762) [-306.142] * (-304.547) (-303.604) [-305.056] (-304.853) -- 0:00:56
175000 -- (-302.149) [-306.576] (-307.133) (-307.563) * [-302.856] (-303.475) (-305.142) (-302.255) -- 0:00:56
Average standard deviation of split frequencies: 0.014880
175500 -- (-304.814) (-302.726) [-302.892] (-306.937) * (-304.853) (-304.364) (-304.639) [-302.819] -- 0:00:56
176000 -- [-305.064] (-304.604) (-307.705) (-308.553) * [-303.655] (-303.640) (-307.877) (-303.071) -- 0:00:56
176500 -- (-304.444) [-303.043] (-305.093) (-307.175) * (-302.226) (-304.298) (-302.738) [-305.611] -- 0:00:55
177000 -- (-306.446) [-303.224] (-303.958) (-303.877) * (-306.319) (-304.707) [-302.472] (-304.446) -- 0:00:55
177500 -- (-303.016) (-302.164) [-304.973] (-304.036) * (-306.374) [-305.643] (-306.086) (-304.407) -- 0:00:55
178000 -- (-302.751) (-302.979) (-304.198) [-304.168] * (-306.092) (-305.935) [-304.965] (-303.463) -- 0:00:55
178500 -- (-303.324) (-305.776) [-303.288] (-303.903) * (-303.859) (-302.634) [-304.180] (-302.951) -- 0:00:55
179000 -- (-303.102) (-302.950) [-304.155] (-307.759) * (-306.249) (-304.676) [-306.226] (-305.000) -- 0:00:55
179500 -- (-304.142) [-304.002] (-306.394) (-303.179) * (-303.191) [-302.961] (-306.994) (-304.242) -- 0:00:54
180000 -- (-304.347) (-305.113) (-311.454) [-303.211] * (-305.766) (-304.039) (-305.265) [-305.170] -- 0:00:54
Average standard deviation of split frequencies: 0.016235
180500 -- (-305.067) [-303.787] (-309.993) (-302.496) * (-304.975) (-303.106) [-304.810] (-307.730) -- 0:00:54
181000 -- (-303.016) (-302.951) (-303.358) [-304.615] * (-303.643) (-306.203) (-302.921) [-303.954] -- 0:00:54
181500 -- (-307.632) (-302.500) (-302.909) [-305.112] * (-304.500) (-304.377) [-305.147] (-303.050) -- 0:00:54
182000 -- (-303.896) (-306.531) (-305.658) [-303.602] * [-305.397] (-303.056) (-303.184) (-304.039) -- 0:00:53
182500 -- (-303.743) (-311.727) (-303.407) [-305.600] * [-302.599] (-306.697) (-303.503) (-310.512) -- 0:00:53
183000 -- (-306.680) (-307.556) (-306.070) [-308.500] * [-303.143] (-304.590) (-302.575) (-306.030) -- 0:00:53
183500 -- (-302.544) (-307.851) [-303.801] (-302.921) * [-302.581] (-303.707) (-307.555) (-303.933) -- 0:00:53
184000 -- (-306.977) (-306.217) (-302.683) [-303.003] * [-302.287] (-304.020) (-303.203) (-307.603) -- 0:00:53
184500 -- (-305.139) (-302.346) (-302.959) [-303.746] * (-304.690) [-302.221] (-302.101) (-306.915) -- 0:00:53
185000 -- (-305.639) (-303.421) [-304.323] (-302.760) * (-302.530) (-303.873) [-302.268] (-306.838) -- 0:00:52
Average standard deviation of split frequencies: 0.014673
185500 -- (-302.593) (-305.632) [-306.554] (-305.865) * (-305.312) (-302.422) (-304.624) [-306.061] -- 0:00:52
186000 -- (-301.994) [-305.387] (-311.533) (-304.564) * (-303.974) (-303.513) [-304.514] (-303.463) -- 0:00:52
186500 -- (-303.742) (-303.027) [-302.776] (-302.981) * [-304.059] (-302.862) (-302.518) (-305.152) -- 0:00:52
187000 -- (-305.333) [-307.339] (-305.476) (-306.458) * (-305.707) (-306.699) (-305.049) [-306.211] -- 0:00:52
187500 -- (-303.921) [-303.202] (-306.925) (-306.851) * (-303.701) (-305.647) [-305.532] (-305.445) -- 0:00:52
188000 -- (-305.689) (-304.205) [-303.105] (-306.106) * (-303.988) (-303.009) (-311.455) [-303.182] -- 0:00:51
188500 -- (-304.791) [-302.721] (-304.966) (-309.098) * (-306.384) (-303.830) [-303.506] (-302.630) -- 0:00:55
189000 -- [-302.843] (-303.083) (-303.459) (-302.972) * (-307.936) [-302.741] (-303.794) (-304.585) -- 0:00:55
189500 -- (-305.632) [-305.899] (-303.888) (-305.855) * (-305.221) (-310.908) [-302.534] (-305.301) -- 0:00:55
190000 -- [-303.915] (-307.373) (-304.293) (-305.249) * (-307.851) [-307.698] (-303.861) (-306.117) -- 0:00:55
Average standard deviation of split frequencies: 0.013403
190500 -- [-302.768] (-306.204) (-304.616) (-304.115) * (-304.750) (-303.804) [-303.128] (-303.589) -- 0:00:55
191000 -- (-303.460) [-305.050] (-302.883) (-304.192) * (-304.567) (-304.803) (-305.045) [-302.997] -- 0:00:55
191500 -- [-303.005] (-302.533) (-303.219) (-306.250) * (-307.369) [-303.535] (-302.759) (-303.064) -- 0:00:54
192000 -- (-304.013) (-302.703) (-305.805) [-302.706] * (-308.562) [-303.663] (-304.139) (-304.601) -- 0:00:54
192500 -- [-305.103] (-302.055) (-307.068) (-302.621) * [-308.658] (-304.264) (-304.760) (-303.713) -- 0:00:54
193000 -- (-306.666) (-304.997) [-303.333] (-304.252) * (-302.554) (-304.720) [-304.960] (-303.288) -- 0:00:54
193500 -- (-304.874) [-303.988] (-304.850) (-305.184) * (-303.371) [-304.465] (-305.184) (-303.693) -- 0:00:54
194000 -- (-301.975) [-308.454] (-305.967) (-305.231) * (-305.213) (-305.163) (-302.662) [-304.532] -- 0:00:54
194500 -- (-304.703) (-304.132) [-304.728] (-302.947) * (-307.176) [-305.904] (-302.523) (-303.926) -- 0:00:53
195000 -- [-304.095] (-303.010) (-303.854) (-305.738) * (-303.988) (-302.149) (-305.162) [-304.199] -- 0:00:53
Average standard deviation of split frequencies: 0.013763
195500 -- (-310.300) [-306.646] (-305.492) (-304.383) * [-304.522] (-310.227) (-304.844) (-303.603) -- 0:00:53
196000 -- (-303.580) [-303.708] (-304.141) (-307.298) * (-304.287) (-303.858) [-302.928] (-301.966) -- 0:00:53
196500 -- (-304.360) (-305.110) [-303.300] (-305.769) * (-305.356) (-303.839) [-304.691] (-305.462) -- 0:00:53
197000 -- (-304.411) (-307.975) [-303.810] (-303.628) * (-304.344) (-303.770) [-303.415] (-306.792) -- 0:00:52
197500 -- (-306.782) (-306.591) (-307.440) [-302.483] * (-304.486) [-304.211] (-305.109) (-302.546) -- 0:00:52
198000 -- (-302.579) [-303.932] (-305.346) (-304.405) * [-305.795] (-302.337) (-303.675) (-302.757) -- 0:00:52
198500 -- [-302.668] (-303.050) (-305.396) (-304.830) * (-304.079) (-304.096) [-303.294] (-302.745) -- 0:00:52
199000 -- [-306.600] (-303.780) (-304.969) (-305.164) * (-304.363) (-306.925) (-304.153) [-305.783] -- 0:00:52
199500 -- [-309.422] (-307.910) (-311.639) (-305.801) * (-304.935) (-306.511) (-307.239) [-306.855] -- 0:00:52
200000 -- [-306.009] (-304.491) (-304.538) (-303.838) * (-302.754) [-305.293] (-302.681) (-302.722) -- 0:00:51
Average standard deviation of split frequencies: 0.014748
200500 -- (-303.529) [-303.722] (-302.547) (-304.399) * (-303.689) (-304.199) [-302.201] (-301.821) -- 0:00:51
201000 -- (-307.877) [-305.504] (-303.530) (-303.735) * (-305.060) [-303.260] (-305.703) (-305.926) -- 0:00:51
201500 -- (-309.271) [-304.338] (-303.006) (-303.401) * [-304.830] (-303.316) (-304.819) (-304.512) -- 0:00:51
202000 -- (-308.074) (-305.895) (-307.511) [-303.289] * (-307.127) (-304.772) (-305.549) [-306.479] -- 0:00:51
202500 -- (-302.560) [-303.205] (-305.349) (-302.599) * (-303.521) [-303.859] (-303.893) (-303.316) -- 0:00:51
203000 -- (-302.057) (-304.262) [-305.033] (-303.212) * [-303.499] (-305.110) (-303.865) (-304.215) -- 0:00:51
203500 -- (-306.884) (-305.699) (-304.748) [-302.176] * (-307.941) (-305.329) (-305.833) [-304.338] -- 0:00:50
204000 -- (-302.018) (-310.924) [-302.366] (-309.505) * [-307.413] (-305.583) (-305.474) (-307.503) -- 0:00:50
204500 -- (-303.750) (-309.495) (-302.929) [-305.268] * (-305.673) [-303.590] (-306.816) (-304.479) -- 0:00:50
205000 -- (-305.052) (-308.832) (-305.749) [-304.381] * (-303.850) [-302.940] (-305.134) (-309.497) -- 0:00:50
Average standard deviation of split frequencies: 0.014747
205500 -- (-304.503) (-309.337) (-302.370) [-303.379] * [-303.291] (-305.847) (-303.933) (-304.673) -- 0:00:54
206000 -- (-305.771) (-303.412) [-306.929] (-302.641) * (-303.757) (-302.405) [-302.552] (-305.577) -- 0:00:53
206500 -- (-305.541) [-304.941] (-303.684) (-305.215) * [-304.728] (-302.648) (-302.906) (-307.243) -- 0:00:53
207000 -- (-305.667) [-302.922] (-303.227) (-303.534) * (-304.263) (-302.450) [-304.578] (-304.831) -- 0:00:53
207500 -- (-303.655) [-306.534] (-305.407) (-303.370) * (-304.705) (-302.125) (-302.664) [-304.927] -- 0:00:53
208000 -- (-303.439) (-304.804) [-305.406] (-303.359) * (-304.865) (-303.241) [-304.020] (-302.464) -- 0:00:53
208500 -- (-302.498) (-302.561) [-303.781] (-305.428) * (-304.501) (-304.463) (-303.214) [-302.876] -- 0:00:53
209000 -- [-307.106] (-303.118) (-307.040) (-304.812) * [-303.324] (-303.405) (-305.056) (-304.224) -- 0:00:52
209500 -- (-305.516) (-303.663) [-304.793] (-304.404) * (-305.266) (-302.271) [-303.190] (-303.436) -- 0:00:52
210000 -- (-301.948) [-303.774] (-304.739) (-304.393) * [-303.226] (-302.032) (-304.551) (-304.990) -- 0:00:52
Average standard deviation of split frequencies: 0.014172
210500 -- (-303.444) (-305.228) [-304.988] (-302.477) * (-306.189) [-304.925] (-302.933) (-302.334) -- 0:00:52
211000 -- (-302.246) (-305.356) [-303.636] (-305.120) * (-305.019) [-303.018] (-304.632) (-303.992) -- 0:00:52
211500 -- (-304.722) (-302.896) [-303.721] (-303.381) * [-304.410] (-303.695) (-304.120) (-306.292) -- 0:00:52
212000 -- (-303.969) [-304.057] (-302.896) (-302.761) * [-302.316] (-303.056) (-306.379) (-304.193) -- 0:00:52
212500 -- [-302.172] (-304.974) (-305.639) (-304.488) * [-304.533] (-304.144) (-306.722) (-303.910) -- 0:00:51
213000 -- (-304.335) (-305.380) (-309.176) [-303.753] * (-303.495) (-304.906) [-304.465] (-302.025) -- 0:00:51
213500 -- (-307.083) (-309.248) (-304.874) [-303.800] * [-306.367] (-308.809) (-310.230) (-304.245) -- 0:00:51
214000 -- (-304.427) (-304.840) [-304.619] (-306.510) * (-305.038) (-303.806) [-303.624] (-309.533) -- 0:00:51
214500 -- (-303.909) [-304.070] (-306.449) (-306.892) * (-305.689) [-303.328] (-304.004) (-304.787) -- 0:00:51
215000 -- [-305.999] (-303.458) (-304.952) (-304.909) * (-303.460) [-307.949] (-306.342) (-303.551) -- 0:00:51
Average standard deviation of split frequencies: 0.016946
215500 -- (-304.845) (-304.619) (-307.457) [-306.359] * [-305.651] (-303.974) (-302.063) (-306.111) -- 0:00:50
216000 -- (-302.692) (-303.427) (-304.236) [-303.905] * (-303.468) [-302.590] (-307.837) (-303.238) -- 0:00:50
216500 -- [-305.023] (-303.380) (-304.252) (-303.528) * (-305.779) (-303.142) (-307.049) [-304.120] -- 0:00:50
217000 -- [-303.375] (-305.769) (-305.867) (-306.651) * (-306.105) [-302.425] (-303.748) (-303.702) -- 0:00:50
217500 -- [-305.046] (-303.057) (-304.874) (-307.592) * (-307.745) [-304.083] (-308.658) (-303.387) -- 0:00:50
218000 -- [-303.539] (-303.063) (-303.355) (-303.651) * (-302.816) (-304.677) (-302.457) [-303.952] -- 0:00:50
218500 -- (-304.004) (-305.975) [-303.557] (-303.096) * (-307.436) (-303.947) (-303.264) [-303.661] -- 0:00:50
219000 -- (-306.812) (-307.046) [-302.349] (-302.901) * (-303.154) (-306.517) (-306.012) [-304.124] -- 0:00:49
219500 -- (-302.591) (-306.979) (-305.852) [-303.905] * (-304.335) [-303.763] (-306.511) (-304.996) -- 0:00:49
220000 -- (-305.216) (-305.709) (-304.188) [-306.231] * [-302.256] (-303.332) (-308.264) (-305.089) -- 0:00:49
Average standard deviation of split frequencies: 0.018221
220500 -- (-303.645) [-308.429] (-304.874) (-308.574) * (-304.041) [-306.801] (-304.985) (-305.685) -- 0:00:49
221000 -- [-303.188] (-307.697) (-303.169) (-304.213) * [-304.392] (-302.947) (-310.326) (-303.413) -- 0:00:49
221500 -- (-303.558) (-306.836) [-303.366] (-305.325) * (-302.227) (-304.945) [-307.896] (-304.038) -- 0:00:52
222000 -- (-303.960) [-302.584] (-302.902) (-305.852) * (-303.361) [-306.548] (-312.453) (-303.987) -- 0:00:52
222500 -- (-304.432) (-309.485) [-306.632] (-302.929) * [-302.993] (-302.196) (-302.040) (-303.404) -- 0:00:52
223000 -- [-305.500] (-304.224) (-308.795) (-305.451) * (-302.640) [-303.786] (-305.638) (-304.346) -- 0:00:52
223500 -- (-308.399) (-302.301) [-305.456] (-302.937) * [-304.581] (-305.560) (-303.170) (-303.448) -- 0:00:52
224000 -- [-307.698] (-306.527) (-302.634) (-305.729) * (-304.508) (-304.286) (-305.675) [-302.476] -- 0:00:51
224500 -- [-303.304] (-306.308) (-304.074) (-304.278) * (-306.084) (-304.115) [-304.022] (-304.360) -- 0:00:51
225000 -- (-307.226) (-303.534) [-305.068] (-305.969) * (-304.771) [-302.478] (-304.068) (-302.488) -- 0:00:51
Average standard deviation of split frequencies: 0.018773
225500 -- (-304.265) [-303.157] (-304.005) (-307.366) * (-305.405) (-302.483) [-302.784] (-302.582) -- 0:00:51
226000 -- (-303.843) (-306.054) (-303.784) [-302.934] * (-305.851) (-302.913) [-305.226] (-304.773) -- 0:00:51
226500 -- [-304.910] (-304.424) (-304.689) (-303.175) * (-304.316) (-305.665) (-304.776) [-303.101] -- 0:00:51
227000 -- (-304.918) (-306.955) (-303.554) [-302.750] * (-303.095) [-305.887] (-303.911) (-304.697) -- 0:00:51
227500 -- (-307.415) [-304.310] (-306.895) (-308.444) * (-302.922) (-303.351) (-304.799) [-306.234] -- 0:00:50
228000 -- (-305.045) [-304.125] (-307.085) (-302.779) * (-302.437) [-306.752] (-304.891) (-306.942) -- 0:00:50
228500 -- (-305.459) (-304.180) (-305.282) [-305.301] * (-304.645) (-308.330) (-305.845) [-305.736] -- 0:00:50
229000 -- (-306.793) (-302.951) (-305.501) [-305.996] * [-303.143] (-304.759) (-303.981) (-304.346) -- 0:00:50
229500 -- [-304.255] (-302.860) (-309.487) (-303.879) * [-302.331] (-303.020) (-303.340) (-302.075) -- 0:00:50
230000 -- (-306.287) (-304.025) [-306.194] (-303.977) * (-303.933) (-305.241) (-303.138) [-303.616] -- 0:00:50
Average standard deviation of split frequencies: 0.018273
230500 -- (-305.379) [-302.910] (-303.431) (-303.828) * (-303.182) (-307.251) (-304.521) [-303.715] -- 0:00:50
231000 -- (-304.979) [-303.517] (-304.507) (-305.901) * [-303.420] (-307.360) (-303.563) (-306.277) -- 0:00:49
231500 -- (-309.318) [-302.927] (-305.948) (-303.487) * (-302.296) [-306.618] (-303.245) (-305.263) -- 0:00:49
232000 -- [-305.427] (-304.575) (-303.240) (-304.649) * (-302.532) [-303.335] (-304.300) (-302.296) -- 0:00:49
232500 -- (-306.665) (-304.426) (-306.265) [-302.541] * (-302.604) (-304.995) (-304.869) [-302.546] -- 0:00:49
233000 -- [-304.436] (-304.751) (-305.755) (-305.231) * (-303.064) [-304.623] (-303.559) (-305.549) -- 0:00:49
233500 -- (-303.924) (-302.714) [-304.868] (-303.936) * [-306.884] (-303.641) (-305.720) (-307.437) -- 0:00:49
234000 -- [-304.573] (-302.623) (-304.538) (-304.132) * (-302.827) (-305.657) [-306.361] (-302.594) -- 0:00:49
234500 -- (-304.871) (-304.616) (-306.010) [-303.607] * (-303.197) (-303.255) (-304.335) [-304.894] -- 0:00:48
235000 -- (-302.140) [-305.962] (-308.545) (-304.268) * (-309.509) [-307.783] (-304.782) (-303.746) -- 0:00:52
Average standard deviation of split frequencies: 0.017977
235500 -- (-305.864) (-302.813) [-307.129] (-306.927) * (-305.849) (-305.829) (-307.309) [-303.816] -- 0:00:51
236000 -- [-303.059] (-304.014) (-303.500) (-303.640) * (-302.921) (-303.208) (-305.928) [-301.920] -- 0:00:51
236500 -- (-308.101) [-303.468] (-302.374) (-304.761) * (-303.091) [-305.276] (-302.949) (-302.582) -- 0:00:51
237000 -- (-306.448) (-303.837) [-303.725] (-303.052) * (-304.851) (-303.383) [-304.107] (-304.030) -- 0:00:51
237500 -- (-304.975) [-305.490] (-305.190) (-302.605) * (-310.164) (-306.347) [-305.338] (-304.107) -- 0:00:51
238000 -- (-304.542) (-302.946) (-306.367) [-301.992] * (-303.488) (-306.448) (-304.962) [-303.776] -- 0:00:51
238500 -- [-304.641] (-305.124) (-306.774) (-302.759) * (-305.361) (-305.294) [-303.210] (-303.169) -- 0:00:51
239000 -- (-306.249) (-303.186) (-303.147) [-303.902] * (-303.957) [-305.501] (-304.208) (-307.322) -- 0:00:50
239500 -- (-304.068) (-303.895) [-303.606] (-302.653) * (-306.448) (-304.026) [-301.982] (-303.392) -- 0:00:50
240000 -- (-302.661) (-302.824) [-304.754] (-306.237) * [-305.788] (-304.051) (-303.525) (-304.375) -- 0:00:50
Average standard deviation of split frequencies: 0.018064
240500 -- [-303.514] (-304.671) (-305.589) (-304.356) * (-305.038) (-304.003) [-305.908] (-303.490) -- 0:00:50
241000 -- (-305.421) (-307.513) (-307.018) [-303.490] * (-304.089) [-304.582] (-305.575) (-308.415) -- 0:00:50
241500 -- (-304.938) (-307.821) [-304.831] (-304.890) * [-303.270] (-305.916) (-302.698) (-303.658) -- 0:00:50
242000 -- (-306.569) (-304.402) (-306.176) [-303.755] * (-305.741) [-304.948] (-306.430) (-303.734) -- 0:00:50
242500 -- (-303.373) (-304.448) (-303.416) [-307.233] * (-304.974) (-305.677) (-310.294) [-306.227] -- 0:00:49
243000 -- (-306.577) [-303.699] (-302.719) (-303.999) * (-304.126) (-309.163) (-303.540) [-303.552] -- 0:00:49
243500 -- [-303.809] (-303.972) (-303.818) (-304.976) * (-305.343) (-303.247) (-306.166) [-303.362] -- 0:00:49
244000 -- (-305.355) (-306.445) (-303.691) [-305.120] * (-307.318) (-306.301) (-306.359) [-302.890] -- 0:00:49
244500 -- (-303.973) (-305.068) [-306.056] (-303.286) * (-305.237) [-304.704] (-310.638) (-306.216) -- 0:00:49
245000 -- [-305.985] (-305.294) (-302.635) (-301.842) * (-304.616) [-303.372] (-306.356) (-305.802) -- 0:00:49
Average standard deviation of split frequencies: 0.017852
245500 -- (-307.903) (-303.812) [-302.361] (-302.311) * (-307.450) (-304.557) [-305.393] (-302.798) -- 0:00:49
246000 -- [-305.448] (-304.522) (-302.838) (-302.360) * (-304.076) (-303.046) (-302.485) [-305.454] -- 0:00:49
246500 -- (-303.912) (-308.298) [-303.148] (-304.315) * (-304.455) (-303.006) (-304.014) [-305.698] -- 0:00:48
247000 -- (-304.472) [-306.347] (-303.197) (-305.462) * (-303.991) (-305.068) (-303.099) [-305.030] -- 0:00:48
247500 -- [-303.326] (-302.896) (-304.275) (-304.337) * (-303.911) (-305.480) (-304.707) [-304.467] -- 0:00:48
248000 -- (-304.378) [-305.421] (-304.597) (-303.766) * (-306.370) (-302.310) [-302.621] (-305.589) -- 0:00:48
248500 -- (-303.549) (-305.931) [-302.696] (-306.790) * (-308.219) [-304.932] (-302.655) (-304.219) -- 0:00:48
249000 -- (-303.063) [-306.953] (-306.107) (-305.411) * (-305.746) (-302.892) [-310.353] (-305.735) -- 0:00:48
249500 -- [-305.998] (-304.612) (-307.551) (-304.431) * (-307.454) (-302.056) [-304.273] (-305.155) -- 0:00:48
250000 -- (-305.880) [-304.903] (-307.289) (-304.271) * (-305.883) (-306.511) [-302.028] (-303.944) -- 0:00:51
Average standard deviation of split frequencies: 0.017618
250500 -- (-305.470) (-306.084) (-308.484) [-305.420] * [-302.827] (-303.210) (-304.157) (-302.747) -- 0:00:50
251000 -- (-305.566) (-303.242) (-309.466) [-306.493] * [-304.335] (-304.622) (-307.926) (-307.730) -- 0:00:50
251500 -- (-303.499) [-305.464] (-307.136) (-305.477) * (-303.608) [-302.811] (-305.021) (-303.317) -- 0:00:50
252000 -- (-305.179) [-305.557] (-314.047) (-307.800) * [-303.272] (-303.193) (-307.954) (-302.425) -- 0:00:50
252500 -- [-303.227] (-305.519) (-305.064) (-311.776) * (-306.321) [-304.302] (-302.250) (-308.758) -- 0:00:50
253000 -- (-306.366) (-304.856) [-304.176] (-309.513) * (-306.442) (-304.301) (-302.336) [-302.556] -- 0:00:50
253500 -- (-305.152) (-305.174) (-304.180) [-303.384] * (-303.471) (-305.685) (-306.577) [-304.550] -- 0:00:50
254000 -- (-302.618) [-304.447] (-306.742) (-305.082) * [-303.901] (-305.669) (-304.343) (-307.873) -- 0:00:49
254500 -- (-305.828) [-304.563] (-302.625) (-303.489) * [-306.865] (-303.205) (-304.328) (-309.198) -- 0:00:49
255000 -- (-305.097) (-306.960) (-302.056) [-305.264] * (-303.819) [-303.978] (-305.853) (-305.954) -- 0:00:49
Average standard deviation of split frequencies: 0.016368
255500 -- [-304.690] (-306.089) (-304.835) (-304.077) * (-302.701) (-304.587) (-304.612) [-304.863] -- 0:00:49
256000 -- (-303.071) [-307.349] (-305.720) (-303.702) * [-304.909] (-303.973) (-304.526) (-305.352) -- 0:00:49
256500 -- (-306.398) [-306.409] (-303.141) (-303.727) * (-307.224) (-304.359) [-304.040] (-306.097) -- 0:00:49
257000 -- (-303.797) (-304.819) (-304.146) [-305.195] * (-302.419) (-302.923) (-305.845) [-306.284] -- 0:00:49
257500 -- (-305.221) (-303.415) (-303.471) [-304.823] * (-304.343) (-306.061) [-306.020] (-306.438) -- 0:00:49
258000 -- (-304.980) (-307.040) [-305.193] (-302.611) * (-303.586) [-308.028] (-305.063) (-304.993) -- 0:00:48
258500 -- (-302.407) [-302.500] (-303.276) (-303.901) * (-306.394) [-303.560] (-303.892) (-304.716) -- 0:00:48
259000 -- (-303.570) [-305.220] (-302.854) (-303.755) * (-304.784) [-303.297] (-303.317) (-305.283) -- 0:00:48
259500 -- (-302.579) (-304.330) (-302.759) [-303.664] * (-302.048) (-304.636) [-302.230] (-303.500) -- 0:00:48
260000 -- (-301.879) (-303.229) (-306.080) [-304.212] * (-302.257) (-303.318) (-302.508) [-302.793] -- 0:00:48
Average standard deviation of split frequencies: 0.018185
260500 -- (-303.494) (-303.540) (-306.824) [-303.274] * (-302.732) (-307.213) (-303.532) [-302.357] -- 0:00:48
261000 -- (-303.577) (-303.305) (-304.027) [-307.771] * (-302.495) (-304.636) (-303.286) [-304.514] -- 0:00:48
261500 -- (-302.151) [-302.811] (-307.999) (-304.255) * (-303.308) [-302.233] (-305.198) (-303.663) -- 0:00:48
262000 -- [-304.437] (-304.078) (-307.192) (-307.815) * [-304.311] (-303.926) (-304.916) (-302.296) -- 0:00:47
262500 -- (-306.019) (-310.856) [-304.353] (-304.614) * [-303.643] (-304.560) (-304.240) (-302.894) -- 0:00:47
263000 -- (-307.842) (-307.600) (-306.709) [-305.783] * (-304.997) [-303.465] (-304.830) (-303.023) -- 0:00:47
263500 -- (-304.470) [-303.082] (-305.625) (-303.855) * [-306.062] (-303.303) (-304.949) (-306.991) -- 0:00:47
264000 -- (-304.901) (-309.703) (-302.701) [-302.603] * (-305.245) [-302.691] (-306.236) (-305.328) -- 0:00:47
264500 -- (-302.980) (-311.083) [-303.406] (-302.504) * (-304.924) (-303.680) (-303.865) [-304.820] -- 0:00:47
265000 -- [-303.737] (-304.326) (-306.462) (-303.601) * (-302.320) (-306.491) [-304.929] (-303.977) -- 0:00:49
Average standard deviation of split frequencies: 0.019494
265500 -- (-302.308) (-306.986) (-306.144) [-304.508] * (-306.474) (-304.114) (-306.066) [-304.671] -- 0:00:49
266000 -- (-303.672) (-305.886) (-304.525) [-303.305] * [-304.951] (-303.764) (-303.304) (-302.504) -- 0:00:49
266500 -- (-306.835) (-303.481) [-305.649] (-305.151) * (-306.505) [-303.497] (-304.560) (-303.862) -- 0:00:49
267000 -- (-306.919) (-305.854) [-303.811] (-308.645) * [-303.079] (-304.513) (-305.894) (-303.710) -- 0:00:49
267500 -- (-303.094) (-307.542) (-307.482) [-303.305] * (-308.966) (-306.065) (-303.210) [-303.202] -- 0:00:49
268000 -- [-305.504] (-304.966) (-304.117) (-304.044) * [-303.904] (-303.884) (-303.184) (-304.198) -- 0:00:49
268500 -- [-307.108] (-304.008) (-304.727) (-303.905) * [-303.408] (-305.209) (-303.524) (-303.272) -- 0:00:49
269000 -- (-303.848) (-303.877) [-304.251] (-303.196) * (-302.921) (-302.822) (-306.838) [-305.587] -- 0:00:48
269500 -- (-305.237) (-302.322) [-303.614] (-308.858) * (-303.992) [-303.184] (-308.043) (-308.265) -- 0:00:48
270000 -- (-307.435) [-303.256] (-309.115) (-307.506) * (-303.559) (-303.601) [-302.792] (-304.739) -- 0:00:48
Average standard deviation of split frequencies: 0.019255
270500 -- [-303.034] (-304.482) (-305.979) (-303.802) * (-303.394) (-305.302) (-304.928) [-302.710] -- 0:00:48
271000 -- (-304.326) (-304.275) (-304.629) [-302.767] * (-303.671) (-308.942) [-302.664] (-302.888) -- 0:00:48
271500 -- (-302.426) (-304.350) (-303.844) [-304.473] * [-302.882] (-303.141) (-304.975) (-303.423) -- 0:00:48
272000 -- (-305.197) [-303.136] (-302.767) (-307.869) * (-304.774) (-304.565) [-303.166] (-304.851) -- 0:00:48
272500 -- (-304.014) (-302.002) [-303.148] (-303.756) * [-307.060] (-302.809) (-303.756) (-305.440) -- 0:00:48
273000 -- [-303.864] (-303.705) (-303.424) (-304.617) * (-303.935) (-303.743) (-303.620) [-302.219] -- 0:00:47
273500 -- (-305.542) [-301.989] (-303.169) (-303.871) * (-306.968) (-305.525) [-302.873] (-304.003) -- 0:00:47
274000 -- (-309.146) (-303.515) [-303.980] (-303.735) * (-310.409) [-304.924] (-303.730) (-303.479) -- 0:00:47
274500 -- (-305.144) (-303.518) (-303.783) [-304.337] * (-305.815) (-304.738) (-304.826) [-303.132] -- 0:00:47
275000 -- (-305.229) [-303.691] (-303.784) (-303.689) * (-302.823) [-305.236] (-303.450) (-303.537) -- 0:00:47
Average standard deviation of split frequencies: 0.018313
275500 -- [-305.134] (-306.904) (-303.456) (-304.046) * (-308.789) (-308.706) [-305.369] (-306.393) -- 0:00:47
276000 -- [-303.042] (-302.776) (-305.350) (-304.821) * [-303.373] (-309.391) (-306.433) (-303.787) -- 0:00:47
276500 -- (-303.456) (-303.878) (-304.172) [-303.837] * [-304.563] (-302.709) (-306.512) (-305.081) -- 0:00:47
277000 -- (-305.087) [-302.908] (-304.908) (-303.535) * (-304.906) (-303.341) [-304.529] (-305.250) -- 0:00:46
277500 -- (-306.387) [-305.375] (-302.260) (-304.849) * [-303.626] (-311.777) (-304.274) (-305.160) -- 0:00:46
278000 -- (-305.584) (-305.647) (-306.553) [-303.421] * [-303.844] (-303.476) (-305.608) (-303.315) -- 0:00:46
278500 -- (-307.212) (-304.841) (-302.287) [-303.095] * (-302.902) (-302.728) (-306.055) [-306.517] -- 0:00:46
279000 -- [-304.131] (-305.006) (-302.168) (-303.664) * [-302.520] (-303.283) (-309.950) (-305.192) -- 0:00:46
279500 -- (-303.439) (-302.734) (-303.719) [-304.214] * (-303.601) [-302.430] (-303.381) (-307.019) -- 0:00:46
280000 -- (-306.020) (-302.704) [-303.541] (-303.260) * (-303.498) (-304.458) (-302.641) [-305.437] -- 0:00:46
Average standard deviation of split frequencies: 0.017822
280500 -- (-304.180) (-305.065) (-302.693) [-303.916] * (-304.952) [-302.719] (-307.452) (-308.326) -- 0:00:48
281000 -- (-305.760) (-303.963) [-302.946] (-304.009) * (-306.825) (-304.933) [-303.217] (-303.626) -- 0:00:48
281500 -- (-309.442) (-303.898) [-303.225] (-306.019) * (-305.523) (-302.428) (-303.203) [-303.977] -- 0:00:48
282000 -- [-305.717] (-303.549) (-304.201) (-303.356) * [-304.969] (-302.393) (-302.706) (-305.795) -- 0:00:48
282500 -- (-304.803) (-304.006) (-308.166) [-306.931] * (-304.137) [-303.072] (-302.445) (-304.682) -- 0:00:48
283000 -- [-306.258] (-303.557) (-302.512) (-302.424) * (-304.000) (-305.320) (-302.834) [-306.227] -- 0:00:48
283500 -- (-303.613) (-302.744) [-303.843] (-305.044) * (-304.697) (-306.860) (-306.054) [-308.962] -- 0:00:48
284000 -- (-302.387) (-305.231) (-307.341) [-303.336] * (-305.310) (-308.742) (-305.140) [-303.654] -- 0:00:47
284500 -- (-302.884) (-304.874) (-302.813) [-304.394] * [-302.971] (-304.825) (-303.263) (-304.481) -- 0:00:47
285000 -- (-304.960) (-305.581) [-304.403] (-306.451) * (-303.416) (-305.040) (-304.263) [-304.703] -- 0:00:47
Average standard deviation of split frequencies: 0.017307
285500 -- (-303.402) [-305.937] (-306.298) (-304.164) * (-305.177) (-302.964) [-302.993] (-305.758) -- 0:00:47
286000 -- (-302.242) (-305.772) (-305.497) [-303.402] * (-305.439) (-303.713) [-304.356] (-305.253) -- 0:00:47
286500 -- (-305.394) [-306.130] (-304.119) (-303.801) * [-305.830] (-304.781) (-302.963) (-304.398) -- 0:00:47
287000 -- (-302.915) [-307.532] (-302.450) (-305.232) * (-302.529) [-306.018] (-305.182) (-305.305) -- 0:00:47
287500 -- (-304.476) (-304.081) [-303.623] (-303.295) * [-304.318] (-305.663) (-306.566) (-303.029) -- 0:00:47
288000 -- [-304.123] (-305.103) (-304.216) (-306.316) * (-304.086) (-303.914) (-312.565) [-304.062] -- 0:00:46
288500 -- (-304.872) [-304.102] (-303.833) (-302.285) * [-303.690] (-306.625) (-304.793) (-302.442) -- 0:00:46
289000 -- (-303.617) [-302.487] (-303.512) (-306.788) * (-304.742) (-304.368) (-306.648) [-303.394] -- 0:00:46
289500 -- (-305.149) [-303.473] (-303.548) (-303.511) * (-305.553) (-305.625) [-305.885] (-303.377) -- 0:00:46
290000 -- [-303.617] (-304.057) (-302.061) (-305.020) * (-306.204) (-303.540) (-305.247) [-303.700] -- 0:00:46
Average standard deviation of split frequencies: 0.016038
290500 -- [-302.752] (-304.325) (-302.129) (-306.728) * (-305.764) (-302.840) (-302.565) [-302.568] -- 0:00:46
291000 -- [-302.905] (-304.619) (-301.983) (-302.432) * [-309.029] (-305.581) (-304.786) (-302.515) -- 0:00:46
291500 -- [-303.544] (-303.880) (-303.333) (-302.646) * (-304.051) (-308.375) (-305.085) [-307.331] -- 0:00:46
292000 -- (-302.321) [-304.743] (-303.364) (-304.146) * [-304.617] (-303.854) (-303.146) (-305.220) -- 0:00:46
292500 -- [-307.735] (-304.671) (-305.053) (-305.279) * (-304.044) (-305.581) (-303.919) [-305.285] -- 0:00:45
293000 -- (-302.068) [-304.035] (-304.110) (-305.382) * [-302.975] (-305.522) (-303.641) (-304.590) -- 0:00:45
293500 -- [-306.216] (-304.014) (-303.471) (-302.857) * (-305.620) (-306.228) (-303.487) [-302.055] -- 0:00:45
294000 -- (-305.440) (-305.630) (-305.903) [-304.940] * [-305.495] (-303.716) (-304.090) (-306.202) -- 0:00:45
294500 -- [-303.526] (-303.803) (-303.571) (-307.673) * (-303.552) (-305.070) [-303.520] (-304.439) -- 0:00:45
295000 -- (-302.480) (-307.236) (-305.619) [-306.190] * (-307.640) (-304.911) (-307.299) [-302.107] -- 0:00:45
Average standard deviation of split frequencies: 0.016191
295500 -- (-305.609) (-304.502) (-305.564) [-304.036] * (-303.598) (-303.628) (-303.400) [-304.321] -- 0:00:45
296000 -- (-302.304) (-304.620) (-302.266) [-304.789] * (-303.147) (-303.117) [-304.805] (-303.527) -- 0:00:45
296500 -- (-303.715) (-307.750) [-303.973] (-303.264) * (-306.393) [-304.981] (-303.483) (-302.704) -- 0:00:45
297000 -- [-305.565] (-303.678) (-306.273) (-302.878) * (-304.403) [-302.446] (-305.594) (-308.874) -- 0:00:44
297500 -- [-306.255] (-305.370) (-306.286) (-303.110) * (-304.820) [-302.803] (-304.816) (-304.236) -- 0:00:44
298000 -- (-304.487) (-304.262) (-306.153) [-305.619] * (-304.191) (-303.636) (-305.924) [-307.597] -- 0:00:47
298500 -- (-302.988) (-305.247) (-305.123) [-304.688] * (-303.255) (-302.738) [-304.321] (-303.194) -- 0:00:47
299000 -- [-302.038] (-303.376) (-305.945) (-310.686) * (-302.751) [-303.871] (-310.641) (-306.181) -- 0:00:46
299500 -- (-303.159) (-305.845) [-303.816] (-309.213) * (-305.332) [-302.524] (-306.020) (-306.156) -- 0:00:46
300000 -- (-303.864) [-302.897] (-302.561) (-303.760) * (-304.823) (-302.225) [-303.880] (-303.447) -- 0:00:46
Average standard deviation of split frequencies: 0.016724
300500 -- (-303.857) (-304.008) (-303.081) [-302.952] * (-303.876) (-304.902) [-307.406] (-305.830) -- 0:00:46
301000 -- (-304.511) [-302.166] (-305.126) (-305.388) * (-304.359) (-304.453) [-304.104] (-302.352) -- 0:00:46
301500 -- (-307.992) (-302.661) [-303.490] (-307.605) * (-304.846) [-304.145] (-305.167) (-303.732) -- 0:00:46
302000 -- (-303.298) (-306.317) (-303.151) [-304.154] * [-307.453] (-303.827) (-305.149) (-303.596) -- 0:00:46
302500 -- [-303.352] (-304.161) (-302.708) (-307.067) * (-304.945) (-305.727) [-303.657] (-302.953) -- 0:00:46
303000 -- (-303.015) [-301.965] (-303.008) (-306.360) * [-303.644] (-306.809) (-305.657) (-304.239) -- 0:00:46
303500 -- (-303.145) (-303.874) [-305.528] (-306.128) * (-303.974) [-304.910] (-305.926) (-302.759) -- 0:00:45
304000 -- [-302.862] (-304.139) (-303.385) (-303.515) * (-306.054) [-303.856] (-304.032) (-303.015) -- 0:00:45
304500 -- [-303.862] (-304.244) (-305.129) (-304.163) * (-304.032) (-302.601) [-302.823] (-302.887) -- 0:00:45
305000 -- (-304.776) (-302.849) [-307.281] (-306.623) * [-303.549] (-302.832) (-303.950) (-302.440) -- 0:00:45
Average standard deviation of split frequencies: 0.018230
305500 -- (-304.838) [-302.737] (-303.705) (-304.422) * (-305.939) (-303.122) [-303.278] (-305.920) -- 0:00:45
306000 -- [-303.418] (-303.371) (-305.110) (-305.429) * [-305.740] (-306.188) (-304.507) (-304.423) -- 0:00:45
306500 -- (-306.745) (-305.536) [-302.274] (-303.950) * (-303.862) (-305.801) (-304.462) [-303.496] -- 0:00:45
307000 -- (-306.505) (-304.713) (-305.742) [-303.718] * (-306.082) (-304.154) (-303.287) [-305.601] -- 0:00:45
307500 -- [-304.484] (-305.494) (-310.652) (-309.230) * (-304.348) (-305.738) [-305.071] (-306.674) -- 0:00:45
308000 -- (-304.639) (-304.171) (-303.872) [-304.215] * (-306.601) (-305.003) [-303.130] (-306.300) -- 0:00:44
308500 -- (-303.336) (-309.006) [-304.892] (-302.636) * (-303.833) (-305.190) (-308.106) [-304.002] -- 0:00:44
309000 -- [-302.708] (-302.907) (-309.547) (-302.726) * (-305.178) (-305.164) (-303.033) [-304.881] -- 0:00:44
309500 -- (-305.832) (-303.558) [-302.358] (-306.264) * (-306.843) (-310.981) [-305.278] (-303.600) -- 0:00:44
310000 -- (-303.872) (-304.428) (-306.423) [-303.187] * (-305.899) (-309.635) (-302.868) [-302.064] -- 0:00:44
Average standard deviation of split frequencies: 0.017197
310500 -- (-304.480) (-308.005) (-304.484) [-303.485] * (-306.934) (-305.969) [-302.159] (-303.255) -- 0:00:44
311000 -- (-302.551) [-307.917] (-303.446) (-302.947) * (-303.527) (-302.765) [-302.166] (-304.254) -- 0:00:44
311500 -- (-302.511) (-303.703) (-303.197) [-302.838] * [-304.715] (-304.727) (-302.201) (-309.281) -- 0:00:44
312000 -- (-303.099) (-305.345) (-304.020) [-302.571] * (-305.627) (-305.373) (-304.751) [-304.359] -- 0:00:44
312500 -- (-305.001) (-304.205) [-303.326] (-303.708) * [-307.481] (-303.214) (-303.542) (-303.313) -- 0:00:44
313000 -- [-303.799] (-302.899) (-304.003) (-305.022) * (-302.294) (-308.518) [-303.431] (-303.387) -- 0:00:43
313500 -- [-303.942] (-303.974) (-303.416) (-305.277) * (-302.777) [-302.464] (-304.763) (-303.045) -- 0:00:43
314000 -- [-302.820] (-305.746) (-302.367) (-303.319) * (-305.567) (-305.460) (-307.624) [-303.775] -- 0:00:43
314500 -- [-303.933] (-304.244) (-308.608) (-303.220) * [-302.807] (-304.339) (-302.904) (-305.416) -- 0:00:43
315000 -- (-308.803) (-304.662) (-303.366) [-302.448] * [-303.369] (-303.181) (-307.322) (-304.064) -- 0:00:45
Average standard deviation of split frequencies: 0.017156
315500 -- (-307.682) [-305.192] (-306.241) (-307.195) * (-303.972) (-305.660) [-304.055] (-307.299) -- 0:00:45
316000 -- (-304.903) (-306.331) (-303.943) [-308.300] * [-302.938] (-304.881) (-303.139) (-303.842) -- 0:00:45
316500 -- (-303.796) (-302.423) (-303.335) [-302.458] * (-305.131) [-304.768] (-304.078) (-305.184) -- 0:00:45
317000 -- (-303.776) (-308.541) [-302.825] (-302.870) * (-304.771) (-305.435) (-303.224) [-306.554] -- 0:00:45
317500 -- [-303.172] (-305.076) (-303.936) (-303.886) * (-303.809) (-308.220) (-305.305) [-302.667] -- 0:00:45
318000 -- (-306.319) (-303.237) (-303.737) [-303.890] * (-306.150) (-303.064) [-304.988] (-302.493) -- 0:00:45
318500 -- (-306.503) [-303.252] (-303.010) (-305.034) * (-305.568) [-303.689] (-303.687) (-307.470) -- 0:00:44
319000 -- (-304.885) (-305.080) (-303.067) [-304.396] * (-302.639) [-303.245] (-302.837) (-303.218) -- 0:00:44
319500 -- (-304.664) [-302.947] (-302.107) (-302.554) * (-303.462) (-307.415) [-304.018] (-303.079) -- 0:00:44
320000 -- (-306.090) [-302.995] (-304.977) (-302.326) * (-304.817) (-304.299) (-307.903) [-305.459] -- 0:00:44
Average standard deviation of split frequencies: 0.016253
320500 -- [-302.627] (-302.270) (-302.386) (-304.148) * (-303.637) (-304.824) (-305.652) [-305.671] -- 0:00:44
321000 -- (-301.856) (-302.827) [-303.451] (-306.929) * (-305.841) (-302.586) (-305.446) [-304.908] -- 0:00:44
321500 -- (-305.034) [-308.720] (-302.794) (-306.146) * (-303.456) [-302.656] (-306.305) (-306.637) -- 0:00:44
322000 -- (-306.422) (-306.205) [-302.503] (-305.024) * (-303.935) (-304.526) (-303.177) [-304.813] -- 0:00:44
322500 -- (-305.041) (-305.028) [-303.179] (-307.710) * (-303.688) [-304.577] (-307.103) (-307.002) -- 0:00:44
323000 -- (-303.788) (-306.433) [-307.724] (-304.523) * (-303.103) (-303.369) [-304.112] (-306.620) -- 0:00:44
323500 -- (-302.628) (-302.520) (-306.041) [-303.843] * (-302.142) (-305.485) [-306.120] (-309.620) -- 0:00:43
324000 -- [-303.997] (-309.518) (-305.827) (-303.165) * (-303.157) (-307.836) [-303.384] (-304.801) -- 0:00:43
324500 -- [-304.619] (-306.016) (-303.340) (-303.639) * (-302.551) (-306.013) (-303.366) [-302.694] -- 0:00:43
325000 -- (-304.077) [-308.320] (-304.859) (-308.449) * [-302.890] (-310.766) (-308.853) (-303.608) -- 0:00:43
Average standard deviation of split frequencies: 0.015424
325500 -- (-302.297) (-304.824) (-303.840) [-303.933] * (-303.103) (-303.632) [-302.129] (-306.844) -- 0:00:43
326000 -- (-302.641) [-303.637] (-304.661) (-302.855) * [-303.569] (-306.851) (-306.386) (-302.970) -- 0:00:43
326500 -- [-304.493] (-304.417) (-305.066) (-304.037) * [-304.970] (-306.907) (-303.881) (-305.221) -- 0:00:43
327000 -- (-303.757) (-303.165) [-306.642] (-305.366) * (-305.182) (-307.408) [-302.889] (-306.972) -- 0:00:43
327500 -- (-303.563) (-306.123) (-303.940) [-304.581] * [-304.489] (-303.468) (-303.399) (-302.886) -- 0:00:43
328000 -- (-303.237) [-303.295] (-303.649) (-304.163) * (-304.887) [-303.396] (-305.728) (-303.170) -- 0:00:43
328500 -- [-305.713] (-302.505) (-304.103) (-303.456) * (-305.575) [-307.459] (-303.049) (-303.558) -- 0:00:42
329000 -- [-303.891] (-303.393) (-304.001) (-303.938) * (-305.972) [-303.572] (-303.603) (-302.938) -- 0:00:42
329500 -- (-305.238) (-303.202) (-306.770) [-304.365] * (-303.765) (-305.073) (-302.638) [-302.825] -- 0:00:42
330000 -- [-303.510] (-304.290) (-305.226) (-305.072) * (-306.397) [-303.513] (-303.544) (-303.134) -- 0:00:42
Average standard deviation of split frequencies: 0.015603
330500 -- [-304.365] (-305.211) (-303.222) (-302.775) * [-303.757] (-303.811) (-305.817) (-304.886) -- 0:00:42
331000 -- (-304.162) (-304.064) (-304.034) [-307.860] * (-304.257) (-306.497) [-304.363] (-302.934) -- 0:00:42
331500 -- (-303.206) (-305.893) [-303.512] (-303.893) * (-305.082) (-302.854) (-306.623) [-306.031] -- 0:00:42
332000 -- (-306.237) (-305.369) [-303.851] (-306.017) * [-303.991] (-302.798) (-303.290) (-307.623) -- 0:00:44
332500 -- [-305.657] (-302.912) (-304.789) (-303.583) * (-302.785) (-303.713) [-302.474] (-308.023) -- 0:00:44
333000 -- [-304.185] (-302.624) (-302.865) (-305.379) * [-302.449] (-303.985) (-304.789) (-304.215) -- 0:00:44
333500 -- [-304.599] (-303.566) (-304.862) (-303.200) * (-303.484) (-302.296) (-305.226) [-302.972] -- 0:00:43
334000 -- (-303.204) (-303.957) (-303.676) [-304.370] * (-303.279) [-303.844] (-304.761) (-303.596) -- 0:00:43
334500 -- (-303.587) (-303.507) (-307.008) [-302.794] * (-304.563) (-304.241) (-303.980) [-303.544] -- 0:00:43
335000 -- (-304.767) [-302.771] (-303.143) (-302.951) * (-306.275) (-303.368) [-302.677] (-305.657) -- 0:00:43
Average standard deviation of split frequencies: 0.014809
335500 -- (-304.598) (-304.651) [-303.334] (-304.002) * (-306.902) (-303.703) (-305.813) [-302.053] -- 0:00:43
336000 -- (-304.124) (-304.861) (-303.390) [-305.170] * [-304.637] (-302.349) (-305.355) (-307.495) -- 0:00:43
336500 -- [-305.349] (-302.821) (-303.237) (-303.045) * (-305.440) [-304.694] (-302.462) (-305.163) -- 0:00:43
337000 -- (-303.607) (-311.050) [-304.812] (-303.788) * [-304.045] (-307.583) (-302.278) (-306.750) -- 0:00:43
337500 -- [-305.514] (-307.872) (-305.718) (-303.576) * [-303.054] (-305.036) (-303.301) (-304.154) -- 0:00:43
338000 -- (-307.150) (-308.874) [-302.973] (-302.706) * [-307.592] (-306.083) (-302.061) (-303.428) -- 0:00:43
338500 -- (-309.834) [-308.176] (-304.432) (-302.024) * (-304.905) (-302.302) [-302.084] (-304.089) -- 0:00:42
339000 -- (-304.654) (-305.988) (-305.221) [-304.565] * (-305.865) (-306.346) [-303.802] (-305.063) -- 0:00:42
339500 -- (-311.070) (-304.128) [-302.713] (-307.222) * (-303.764) [-308.229] (-303.843) (-305.217) -- 0:00:42
340000 -- (-304.148) (-304.856) (-303.055) [-308.130] * (-303.478) (-304.828) [-304.772] (-303.859) -- 0:00:42
Average standard deviation of split frequencies: 0.014001
340500 -- (-306.890) (-304.825) [-304.215] (-304.262) * [-302.287] (-306.351) (-307.167) (-305.727) -- 0:00:42
341000 -- [-310.254] (-305.838) (-305.219) (-305.862) * [-304.509] (-307.677) (-303.357) (-305.951) -- 0:00:42
341500 -- [-303.787] (-309.119) (-306.646) (-304.631) * (-305.719) (-308.026) [-302.163] (-302.604) -- 0:00:42
342000 -- [-307.436] (-304.692) (-305.348) (-302.588) * (-303.254) [-305.320] (-306.019) (-303.723) -- 0:00:42
342500 -- (-307.070) [-302.238] (-303.403) (-306.868) * [-303.419] (-306.411) (-304.611) (-302.603) -- 0:00:42
343000 -- (-302.884) (-303.268) (-304.894) [-303.327] * (-305.876) (-303.085) [-307.195] (-302.489) -- 0:00:42
343500 -- [-303.082] (-304.761) (-305.794) (-303.736) * (-304.762) (-303.037) [-302.651] (-302.337) -- 0:00:42
344000 -- [-302.394] (-302.760) (-303.534) (-307.922) * (-303.071) [-305.205] (-303.636) (-303.057) -- 0:00:41
344500 -- (-302.773) (-302.515) (-302.777) [-307.470] * (-307.680) (-305.601) (-303.393) [-309.118] -- 0:00:41
345000 -- [-303.352] (-305.822) (-304.076) (-304.128) * [-303.156] (-304.601) (-303.080) (-303.550) -- 0:00:41
Average standard deviation of split frequencies: 0.014457
345500 -- (-302.653) (-306.135) (-303.027) [-302.477] * (-305.527) (-306.155) (-305.117) [-303.419] -- 0:00:41
346000 -- (-302.880) [-303.908] (-304.624) (-308.936) * (-302.637) [-304.356] (-303.999) (-309.682) -- 0:00:41
346500 -- (-303.146) (-306.240) (-305.249) [-302.562] * (-303.006) [-305.246] (-303.711) (-307.318) -- 0:00:41
347000 -- (-306.550) (-302.911) (-307.036) [-303.876] * (-302.818) (-306.975) [-304.173] (-306.610) -- 0:00:41
347500 -- (-306.082) [-302.796] (-303.771) (-306.905) * (-301.858) (-303.611) (-303.959) [-303.797] -- 0:00:41
348000 -- (-304.892) [-303.282] (-305.533) (-305.312) * (-305.522) (-304.990) (-303.433) [-305.374] -- 0:00:41
348500 -- (-304.261) (-304.116) (-307.927) [-303.229] * (-303.129) (-303.559) [-306.473] (-304.228) -- 0:00:41
349000 -- (-305.340) [-305.840] (-305.766) (-303.183) * (-304.594) (-305.832) (-302.856) [-307.836] -- 0:00:42
349500 -- (-307.631) (-304.030) [-305.661] (-305.431) * (-304.831) (-304.063) (-304.973) [-308.254] -- 0:00:42
350000 -- (-302.055) (-304.519) [-302.121] (-305.406) * (-309.191) [-303.838] (-304.589) (-302.118) -- 0:00:42
Average standard deviation of split frequencies: 0.014190
350500 -- (-302.837) [-304.278] (-302.122) (-303.316) * (-306.035) (-302.974) [-302.174] (-305.373) -- 0:00:42
351000 -- (-302.418) [-306.212] (-303.672) (-302.780) * (-303.762) (-302.552) (-302.280) [-305.981] -- 0:00:42
351500 -- (-303.597) (-303.849) [-304.852] (-302.726) * (-303.403) (-303.851) (-302.406) [-304.477] -- 0:00:42
352000 -- (-303.257) (-303.094) [-305.537] (-306.339) * (-302.558) (-302.977) [-304.157] (-304.409) -- 0:00:42
352500 -- (-302.766) (-305.911) [-304.083] (-302.342) * (-313.443) (-306.623) [-304.729] (-306.573) -- 0:00:42
353000 -- (-303.923) (-304.521) (-306.005) [-306.141] * (-305.758) [-302.147] (-304.242) (-310.605) -- 0:00:42
353500 -- (-304.540) (-304.221) [-306.632] (-307.003) * [-305.474] (-304.740) (-303.612) (-305.434) -- 0:00:42
354000 -- (-303.399) [-303.358] (-303.313) (-308.521) * (-305.375) (-306.553) [-302.617] (-304.801) -- 0:00:41
354500 -- [-305.269] (-306.581) (-304.860) (-302.376) * [-303.649] (-302.407) (-305.977) (-306.547) -- 0:00:41
355000 -- (-302.848) (-305.057) (-304.527) [-302.511] * (-304.753) [-305.938] (-304.835) (-308.944) -- 0:00:41
Average standard deviation of split frequencies: 0.014198
355500 -- (-306.621) [-307.232] (-305.754) (-305.017) * (-303.160) [-303.872] (-302.731) (-304.389) -- 0:00:41
356000 -- (-302.172) (-308.496) [-305.853] (-303.746) * (-304.325) [-302.584] (-303.970) (-309.233) -- 0:00:41
356500 -- (-301.957) [-304.706] (-306.895) (-303.750) * (-303.638) [-303.413] (-304.554) (-310.368) -- 0:00:41
357000 -- (-303.605) [-305.881] (-302.225) (-302.158) * [-303.405] (-303.567) (-304.437) (-307.693) -- 0:00:41
357500 -- [-303.462] (-304.684) (-304.382) (-310.483) * [-303.732] (-307.267) (-304.122) (-306.514) -- 0:00:41
358000 -- (-302.836) (-303.426) (-303.193) [-304.980] * [-302.170] (-305.659) (-303.251) (-304.078) -- 0:00:41
358500 -- [-304.058] (-304.173) (-303.329) (-305.864) * (-304.628) (-303.442) [-305.203] (-308.220) -- 0:00:41
359000 -- (-303.815) [-303.656] (-306.717) (-304.614) * (-306.460) (-303.110) (-304.052) [-303.611] -- 0:00:41
359500 -- (-304.263) (-302.885) [-303.838] (-305.614) * (-304.067) (-303.846) [-302.963] (-303.497) -- 0:00:40
360000 -- (-307.450) [-303.129] (-304.748) (-304.424) * [-305.731] (-305.737) (-303.606) (-303.523) -- 0:00:40
Average standard deviation of split frequencies: 0.013685
360500 -- [-302.836] (-305.797) (-303.440) (-305.927) * (-303.046) [-304.918] (-304.275) (-302.464) -- 0:00:40
361000 -- [-307.507] (-304.583) (-303.982) (-305.722) * (-308.818) (-303.545) [-303.120] (-303.923) -- 0:00:40
361500 -- [-303.595] (-302.259) (-308.176) (-302.886) * (-308.985) (-313.052) [-302.725] (-305.382) -- 0:00:40
362000 -- [-306.688] (-303.062) (-312.004) (-303.588) * (-305.235) [-302.867] (-303.643) (-305.699) -- 0:00:40
362500 -- (-302.126) (-305.806) (-309.922) [-303.608] * (-302.673) (-303.686) [-305.367] (-304.055) -- 0:00:40
363000 -- (-305.200) (-304.807) [-304.064] (-303.981) * (-304.951) [-303.158] (-305.120) (-303.387) -- 0:00:40
363500 -- (-303.240) (-305.629) (-303.238) [-304.565] * [-305.436] (-302.310) (-304.555) (-306.156) -- 0:00:40
364000 -- (-304.351) (-305.237) (-305.695) [-302.806] * (-303.615) (-307.713) (-302.636) [-303.469] -- 0:00:40
364500 -- (-302.957) [-303.672] (-305.809) (-311.314) * [-304.032] (-306.729) (-303.475) (-305.178) -- 0:00:40
365000 -- (-306.579) (-303.656) [-305.015] (-305.084) * [-304.642] (-305.096) (-305.063) (-309.243) -- 0:00:40
Average standard deviation of split frequencies: 0.013638
365500 -- (-302.835) (-304.374) [-304.478] (-305.805) * (-304.096) (-302.968) [-303.291] (-302.422) -- 0:00:39
366000 -- (-303.352) [-304.883] (-307.967) (-302.957) * (-304.869) (-305.526) (-303.666) [-302.949] -- 0:00:39
366500 -- (-307.750) (-304.914) (-303.130) [-301.962] * (-304.114) [-307.872] (-307.269) (-303.460) -- 0:00:41
367000 -- (-307.093) [-303.343] (-302.895) (-305.901) * (-308.188) (-303.995) [-306.876] (-303.518) -- 0:00:41
367500 -- (-303.871) (-304.093) [-303.432] (-307.113) * (-308.446) [-303.349] (-304.905) (-303.708) -- 0:00:41
368000 -- (-304.199) (-303.475) (-303.719) [-304.073] * (-310.920) (-305.327) [-302.834] (-303.860) -- 0:00:41
368500 -- (-307.159) (-308.342) (-302.146) [-305.219] * (-311.740) (-303.050) [-308.001] (-304.569) -- 0:00:41
369000 -- (-305.171) (-304.526) [-303.654] (-302.935) * (-305.716) (-306.630) [-305.389] (-303.599) -- 0:00:41
369500 -- (-306.645) (-309.476) [-302.040] (-304.648) * (-305.488) (-303.118) [-304.002] (-303.872) -- 0:00:40
370000 -- (-307.007) (-301.988) [-304.356] (-303.216) * [-302.844] (-302.107) (-305.447) (-302.972) -- 0:00:40
Average standard deviation of split frequencies: 0.013495
370500 -- (-304.120) [-305.108] (-307.262) (-303.141) * [-305.565] (-301.930) (-303.190) (-303.922) -- 0:00:40
371000 -- (-311.146) (-303.530) (-305.020) [-303.161] * (-303.415) (-305.840) (-302.079) [-308.130] -- 0:00:40
371500 -- (-304.464) (-305.369) (-305.121) [-303.162] * (-303.890) [-305.613] (-302.966) (-307.500) -- 0:00:40
372000 -- (-303.525) (-304.382) [-302.583] (-302.765) * [-303.219] (-304.092) (-303.916) (-305.253) -- 0:00:40
372500 -- (-302.524) [-304.353] (-302.063) (-304.879) * (-304.349) [-305.577] (-305.139) (-302.300) -- 0:00:40
373000 -- (-303.690) (-305.115) [-302.580] (-302.230) * (-303.176) (-305.260) (-304.854) [-303.303] -- 0:00:40
373500 -- (-306.678) (-304.559) [-302.309] (-305.154) * [-306.861] (-308.354) (-303.811) (-303.562) -- 0:00:40
374000 -- (-302.871) (-303.700) (-302.938) [-303.857] * (-303.403) [-306.018] (-304.717) (-308.077) -- 0:00:40
374500 -- (-302.279) (-303.278) (-309.176) [-307.627] * (-305.655) [-303.354] (-302.858) (-303.848) -- 0:00:40
375000 -- [-302.396] (-304.808) (-307.578) (-306.967) * [-305.363] (-305.059) (-308.550) (-305.149) -- 0:00:40
Average standard deviation of split frequencies: 0.014348
375500 -- (-305.107) (-305.008) (-305.160) [-303.572] * (-302.430) (-304.607) (-305.222) [-305.427] -- 0:00:39
376000 -- (-304.400) (-312.988) (-304.364) [-304.491] * (-304.196) (-304.967) [-303.910] (-306.431) -- 0:00:39
376500 -- (-304.143) (-303.310) [-302.944] (-304.990) * (-310.924) (-303.959) [-303.288] (-304.634) -- 0:00:39
377000 -- (-303.652) [-304.987] (-306.738) (-304.488) * (-308.775) [-303.269] (-304.771) (-306.704) -- 0:00:39
377500 -- (-303.062) [-303.812] (-306.558) (-304.429) * [-302.310] (-302.853) (-304.614) (-308.269) -- 0:00:39
378000 -- (-305.513) [-304.034] (-304.057) (-304.595) * [-302.266] (-302.716) (-304.542) (-309.707) -- 0:00:39
378500 -- (-304.914) [-305.913] (-302.708) (-305.483) * (-303.506) (-304.076) (-303.880) [-304.596] -- 0:00:39
379000 -- (-307.591) [-305.309] (-305.352) (-303.531) * [-302.839] (-303.957) (-303.295) (-303.643) -- 0:00:39
379500 -- (-304.948) (-303.287) (-305.204) [-307.008] * [-302.637] (-302.885) (-303.005) (-303.101) -- 0:00:39
380000 -- [-304.265] (-306.784) (-302.554) (-306.998) * [-305.161] (-308.565) (-304.187) (-305.380) -- 0:00:39
Average standard deviation of split frequencies: 0.013966
380500 -- (-305.163) (-303.320) (-305.201) [-302.978] * (-305.620) (-306.837) (-305.997) [-308.418] -- 0:00:39
381000 -- (-303.314) [-304.868] (-304.609) (-304.409) * [-304.808] (-315.045) (-303.149) (-303.175) -- 0:00:38
381500 -- (-302.178) (-303.168) (-305.013) [-304.904] * (-307.074) [-303.526] (-304.738) (-302.739) -- 0:00:38
382000 -- (-305.205) [-306.827] (-305.871) (-306.821) * (-306.657) (-303.241) (-304.646) [-305.402] -- 0:00:38
382500 -- (-304.416) (-304.062) [-306.391] (-308.883) * (-303.860) (-307.756) (-305.543) [-304.356] -- 0:00:38
383000 -- (-307.010) (-304.465) [-308.220] (-307.675) * (-303.837) [-303.937] (-305.057) (-304.474) -- 0:00:38
383500 -- [-304.113] (-302.373) (-304.601) (-305.196) * (-301.918) [-303.947] (-306.726) (-303.830) -- 0:00:40
384000 -- (-304.132) [-305.813] (-304.780) (-305.558) * [-302.863] (-305.598) (-302.310) (-305.892) -- 0:00:40
384500 -- (-306.959) (-304.050) [-305.551] (-303.211) * (-304.925) (-307.472) [-302.063] (-303.190) -- 0:00:40
385000 -- (-305.079) (-306.058) [-305.310] (-307.159) * (-303.234) [-304.511] (-303.077) (-302.775) -- 0:00:39
Average standard deviation of split frequencies: 0.013977
385500 -- (-304.242) (-308.857) (-302.592) [-304.402] * [-303.075] (-305.328) (-302.577) (-303.083) -- 0:00:39
386000 -- (-304.144) (-303.611) (-308.899) [-302.496] * (-304.004) (-305.581) (-304.073) [-306.096] -- 0:00:39
386500 -- (-304.804) [-303.061] (-306.467) (-302.959) * [-302.385] (-304.428) (-304.016) (-304.351) -- 0:00:39
387000 -- (-305.139) (-303.006) [-305.353] (-304.576) * [-302.174] (-304.400) (-307.103) (-305.980) -- 0:00:39
387500 -- (-304.944) (-303.503) [-304.415] (-307.959) * [-303.005] (-307.258) (-304.826) (-305.763) -- 0:00:39
388000 -- [-303.125] (-307.050) (-308.828) (-304.466) * (-304.740) [-304.883] (-302.377) (-305.888) -- 0:00:39
388500 -- (-305.714) (-302.525) (-303.459) [-304.257] * (-304.169) [-305.593] (-308.796) (-303.776) -- 0:00:39
389000 -- (-303.282) (-304.527) [-304.069] (-303.345) * (-307.515) (-303.117) (-305.469) [-302.747] -- 0:00:39
389500 -- [-304.347] (-302.973) (-305.897) (-305.285) * (-306.347) (-303.827) (-305.854) [-302.239] -- 0:00:39
390000 -- (-305.260) [-303.161] (-307.332) (-303.530) * (-308.849) (-307.417) (-306.932) [-302.171] -- 0:00:39
Average standard deviation of split frequencies: 0.013810
390500 -- (-305.795) (-304.882) (-303.111) [-309.022] * (-304.585) (-307.727) (-303.463) [-307.056] -- 0:00:39
391000 -- [-306.780] (-307.504) (-312.118) (-307.065) * (-305.174) [-304.319] (-305.070) (-304.859) -- 0:00:38
391500 -- (-305.360) (-308.817) (-305.233) [-304.334] * [-303.905] (-306.439) (-308.310) (-305.342) -- 0:00:38
392000 -- (-304.243) (-303.384) [-304.703] (-304.192) * (-303.700) [-305.663] (-308.614) (-306.080) -- 0:00:38
392500 -- (-307.460) (-308.147) (-303.249) [-304.027] * (-308.129) [-302.257] (-304.279) (-303.857) -- 0:00:38
393000 -- (-303.271) [-306.801] (-304.875) (-304.204) * (-303.519) [-303.803] (-303.799) (-302.007) -- 0:00:38
393500 -- (-304.577) [-305.193] (-303.367) (-306.596) * [-303.614] (-303.472) (-303.848) (-303.879) -- 0:00:38
394000 -- (-304.386) (-304.811) [-303.547] (-305.924) * (-304.984) (-302.912) [-302.431] (-302.218) -- 0:00:38
394500 -- (-303.667) [-304.253] (-306.199) (-303.929) * [-304.497] (-307.370) (-302.275) (-302.082) -- 0:00:38
395000 -- (-305.787) [-304.994] (-307.019) (-303.855) * (-302.796) (-302.388) (-304.942) [-304.892] -- 0:00:38
Average standard deviation of split frequencies: 0.014020
395500 -- (-304.993) (-304.472) [-305.163] (-304.170) * [-302.396] (-307.161) (-305.958) (-305.955) -- 0:00:38
396000 -- (-304.056) (-308.395) (-305.902) [-303.596] * (-303.500) [-306.760] (-311.281) (-304.767) -- 0:00:38
396500 -- (-305.716) (-306.005) [-305.146] (-305.710) * (-304.505) [-304.161] (-305.172) (-304.596) -- 0:00:38
397000 -- [-303.994] (-304.434) (-306.336) (-305.491) * (-304.600) (-306.504) [-308.316] (-302.672) -- 0:00:37
397500 -- (-308.314) [-302.412] (-302.584) (-309.132) * (-303.863) (-305.257) [-304.709] (-305.809) -- 0:00:37
398000 -- (-305.833) (-303.788) [-302.419] (-304.635) * (-302.872) (-303.275) (-302.216) [-302.534] -- 0:00:37
398500 -- [-305.196] (-302.990) (-303.040) (-304.181) * (-304.124) [-302.445] (-303.327) (-305.368) -- 0:00:37
399000 -- (-305.807) (-306.416) (-305.477) [-304.448] * [-304.689] (-302.296) (-303.555) (-305.579) -- 0:00:37
399500 -- (-305.778) [-303.970] (-302.774) (-304.682) * (-304.193) [-303.378] (-303.943) (-302.664) -- 0:00:37
400000 -- (-305.873) [-305.158] (-302.916) (-307.223) * [-302.754] (-303.622) (-305.167) (-302.168) -- 0:00:37
Average standard deviation of split frequencies: 0.013565
400500 -- [-305.616] (-303.951) (-304.614) (-308.065) * (-304.942) [-302.996] (-305.107) (-305.234) -- 0:00:38
401000 -- (-302.377) (-306.680) [-309.352] (-304.112) * (-303.568) (-304.242) [-303.609] (-303.371) -- 0:00:38
401500 -- (-304.741) (-310.738) [-304.298] (-302.331) * [-304.245] (-310.157) (-305.129) (-302.878) -- 0:00:38
402000 -- [-303.388] (-306.278) (-306.652) (-306.721) * (-312.759) (-304.866) [-306.217] (-303.303) -- 0:00:38
402500 -- (-303.531) (-306.045) [-304.172] (-305.402) * (-305.249) [-309.399] (-315.348) (-302.184) -- 0:00:38
403000 -- (-305.264) (-303.694) (-303.621) [-302.513] * (-303.584) (-308.336) (-303.114) [-303.981] -- 0:00:38
403500 -- (-307.026) (-304.744) [-302.187] (-302.720) * (-304.863) [-304.195] (-303.226) (-304.124) -- 0:00:38
404000 -- [-304.111] (-304.534) (-303.743) (-304.954) * (-304.753) (-304.056) (-304.236) [-304.141] -- 0:00:38
404500 -- (-303.473) [-304.378] (-306.516) (-306.553) * (-306.737) (-305.877) (-305.000) [-306.262] -- 0:00:38
405000 -- (-310.261) [-303.493] (-304.978) (-304.980) * [-303.821] (-305.530) (-303.747) (-304.379) -- 0:00:38
Average standard deviation of split frequencies: 0.012909
405500 -- (-306.009) (-302.982) (-303.022) [-303.611] * (-305.322) [-302.294] (-304.363) (-303.821) -- 0:00:38
406000 -- [-303.004] (-302.477) (-303.944) (-304.711) * (-304.032) (-306.552) [-303.323] (-307.284) -- 0:00:38
406500 -- (-304.992) (-307.177) (-304.641) [-303.654] * (-304.078) (-305.683) (-307.532) [-303.307] -- 0:00:37
407000 -- (-302.417) (-304.299) (-303.980) [-302.989] * [-306.916] (-303.529) (-307.501) (-305.316) -- 0:00:37
407500 -- (-305.908) (-303.281) (-305.076) [-305.242] * (-304.424) [-304.058] (-303.512) (-304.468) -- 0:00:37
408000 -- (-307.095) (-303.986) (-302.504) [-304.341] * (-303.573) (-303.305) (-304.122) [-303.084] -- 0:00:37
408500 -- [-302.181] (-306.647) (-303.827) (-305.343) * [-303.531] (-303.082) (-302.897) (-307.003) -- 0:00:37
409000 -- (-303.361) (-304.188) [-302.815] (-306.236) * (-303.471) (-305.276) (-304.031) [-305.540] -- 0:00:37
409500 -- (-303.117) [-302.853] (-305.107) (-304.936) * (-304.331) (-308.197) [-304.842] (-312.278) -- 0:00:37
410000 -- (-305.842) (-302.851) [-302.898] (-303.248) * (-304.037) (-307.423) (-304.942) [-310.787] -- 0:00:37
Average standard deviation of split frequencies: 0.012694
410500 -- (-302.926) [-302.888] (-306.232) (-305.132) * [-302.557] (-302.475) (-303.435) (-305.226) -- 0:00:37
411000 -- (-304.552) (-305.681) (-309.718) [-305.168] * (-304.223) (-303.645) (-302.610) [-307.485] -- 0:00:37
411500 -- (-302.592) (-304.744) (-306.761) [-306.666] * (-305.360) (-309.969) (-306.683) [-302.536] -- 0:00:37
412000 -- (-303.460) (-304.260) [-303.048] (-303.364) * (-303.591) [-303.053] (-307.036) (-302.499) -- 0:00:37
412500 -- (-304.840) (-304.587) (-303.391) [-302.094] * (-303.121) [-305.980] (-304.856) (-302.584) -- 0:00:37
413000 -- (-303.869) (-303.844) (-302.641) [-302.811] * (-305.356) (-304.635) [-307.061] (-303.265) -- 0:00:36
413500 -- (-303.374) (-303.572) [-302.886] (-303.852) * (-305.739) (-308.777) (-309.294) [-303.259] -- 0:00:36
414000 -- (-304.411) (-304.096) (-303.999) [-304.510] * (-303.055) (-304.573) (-305.345) [-304.422] -- 0:00:36
414500 -- (-303.420) [-304.963] (-306.046) (-303.850) * (-308.521) (-303.641) (-305.479) [-305.191] -- 0:00:36
415000 -- (-306.094) (-302.950) (-302.464) [-303.112] * (-305.278) (-302.326) (-302.848) [-303.038] -- 0:00:36
Average standard deviation of split frequencies: 0.011798
415500 -- [-305.315] (-302.256) (-304.080) (-302.804) * (-304.114) [-305.593] (-304.936) (-302.568) -- 0:00:36
416000 -- (-306.633) [-303.390] (-306.656) (-302.929) * (-302.658) (-304.672) [-304.061] (-304.470) -- 0:00:36
416500 -- (-310.075) (-306.012) (-308.212) [-303.870] * (-303.105) [-302.435] (-304.276) (-305.012) -- 0:00:36
417000 -- [-307.237] (-307.787) (-305.588) (-302.867) * [-303.456] (-303.577) (-305.405) (-305.390) -- 0:00:36
417500 -- [-308.099] (-303.846) (-303.631) (-303.427) * [-304.000] (-305.627) (-305.604) (-302.876) -- 0:00:37
418000 -- (-303.533) (-305.575) (-303.419) [-307.332] * [-302.312] (-302.896) (-307.637) (-304.706) -- 0:00:37
418500 -- (-305.840) (-302.917) [-304.404] (-308.407) * (-303.261) (-303.059) [-304.552] (-303.556) -- 0:00:37
419000 -- (-305.387) [-303.036] (-304.649) (-306.547) * [-302.757] (-305.750) (-303.110) (-304.205) -- 0:00:37
419500 -- (-303.319) [-303.375] (-307.289) (-306.456) * [-303.498] (-305.366) (-302.770) (-302.778) -- 0:00:37
420000 -- [-303.992] (-303.166) (-306.678) (-303.421) * [-304.533] (-303.600) (-303.361) (-303.221) -- 0:00:37
Average standard deviation of split frequencies: 0.010996
420500 -- (-305.189) (-302.900) [-309.095] (-303.219) * (-305.179) [-305.585] (-304.633) (-304.324) -- 0:00:37
421000 -- (-302.524) [-305.086] (-305.723) (-303.322) * (-303.780) (-302.885) (-303.205) [-303.168] -- 0:00:37
421500 -- (-304.968) (-305.915) [-304.036] (-306.890) * (-304.956) [-306.548] (-306.532) (-304.164) -- 0:00:37
422000 -- (-303.957) (-303.682) (-307.846) [-305.747] * (-302.659) [-310.016] (-304.302) (-303.418) -- 0:00:36
422500 -- (-303.749) [-307.696] (-304.587) (-304.528) * (-302.554) (-313.710) [-301.944] (-304.516) -- 0:00:36
423000 -- [-303.267] (-305.778) (-302.278) (-303.564) * (-303.581) (-309.336) (-304.026) [-303.541] -- 0:00:36
423500 -- (-302.845) (-304.117) (-303.558) [-304.756] * (-305.513) [-305.322] (-304.686) (-303.681) -- 0:00:36
424000 -- (-304.059) [-305.945] (-306.551) (-306.171) * [-308.122] (-307.697) (-302.496) (-304.579) -- 0:00:36
424500 -- (-304.164) (-304.023) [-305.483] (-305.327) * (-302.043) [-303.156] (-303.308) (-305.259) -- 0:00:36
425000 -- (-302.596) (-307.040) [-305.378] (-307.245) * [-303.591] (-302.130) (-304.674) (-304.808) -- 0:00:36
Average standard deviation of split frequencies: 0.011131
425500 -- [-303.430] (-308.019) (-305.621) (-305.033) * (-305.786) [-306.012] (-306.315) (-304.067) -- 0:00:36
426000 -- (-303.538) (-306.335) (-305.699) [-303.189] * (-304.645) (-306.610) [-302.742] (-302.374) -- 0:00:36
426500 -- (-303.329) [-305.540] (-312.256) (-303.983) * (-302.637) (-303.478) (-302.591) [-304.540] -- 0:00:36
427000 -- (-306.301) (-303.957) [-303.670] (-303.392) * (-305.789) (-305.206) (-305.180) [-302.857] -- 0:00:36
427500 -- (-304.174) [-303.992] (-307.135) (-309.663) * (-304.265) (-304.414) [-303.728] (-307.114) -- 0:00:36
428000 -- (-307.312) (-309.048) (-305.286) [-303.849] * (-302.369) [-307.280] (-302.502) (-305.249) -- 0:00:36
428500 -- (-302.596) (-308.115) (-306.174) [-302.107] * (-302.789) [-304.257] (-307.449) (-303.941) -- 0:00:36
429000 -- (-303.915) (-306.502) (-304.809) [-302.721] * (-303.179) (-302.572) [-303.813] (-304.621) -- 0:00:35
429500 -- (-302.353) (-306.034) [-303.258] (-303.318) * (-303.867) (-303.451) (-306.193) [-302.790] -- 0:00:35
430000 -- (-303.695) [-304.584] (-305.226) (-305.430) * (-303.866) (-304.911) [-302.327] (-303.784) -- 0:00:35
Average standard deviation of split frequencies: 0.011356
430500 -- (-305.467) [-304.643] (-305.565) (-303.411) * (-305.192) (-306.116) [-302.419] (-305.027) -- 0:00:35
431000 -- (-304.276) (-303.097) [-306.546] (-303.932) * (-304.001) (-304.629) [-302.247] (-304.425) -- 0:00:35
431500 -- (-304.428) [-302.822] (-305.207) (-304.722) * (-304.275) [-304.875] (-306.105) (-304.721) -- 0:00:35
432000 -- [-304.739] (-302.434) (-307.276) (-304.429) * [-305.178] (-303.808) (-304.473) (-303.754) -- 0:00:35
432500 -- (-303.728) (-302.060) [-305.910] (-303.222) * (-304.219) (-307.507) [-305.104] (-303.665) -- 0:00:35
433000 -- (-304.807) (-303.712) [-303.974] (-305.412) * (-306.432) (-308.004) (-309.857) [-305.066] -- 0:00:35
433500 -- [-305.726] (-303.882) (-304.282) (-307.109) * (-305.547) [-306.681] (-303.813) (-306.004) -- 0:00:35
434000 -- (-302.627) (-303.232) (-306.946) [-303.496] * (-303.417) [-306.198] (-305.166) (-304.964) -- 0:00:35
434500 -- (-306.482) (-303.238) [-304.358] (-306.162) * (-303.524) (-302.793) [-305.424] (-304.698) -- 0:00:36
435000 -- (-302.911) (-303.830) [-303.929] (-304.123) * (-303.080) (-302.597) [-305.375] (-303.097) -- 0:00:36
Average standard deviation of split frequencies: 0.011575
435500 -- [-302.329] (-302.894) (-305.760) (-305.331) * (-303.995) (-303.716) [-303.209] (-304.836) -- 0:00:36
436000 -- [-304.966] (-303.002) (-303.030) (-304.593) * [-303.407] (-304.717) (-305.220) (-303.921) -- 0:00:36
436500 -- (-302.950) (-303.904) (-305.824) [-304.781] * [-303.957] (-304.851) (-303.938) (-302.960) -- 0:00:36
437000 -- (-305.062) [-303.794] (-306.093) (-304.875) * [-303.700] (-305.101) (-307.218) (-305.174) -- 0:00:36
437500 -- (-304.139) [-303.270] (-304.660) (-304.937) * (-304.485) [-305.158] (-309.084) (-308.158) -- 0:00:36
438000 -- (-304.203) (-305.284) [-304.652] (-304.795) * [-303.662] (-303.703) (-305.466) (-307.990) -- 0:00:35
438500 -- [-303.432] (-304.999) (-305.387) (-303.286) * (-304.228) (-302.257) [-308.119] (-309.214) -- 0:00:35
439000 -- (-304.079) (-304.630) (-307.844) [-305.539] * (-305.924) (-305.049) (-303.659) [-305.399] -- 0:00:35
439500 -- (-305.285) (-302.005) (-302.869) [-302.434] * (-305.812) [-302.132] (-305.292) (-305.964) -- 0:00:35
440000 -- (-305.165) [-302.669] (-303.918) (-302.645) * (-303.195) [-306.083] (-304.714) (-305.424) -- 0:00:35
Average standard deviation of split frequencies: 0.011641
440500 -- (-305.704) [-302.964] (-303.537) (-302.296) * (-302.855) (-301.983) [-304.330] (-312.390) -- 0:00:35
441000 -- (-303.692) [-305.572] (-304.346) (-307.472) * [-302.767] (-303.610) (-303.728) (-305.069) -- 0:00:35
441500 -- (-304.126) (-305.660) [-310.502] (-304.391) * (-304.609) (-303.228) [-302.570] (-302.195) -- 0:00:35
442000 -- (-305.056) [-303.648] (-305.942) (-307.219) * (-309.462) [-303.529] (-303.915) (-301.982) -- 0:00:35
442500 -- (-304.741) (-308.024) [-302.710] (-305.946) * (-304.119) [-303.648] (-304.506) (-303.163) -- 0:00:35
443000 -- [-303.711] (-305.689) (-305.507) (-302.495) * (-305.588) (-305.489) (-302.799) [-303.289] -- 0:00:35
443500 -- [-303.159] (-304.693) (-306.688) (-303.260) * [-302.700] (-304.359) (-306.507) (-306.073) -- 0:00:35
444000 -- (-302.247) (-304.426) (-302.423) [-304.973] * [-306.763] (-304.688) (-303.340) (-305.246) -- 0:00:35
444500 -- (-302.619) [-306.179] (-303.241) (-303.900) * (-303.386) (-305.440) (-302.630) [-303.256] -- 0:00:34
445000 -- (-308.600) (-303.060) (-305.079) [-303.145] * (-304.190) (-303.717) (-304.505) [-305.225] -- 0:00:34
Average standard deviation of split frequencies: 0.010570
445500 -- (-306.049) (-303.387) (-302.070) [-307.755] * [-304.513] (-303.436) (-306.681) (-304.679) -- 0:00:34
446000 -- (-307.091) (-306.232) (-304.041) [-302.997] * [-306.623] (-304.324) (-308.567) (-302.453) -- 0:00:34
446500 -- [-303.642] (-303.500) (-303.607) (-302.161) * (-306.323) [-303.487] (-304.679) (-302.711) -- 0:00:34
447000 -- (-303.658) [-306.215] (-304.562) (-303.155) * [-302.173] (-303.382) (-302.673) (-305.557) -- 0:00:34
447500 -- (-308.396) (-306.184) (-303.673) [-304.587] * (-304.001) (-305.148) [-305.701] (-305.498) -- 0:00:34
448000 -- (-305.280) [-305.559] (-304.165) (-307.067) * (-303.067) [-305.955] (-304.316) (-304.000) -- 0:00:34
448500 -- (-304.049) (-304.415) (-303.742) [-304.006] * (-302.147) (-305.425) [-306.820] (-304.866) -- 0:00:34
449000 -- [-302.698] (-302.616) (-306.179) (-304.301) * (-304.787) (-305.416) [-307.221] (-302.857) -- 0:00:34
449500 -- (-304.031) (-303.272) (-305.452) [-303.331] * (-303.842) (-303.008) [-305.714] (-303.521) -- 0:00:34
450000 -- (-304.218) (-303.312) (-310.338) [-305.623] * [-304.032] (-308.446) (-304.647) (-304.307) -- 0:00:34
Average standard deviation of split frequencies: 0.010329
450500 -- (-302.590) [-304.416] (-307.196) (-303.027) * [-304.230] (-304.186) (-303.480) (-306.498) -- 0:00:34
451000 -- (-304.499) (-304.409) [-304.899] (-302.735) * (-307.744) (-302.771) [-302.079] (-306.754) -- 0:00:34
451500 -- (-303.152) (-304.994) (-307.551) [-302.956] * (-304.168) [-304.381] (-308.010) (-302.159) -- 0:00:35
452000 -- (-305.105) [-305.389] (-302.648) (-304.954) * (-302.681) (-305.425) (-304.796) [-303.650] -- 0:00:35
452500 -- (-302.487) (-305.013) [-302.649] (-304.488) * [-305.728] (-311.355) (-305.990) (-305.266) -- 0:00:35
453000 -- (-307.084) (-304.691) (-302.559) [-302.615] * (-303.917) [-309.131] (-302.893) (-302.617) -- 0:00:35
453500 -- (-305.137) [-305.294] (-307.264) (-303.167) * [-304.037] (-306.845) (-304.066) (-305.137) -- 0:00:34
454000 -- (-306.252) (-304.639) (-305.342) [-303.374] * [-302.954] (-304.296) (-303.328) (-304.065) -- 0:00:34
454500 -- [-305.925] (-310.176) (-306.295) (-307.412) * (-303.640) [-306.024] (-305.300) (-302.932) -- 0:00:34
455000 -- (-304.274) (-302.208) (-303.924) [-303.965] * (-304.080) [-303.891] (-303.653) (-305.691) -- 0:00:34
Average standard deviation of split frequencies: 0.010824
455500 -- (-303.042) [-303.375] (-303.106) (-302.496) * (-306.791) (-303.855) [-304.388] (-302.195) -- 0:00:34
456000 -- [-306.123] (-308.613) (-303.355) (-306.656) * [-302.874] (-303.444) (-305.099) (-303.591) -- 0:00:34
456500 -- (-303.614) (-303.842) (-306.015) [-304.920] * (-302.480) (-305.891) (-309.467) [-302.861] -- 0:00:34
457000 -- (-303.775) (-305.124) (-302.920) [-302.528] * (-307.816) [-303.174] (-305.549) (-303.578) -- 0:00:34
457500 -- (-303.784) (-305.641) (-302.658) [-302.775] * (-302.755) (-303.128) (-307.321) [-310.496] -- 0:00:34
458000 -- (-302.923) [-306.358] (-304.526) (-304.137) * (-302.116) [-304.518] (-305.822) (-303.663) -- 0:00:34
458500 -- (-303.195) (-306.163) (-303.206) [-305.662] * (-303.220) (-303.566) [-303.194] (-304.321) -- 0:00:34
459000 -- (-306.084) (-303.884) (-302.797) [-305.298] * [-304.174] (-302.597) (-302.742) (-308.996) -- 0:00:34
459500 -- (-303.757) (-303.104) [-302.618] (-304.351) * (-308.589) [-303.830] (-304.523) (-305.030) -- 0:00:34
460000 -- (-305.244) (-303.782) [-303.560] (-305.085) * (-308.169) (-307.669) [-304.275] (-305.894) -- 0:00:34
Average standard deviation of split frequencies: 0.011497
460500 -- (-303.644) (-304.893) [-302.771] (-303.173) * [-307.159] (-309.481) (-307.528) (-306.644) -- 0:00:33
461000 -- [-303.879] (-305.187) (-303.874) (-303.576) * [-303.118] (-302.755) (-302.039) (-302.289) -- 0:00:33
461500 -- (-304.812) [-304.147] (-302.667) (-304.341) * (-303.923) (-303.771) [-304.655] (-302.485) -- 0:00:33
462000 -- (-306.416) [-304.629] (-304.053) (-302.413) * [-302.573] (-303.918) (-305.325) (-302.601) -- 0:00:33
462500 -- (-303.406) (-302.850) (-304.348) [-304.071] * (-305.826) [-303.627] (-304.357) (-305.427) -- 0:00:33
463000 -- (-307.822) (-306.762) [-306.330] (-302.844) * (-308.360) (-302.618) (-303.357) [-305.587] -- 0:00:33
463500 -- (-305.708) [-304.244] (-308.983) (-302.803) * (-303.451) [-304.247] (-305.246) (-307.176) -- 0:00:33
464000 -- (-303.125) (-307.588) (-309.053) [-304.144] * (-307.727) [-305.720] (-303.698) (-303.722) -- 0:00:33
464500 -- (-303.256) (-303.394) (-308.405) [-303.456] * [-307.908] (-303.171) (-305.009) (-311.418) -- 0:00:33
465000 -- (-303.742) [-302.548] (-311.433) (-304.116) * [-303.076] (-303.859) (-302.970) (-302.541) -- 0:00:33
Average standard deviation of split frequencies: 0.012199
465500 -- (-302.318) (-302.442) (-309.974) [-304.065] * (-310.922) [-309.296] (-303.587) (-304.145) -- 0:00:33
466000 -- (-303.431) [-305.234] (-304.186) (-304.061) * [-308.475] (-302.221) (-305.455) (-310.078) -- 0:00:33
466500 -- (-305.416) (-303.367) [-304.964] (-307.156) * [-303.995] (-303.611) (-304.369) (-308.878) -- 0:00:33
467000 -- (-306.327) [-307.089] (-309.887) (-302.654) * (-304.307) (-304.524) (-304.496) [-306.775] -- 0:00:33
467500 -- (-306.406) (-303.285) (-302.454) [-305.165] * (-303.529) [-303.688] (-302.844) (-304.494) -- 0:00:33
468000 -- (-304.431) (-305.725) (-302.890) [-303.917] * (-304.363) (-305.005) [-304.268] (-308.423) -- 0:00:32
468500 -- (-305.558) (-302.232) (-302.735) [-308.049] * (-306.337) [-304.944] (-303.384) (-305.541) -- 0:00:34
469000 -- (-303.281) (-303.298) (-307.270) [-307.083] * [-303.189] (-305.466) (-302.930) (-302.985) -- 0:00:33
469500 -- (-302.923) (-303.024) (-304.944) [-305.421] * (-302.908) (-308.118) [-303.175] (-303.912) -- 0:00:33
470000 -- (-302.572) [-302.307] (-307.464) (-302.825) * [-302.740] (-304.892) (-302.522) (-302.555) -- 0:00:33
Average standard deviation of split frequencies: 0.012137
470500 -- (-304.947) (-302.769) (-304.143) [-302.898] * [-303.047] (-304.886) (-303.828) (-303.303) -- 0:00:33
471000 -- (-307.258) (-304.055) [-307.670] (-308.533) * (-307.935) [-302.551] (-308.499) (-306.389) -- 0:00:33
471500 -- [-304.813] (-304.649) (-304.918) (-304.696) * (-306.358) (-307.917) (-307.515) [-304.098] -- 0:00:33
472000 -- (-305.833) (-303.520) (-306.333) [-309.148] * (-307.238) [-304.160] (-302.014) (-303.689) -- 0:00:33
472500 -- (-302.854) (-307.540) [-308.990] (-304.846) * (-302.911) (-304.310) (-304.861) [-304.332] -- 0:00:33
473000 -- [-303.395] (-303.801) (-304.567) (-305.288) * [-302.952] (-304.233) (-304.391) (-303.024) -- 0:00:33
473500 -- (-303.156) (-303.713) (-303.135) [-302.985] * [-306.290] (-304.493) (-303.003) (-303.074) -- 0:00:33
474000 -- [-303.026] (-304.768) (-302.802) (-304.460) * (-304.812) (-306.320) [-302.776] (-305.415) -- 0:00:33
474500 -- (-302.692) (-304.556) [-303.304] (-302.480) * (-303.342) (-307.355) (-307.041) [-302.476] -- 0:00:33
475000 -- (-302.600) (-304.023) (-307.774) [-303.321] * (-303.357) (-303.829) [-302.025] (-307.085) -- 0:00:33
Average standard deviation of split frequencies: 0.012059
475500 -- (-307.845) [-302.972] (-309.734) (-305.485) * (-302.409) (-306.612) (-302.355) [-303.909] -- 0:00:33
476000 -- (-303.821) [-302.289] (-302.642) (-303.909) * [-303.453] (-305.527) (-303.811) (-306.591) -- 0:00:33
476500 -- (-306.755) (-302.143) [-305.658] (-304.216) * (-304.055) (-304.714) [-304.314] (-302.822) -- 0:00:32
477000 -- (-304.071) [-303.451] (-302.260) (-302.894) * (-302.073) (-304.691) (-303.899) [-302.889] -- 0:00:32
477500 -- [-306.429] (-302.646) (-303.752) (-305.893) * (-304.329) [-308.208] (-306.437) (-303.307) -- 0:00:32
478000 -- (-303.952) (-303.234) (-303.962) [-305.137] * (-304.592) (-302.923) (-305.490) [-304.317] -- 0:00:32
478500 -- (-304.597) [-304.171] (-302.690) (-311.059) * (-305.662) [-307.734] (-302.474) (-305.659) -- 0:00:32
479000 -- (-303.491) [-302.868] (-303.114) (-304.011) * (-304.546) [-302.052] (-303.692) (-303.003) -- 0:00:32
479500 -- (-304.587) (-303.438) (-305.522) [-303.315] * (-309.236) (-303.101) (-303.403) [-308.633] -- 0:00:32
480000 -- [-302.939] (-302.969) (-304.887) (-304.500) * (-309.524) (-303.371) [-304.158] (-304.411) -- 0:00:32
Average standard deviation of split frequencies: 0.011830
480500 -- (-303.312) [-302.303] (-302.434) (-303.910) * (-305.425) (-302.787) (-302.609) [-306.834] -- 0:00:32
481000 -- [-304.557] (-305.440) (-306.718) (-305.003) * (-304.258) [-305.037] (-304.760) (-305.979) -- 0:00:32
481500 -- (-302.785) (-304.301) (-303.040) [-302.865] * (-305.663) (-303.234) [-310.615] (-304.386) -- 0:00:32
482000 -- (-304.311) (-304.162) (-304.037) [-304.601] * (-302.838) (-303.585) (-304.210) [-304.475] -- 0:00:32
482500 -- (-307.256) (-302.552) (-304.310) [-304.685] * [-302.174] (-303.098) (-303.039) (-302.468) -- 0:00:32
483000 -- (-305.391) (-304.937) [-304.065] (-303.334) * (-303.950) (-302.839) [-302.942] (-305.765) -- 0:00:32
483500 -- (-303.737) (-304.490) [-304.437] (-303.956) * (-303.254) (-304.584) (-308.193) [-305.777] -- 0:00:32
484000 -- (-303.178) [-305.499] (-305.327) (-303.593) * (-303.867) (-303.911) [-306.760] (-310.308) -- 0:00:31
484500 -- (-302.843) (-308.310) (-303.907) [-304.136] * (-303.676) [-304.732] (-303.047) (-303.520) -- 0:00:31
485000 -- [-305.034] (-306.537) (-307.927) (-306.175) * (-303.198) (-304.226) (-304.103) [-302.256] -- 0:00:31
Average standard deviation of split frequencies: 0.012039
485500 -- (-303.153) (-302.131) [-304.711] (-307.146) * (-307.964) (-304.114) (-302.491) [-306.913] -- 0:00:31
486000 -- (-302.804) (-303.023) (-303.731) [-306.023] * [-305.719] (-302.557) (-305.791) (-304.444) -- 0:00:32
486500 -- (-303.611) (-303.595) [-303.483] (-304.311) * (-304.839) [-301.895] (-305.901) (-305.206) -- 0:00:32
487000 -- (-304.228) (-306.843) (-305.472) [-305.926] * (-302.527) [-304.686] (-302.425) (-304.444) -- 0:00:32
487500 -- (-304.217) [-302.836] (-304.932) (-306.296) * (-306.624) (-305.777) (-307.332) [-303.911] -- 0:00:32
488000 -- (-305.295) (-303.430) [-303.615] (-306.475) * (-306.781) (-308.473) (-304.467) [-305.649] -- 0:00:32
488500 -- [-303.859] (-308.426) (-304.577) (-304.802) * (-303.586) (-308.109) (-304.209) [-302.693] -- 0:00:32
489000 -- (-303.019) (-306.346) [-305.945] (-305.120) * (-307.096) (-304.053) (-302.860) [-307.274] -- 0:00:32
489500 -- (-304.110) (-308.253) (-304.598) [-303.774] * (-306.459) (-302.728) [-305.392] (-303.016) -- 0:00:32
490000 -- [-304.017] (-309.732) (-308.123) (-304.645) * (-306.529) (-303.344) (-309.126) [-302.949] -- 0:00:32
Average standard deviation of split frequencies: 0.011811
490500 -- [-306.696] (-305.563) (-303.808) (-306.408) * (-308.472) [-303.949] (-304.911) (-303.346) -- 0:00:32
491000 -- [-303.305] (-304.610) (-304.523) (-302.871) * (-305.615) (-307.495) [-304.889] (-305.259) -- 0:00:32
491500 -- (-304.646) [-304.470] (-304.079) (-303.005) * [-305.377] (-304.671) (-302.953) (-302.226) -- 0:00:32
492000 -- (-306.815) [-305.560] (-307.887) (-302.716) * (-302.999) (-307.325) [-305.339] (-304.745) -- 0:00:32
492500 -- [-304.955] (-304.897) (-307.770) (-304.917) * (-304.937) (-309.042) (-304.154) [-302.886] -- 0:00:31
493000 -- [-306.350] (-305.003) (-303.225) (-302.515) * [-303.060] (-307.827) (-304.890) (-303.861) -- 0:00:31
493500 -- (-302.522) [-307.495] (-304.578) (-303.460) * [-303.176] (-307.158) (-302.889) (-304.081) -- 0:00:31
494000 -- [-302.298] (-306.450) (-306.091) (-304.738) * [-303.412] (-312.509) (-304.990) (-302.594) -- 0:00:31
494500 -- [-302.240] (-302.224) (-303.670) (-305.920) * (-305.110) [-304.397] (-302.746) (-306.314) -- 0:00:31
495000 -- (-303.273) (-303.239) (-303.235) [-303.359] * [-302.685] (-308.004) (-305.571) (-310.059) -- 0:00:31
Average standard deviation of split frequencies: 0.012299
495500 -- [-303.304] (-303.574) (-303.517) (-306.600) * [-304.903] (-305.694) (-302.340) (-305.081) -- 0:00:31
496000 -- (-305.022) (-306.991) [-304.232] (-302.975) * (-304.105) (-303.234) (-303.420) [-307.421] -- 0:00:31
496500 -- (-305.687) (-304.996) (-306.122) [-302.542] * (-302.619) (-305.518) [-302.582] (-306.186) -- 0:00:31
497000 -- (-305.744) (-305.544) (-308.087) [-306.700] * (-304.850) (-306.964) [-303.918] (-307.391) -- 0:00:31
497500 -- (-305.479) (-307.771) (-304.311) [-303.676] * (-306.331) (-305.626) (-303.199) [-311.631] -- 0:00:31
498000 -- (-306.807) (-305.124) (-303.626) [-303.944] * (-303.410) (-304.101) (-306.309) [-310.301] -- 0:00:31
498500 -- (-303.130) (-304.088) [-303.087] (-302.454) * [-304.592] (-304.950) (-303.846) (-304.037) -- 0:00:31
499000 -- (-303.649) (-305.549) (-302.840) [-302.146] * [-304.652] (-308.460) (-307.515) (-304.111) -- 0:00:31
499500 -- (-303.163) (-303.608) [-303.978] (-303.267) * (-306.064) (-306.671) [-304.481] (-305.303) -- 0:00:31
500000 -- (-310.694) [-303.402] (-303.194) (-302.797) * (-305.652) [-304.509] (-306.424) (-303.814) -- 0:00:31
Average standard deviation of split frequencies: 0.013459
500500 -- (-303.126) (-305.254) [-302.472] (-305.387) * (-307.115) [-302.547] (-308.750) (-304.268) -- 0:00:30
501000 -- (-304.460) [-303.523] (-303.465) (-302.598) * (-307.155) (-304.655) [-304.457] (-306.417) -- 0:00:30
501500 -- (-303.962) (-307.592) (-302.984) [-305.501] * (-305.348) [-303.329] (-304.895) (-304.443) -- 0:00:30
502000 -- (-305.873) [-305.340] (-303.633) (-306.586) * (-305.243) (-305.928) (-305.419) [-306.045] -- 0:00:30
502500 -- (-302.911) (-302.818) (-306.507) [-303.018] * (-305.047) [-305.015] (-303.739) (-303.352) -- 0:00:31
503000 -- (-304.980) (-302.942) (-303.724) [-304.224] * [-304.375] (-305.498) (-305.596) (-306.678) -- 0:00:31
503500 -- [-303.470] (-303.730) (-311.489) (-303.239) * [-304.253] (-305.303) (-304.478) (-303.223) -- 0:00:31
504000 -- [-303.634] (-303.453) (-306.587) (-303.782) * (-305.348) [-305.856] (-304.430) (-308.287) -- 0:00:31
504500 -- [-303.848] (-301.993) (-305.314) (-305.038) * (-302.642) [-305.276] (-303.919) (-305.535) -- 0:00:31
505000 -- [-302.685] (-302.347) (-303.473) (-304.064) * (-303.030) (-303.252) [-304.422] (-308.603) -- 0:00:31
Average standard deviation of split frequencies: 0.013302
505500 -- (-304.213) (-302.343) (-303.982) [-303.594] * (-302.274) (-304.560) (-303.342) [-303.347] -- 0:00:31
506000 -- (-308.296) [-303.160] (-302.735) (-303.671) * (-302.547) [-305.294] (-303.921) (-304.958) -- 0:00:31
506500 -- (-304.079) [-303.938] (-303.181) (-302.919) * [-304.901] (-304.099) (-304.406) (-304.604) -- 0:00:31
507000 -- (-306.142) (-304.548) [-305.902] (-302.429) * (-304.271) (-302.891) [-303.764] (-309.845) -- 0:00:31
507500 -- (-302.156) (-302.616) (-303.910) [-304.519] * (-303.940) (-303.413) (-302.976) [-303.634] -- 0:00:31
508000 -- (-302.951) [-303.573] (-305.068) (-305.620) * (-306.486) [-303.953] (-303.093) (-302.944) -- 0:00:30
508500 -- (-308.277) (-303.703) [-306.175] (-305.319) * [-304.379] (-306.878) (-303.696) (-304.961) -- 0:00:30
509000 -- (-305.653) [-304.087] (-305.805) (-304.215) * (-302.705) (-303.422) (-307.027) [-305.374] -- 0:00:30
509500 -- [-302.512] (-305.787) (-303.988) (-306.118) * (-307.321) (-305.948) (-306.964) [-303.287] -- 0:00:30
510000 -- [-304.779] (-305.454) (-305.487) (-305.548) * (-305.491) (-304.929) [-304.483] (-303.327) -- 0:00:30
Average standard deviation of split frequencies: 0.013077
510500 -- (-307.824) (-303.749) (-304.662) [-303.109] * [-306.276] (-311.552) (-305.853) (-303.265) -- 0:00:30
511000 -- (-304.891) (-302.413) [-302.708] (-303.407) * (-305.909) (-309.312) (-307.527) [-303.520] -- 0:00:30
511500 -- (-307.981) [-302.849] (-305.956) (-306.116) * [-304.880] (-308.667) (-305.375) (-304.794) -- 0:00:30
512000 -- (-305.499) (-303.494) (-302.592) [-302.918] * (-303.697) (-305.653) (-305.211) [-304.555] -- 0:00:30
512500 -- [-304.244] (-308.044) (-306.014) (-302.614) * [-302.706] (-304.030) (-301.962) (-303.785) -- 0:00:30
513000 -- [-302.570] (-304.750) (-302.683) (-303.893) * [-302.661] (-306.575) (-304.825) (-306.133) -- 0:00:30
513500 -- [-304.150] (-303.939) (-306.309) (-303.008) * (-304.531) (-303.252) [-302.818] (-303.984) -- 0:00:30
514000 -- (-303.545) [-302.863] (-309.413) (-304.267) * (-305.779) (-304.208) (-305.039) [-302.771] -- 0:00:30
514500 -- (-302.703) (-305.440) (-304.595) [-304.828] * (-303.978) (-302.790) (-303.507) [-304.117] -- 0:00:30
515000 -- (-302.371) (-303.843) [-303.685] (-303.276) * (-304.532) (-305.155) [-302.792] (-303.649) -- 0:00:30
Average standard deviation of split frequencies: 0.012736
515500 -- (-302.907) (-304.413) (-304.571) [-304.046] * (-306.052) (-309.271) [-304.399] (-304.104) -- 0:00:30
516000 -- [-304.654] (-303.981) (-303.616) (-308.576) * (-308.138) [-303.210] (-305.956) (-304.391) -- 0:00:30
516500 -- (-307.323) [-303.665] (-303.218) (-303.883) * (-306.233) [-302.708] (-304.541) (-304.277) -- 0:00:29
517000 -- (-305.397) (-303.599) [-302.780] (-305.601) * (-304.311) (-304.353) [-304.639] (-303.630) -- 0:00:30
517500 -- [-307.451] (-302.950) (-305.332) (-310.251) * (-306.418) (-303.738) (-311.010) [-303.438] -- 0:00:30
518000 -- [-307.265] (-304.857) (-306.843) (-305.035) * (-308.633) (-305.065) [-303.703] (-302.897) -- 0:00:30
518500 -- (-309.494) (-304.037) [-304.978] (-303.493) * (-304.095) [-304.863] (-306.139) (-304.858) -- 0:00:30
519000 -- (-305.836) [-304.063] (-309.861) (-302.497) * (-304.205) (-303.735) [-304.701] (-304.439) -- 0:00:30
519500 -- (-303.911) [-304.054] (-306.292) (-305.599) * (-303.973) (-302.744) [-302.156] (-303.192) -- 0:00:30
520000 -- (-304.532) [-302.525] (-308.163) (-304.831) * [-302.601] (-304.605) (-304.603) (-302.961) -- 0:00:30
Average standard deviation of split frequencies: 0.012977
520500 -- [-302.951] (-304.283) (-306.716) (-304.205) * (-302.873) (-304.547) (-307.459) [-303.633] -- 0:00:30
521000 -- [-304.916] (-307.112) (-303.130) (-304.357) * (-302.976) (-303.668) [-303.720] (-303.026) -- 0:00:30
521500 -- [-303.962] (-302.271) (-308.222) (-303.679) * (-309.398) (-302.120) (-303.469) [-303.537] -- 0:00:30
522000 -- (-302.874) (-303.944) (-304.506) [-302.707] * (-309.051) [-303.890] (-303.171) (-304.359) -- 0:00:30
522500 -- (-303.588) [-303.546] (-304.879) (-303.396) * [-304.376] (-302.629) (-307.026) (-305.657) -- 0:00:30
523000 -- (-303.249) (-304.654) [-303.905] (-303.688) * (-303.070) (-303.250) (-304.705) [-303.529] -- 0:00:30
523500 -- (-304.202) (-304.110) [-303.779] (-307.976) * (-307.929) (-303.575) (-302.576) [-308.176] -- 0:00:30
524000 -- [-303.733] (-303.053) (-307.918) (-308.844) * (-305.360) (-303.179) [-303.046] (-302.508) -- 0:00:29
524500 -- (-303.585) [-304.826] (-308.803) (-305.503) * (-302.559) (-306.188) (-303.214) [-302.323] -- 0:00:29
525000 -- [-304.409] (-304.326) (-304.602) (-305.619) * (-304.512) (-303.805) (-302.655) [-302.284] -- 0:00:29
Average standard deviation of split frequencies: 0.013294
525500 -- [-304.388] (-302.789) (-304.160) (-303.758) * (-304.168) (-305.548) [-302.407] (-302.797) -- 0:00:29
526000 -- (-305.107) [-303.787] (-306.028) (-304.508) * (-304.029) [-304.402] (-303.705) (-303.334) -- 0:00:29
526500 -- (-303.021) (-307.394) (-304.143) [-306.154] * (-302.546) [-303.482] (-302.749) (-302.624) -- 0:00:29
527000 -- [-302.878] (-303.856) (-310.251) (-305.938) * (-304.118) (-304.101) (-304.461) [-302.864] -- 0:00:29
527500 -- [-302.905] (-302.345) (-305.493) (-305.743) * [-304.437] (-305.759) (-306.314) (-303.075) -- 0:00:29
528000 -- (-309.564) [-302.369] (-310.353) (-302.516) * (-301.855) [-305.115] (-302.630) (-302.313) -- 0:00:29
528500 -- (-305.130) (-303.855) [-304.775] (-304.686) * [-302.361] (-306.007) (-308.914) (-304.167) -- 0:00:29
529000 -- (-303.991) (-309.790) [-305.057] (-304.296) * (-304.033) (-306.568) [-304.571] (-305.168) -- 0:00:29
529500 -- (-306.118) (-310.636) [-304.203] (-305.414) * (-302.512) (-306.378) [-303.125] (-304.108) -- 0:00:29
530000 -- (-303.801) (-310.446) (-304.065) [-305.011] * (-306.991) (-305.491) [-303.301] (-303.516) -- 0:00:29
Average standard deviation of split frequencies: 0.013226
530500 -- (-304.705) (-304.438) [-302.403] (-302.780) * [-303.633] (-303.600) (-305.951) (-304.654) -- 0:00:29
531000 -- [-305.342] (-304.044) (-302.711) (-302.238) * (-303.028) [-305.268] (-304.160) (-302.689) -- 0:00:29
531500 -- (-305.880) (-304.904) [-304.605] (-303.822) * (-303.381) [-304.224] (-303.324) (-308.595) -- 0:00:29
532000 -- (-305.224) [-304.595] (-304.755) (-303.990) * (-305.079) (-302.733) [-302.924] (-303.760) -- 0:00:29
532500 -- (-305.889) (-302.406) [-304.276] (-305.179) * (-305.344) (-302.668) (-304.640) [-303.746] -- 0:00:28
533000 -- (-305.877) (-303.509) [-304.395] (-303.709) * (-303.653) (-307.361) [-304.529] (-302.371) -- 0:00:28
533500 -- (-303.351) [-307.769] (-306.390) (-304.467) * (-304.903) (-303.717) [-304.108] (-307.366) -- 0:00:28
534000 -- (-304.449) (-302.235) (-304.497) [-303.317] * (-307.431) (-302.877) (-306.048) [-306.750] -- 0:00:28
534500 -- (-302.923) [-301.953] (-303.002) (-303.112) * [-306.691] (-303.294) (-302.967) (-309.741) -- 0:00:29
535000 -- (-308.869) (-306.519) [-306.851] (-305.353) * (-303.661) (-303.915) (-304.358) [-302.710] -- 0:00:29
Average standard deviation of split frequencies: 0.014365
535500 -- (-307.366) (-310.283) [-304.151] (-304.524) * [-302.524] (-305.811) (-304.166) (-302.456) -- 0:00:29
536000 -- (-305.663) [-304.611] (-303.115) (-310.096) * (-308.164) (-303.999) [-305.656] (-303.369) -- 0:00:29
536500 -- (-305.635) [-302.249] (-303.935) (-305.185) * (-303.424) [-303.153] (-307.469) (-306.600) -- 0:00:29
537000 -- (-305.976) (-304.893) (-303.324) [-303.050] * (-303.434) [-302.978] (-303.391) (-302.433) -- 0:00:29
537500 -- (-302.912) [-302.194] (-304.129) (-305.200) * [-306.926] (-304.760) (-303.602) (-305.825) -- 0:00:29
538000 -- (-302.371) (-302.964) [-303.750] (-303.007) * (-302.854) (-304.988) (-304.165) [-303.183] -- 0:00:29
538500 -- (-303.964) (-305.782) [-303.400] (-303.255) * [-302.726] (-304.725) (-305.198) (-307.063) -- 0:00:29
539000 -- (-306.556) [-302.217] (-302.151) (-303.579) * (-302.895) [-306.218] (-302.361) (-304.835) -- 0:00:29
539500 -- [-303.060] (-304.622) (-304.970) (-304.896) * (-305.300) [-305.336] (-304.030) (-305.598) -- 0:00:29
540000 -- [-304.090] (-304.221) (-302.885) (-306.181) * (-305.784) [-304.326] (-302.797) (-306.398) -- 0:00:28
Average standard deviation of split frequencies: 0.013321
540500 -- (-304.519) (-305.236) [-303.482] (-304.346) * (-305.076) (-305.401) [-302.562] (-302.452) -- 0:00:28
541000 -- [-306.045] (-305.334) (-304.182) (-303.615) * (-306.058) [-303.327] (-303.064) (-305.672) -- 0:00:28
541500 -- (-308.286) [-302.203] (-304.901) (-304.137) * (-304.271) (-304.113) (-308.859) [-303.167] -- 0:00:28
542000 -- [-304.740] (-302.352) (-303.495) (-304.212) * (-304.150) [-306.182] (-305.471) (-308.346) -- 0:00:28
542500 -- (-303.617) [-303.582] (-303.413) (-306.518) * (-302.601) (-303.764) [-302.619] (-304.336) -- 0:00:28
543000 -- [-304.426] (-304.504) (-302.042) (-305.278) * (-309.282) (-306.914) [-304.411] (-307.299) -- 0:00:28
543500 -- (-304.499) (-303.415) [-302.202] (-303.392) * (-305.382) (-306.570) [-303.778] (-304.712) -- 0:00:28
544000 -- (-307.395) (-304.995) [-302.586] (-303.361) * [-303.396] (-306.641) (-303.793) (-305.582) -- 0:00:28
544500 -- (-303.631) (-303.767) [-302.897] (-304.325) * (-305.290) (-303.671) (-306.725) [-304.347] -- 0:00:28
545000 -- (-305.107) [-303.098] (-303.868) (-306.729) * (-303.314) (-303.497) (-303.540) [-304.017] -- 0:00:28
Average standard deviation of split frequencies: 0.013622
545500 -- [-303.184] (-307.734) (-305.434) (-308.984) * [-305.173] (-306.050) (-304.160) (-303.939) -- 0:00:28
546000 -- (-303.911) (-303.984) [-303.075] (-308.437) * (-304.009) (-304.809) (-306.200) [-303.759] -- 0:00:28
546500 -- (-310.259) (-307.141) [-302.807] (-304.983) * (-308.735) (-303.464) (-304.972) [-304.559] -- 0:00:28
547000 -- (-303.010) (-306.497) (-304.553) [-302.338] * [-303.257] (-305.655) (-305.593) (-303.896) -- 0:00:28
547500 -- (-302.038) [-303.566] (-303.680) (-302.995) * (-305.681) (-303.154) (-302.948) [-304.046] -- 0:00:28
548000 -- (-303.496) (-304.660) [-303.763] (-304.748) * (-305.016) (-306.743) [-303.360] (-304.228) -- 0:00:28
548500 -- (-302.271) [-304.524] (-306.031) (-302.806) * (-305.541) [-308.243] (-307.360) (-302.742) -- 0:00:27
549000 -- [-304.022] (-304.419) (-304.694) (-308.502) * (-305.636) (-305.697) (-304.973) [-302.214] -- 0:00:27
549500 -- (-307.614) (-302.158) (-305.799) [-303.587] * (-308.785) (-304.524) [-303.429] (-304.386) -- 0:00:27
550000 -- (-302.996) [-302.606] (-306.285) (-304.902) * [-303.743] (-303.879) (-302.249) (-307.314) -- 0:00:27
Average standard deviation of split frequencies: 0.013364
550500 -- (-303.573) [-302.547] (-304.817) (-304.268) * [-302.667] (-304.571) (-305.936) (-308.453) -- 0:00:27
551000 -- (-303.206) (-304.402) (-305.003) [-305.215] * [-304.612] (-304.989) (-308.879) (-304.329) -- 0:00:27
551500 -- (-302.963) (-305.887) (-305.066) [-302.250] * (-302.386) (-305.582) [-302.547] (-304.572) -- 0:00:28
552000 -- (-304.312) (-307.303) [-304.784] (-303.416) * (-301.987) (-306.168) [-303.090] (-304.286) -- 0:00:28
552500 -- (-304.208) (-305.861) (-307.684) [-303.984] * (-304.516) (-306.521) (-302.836) [-306.763] -- 0:00:28
553000 -- (-304.383) (-305.055) [-303.080] (-303.711) * (-302.878) (-303.226) [-303.193] (-303.086) -- 0:00:28
553500 -- (-303.493) (-302.913) (-305.098) [-302.991] * (-303.715) (-302.853) (-303.181) [-303.580] -- 0:00:28
554000 -- (-303.527) (-304.670) (-303.815) [-304.777] * (-303.664) [-301.819] (-302.428) (-303.977) -- 0:00:28
554500 -- (-303.137) (-309.475) [-305.553] (-303.466) * (-303.781) (-305.251) [-303.097] (-303.188) -- 0:00:28
555000 -- (-304.258) (-303.451) [-304.487] (-303.389) * [-302.708] (-303.157) (-307.646) (-303.229) -- 0:00:28
Average standard deviation of split frequencies: 0.013754
555500 -- (-303.940) (-303.688) [-304.149] (-305.911) * (-303.283) (-302.331) [-303.318] (-303.839) -- 0:00:28
556000 -- (-302.578) [-303.840] (-308.639) (-302.559) * (-305.004) (-303.388) (-305.031) [-302.543] -- 0:00:27
556500 -- (-303.083) (-304.512) [-303.012] (-303.540) * [-303.380] (-306.048) (-304.511) (-303.526) -- 0:00:27
557000 -- (-305.894) (-302.952) [-305.423] (-302.398) * [-307.644] (-307.151) (-306.268) (-303.538) -- 0:00:27
557500 -- (-307.054) (-304.848) [-306.088] (-305.957) * [-303.569] (-304.151) (-303.044) (-305.889) -- 0:00:27
558000 -- (-302.083) [-302.280] (-303.595) (-305.546) * (-304.738) (-303.935) [-303.274] (-304.834) -- 0:00:27
558500 -- (-308.013) [-302.888] (-305.290) (-303.522) * (-301.948) (-305.894) (-303.603) [-305.228] -- 0:00:27
559000 -- (-304.008) [-306.178] (-304.943) (-304.588) * (-304.407) [-308.381] (-305.001) (-303.702) -- 0:00:27
559500 -- (-305.607) (-303.206) [-305.590] (-303.523) * (-305.193) (-305.569) (-303.043) [-302.697] -- 0:00:27
560000 -- (-303.251) (-307.007) [-306.240] (-306.045) * (-310.286) [-307.548] (-307.373) (-302.633) -- 0:00:27
Average standard deviation of split frequencies: 0.013593
560500 -- [-303.741] (-303.190) (-308.691) (-303.235) * [-307.909] (-304.381) (-305.982) (-303.897) -- 0:00:27
561000 -- (-309.973) (-303.052) [-303.784] (-302.644) * [-306.242] (-305.948) (-311.476) (-306.020) -- 0:00:27
561500 -- (-302.886) (-303.198) (-302.832) [-302.930] * (-308.875) (-306.623) (-308.825) [-302.573] -- 0:00:27
562000 -- (-304.014) (-303.312) (-302.671) [-304.584] * [-305.564] (-304.287) (-303.596) (-304.059) -- 0:00:27
562500 -- [-306.280] (-303.617) (-302.464) (-305.109) * (-305.584) (-303.667) [-303.363] (-302.547) -- 0:00:27
563000 -- [-305.938] (-302.543) (-303.508) (-311.598) * (-304.516) (-306.705) [-303.289] (-303.022) -- 0:00:27
563500 -- (-302.798) [-305.005] (-303.044) (-304.029) * (-304.656) (-313.833) [-307.245] (-305.256) -- 0:00:27
564000 -- [-303.806] (-308.028) (-303.134) (-303.962) * [-303.590] (-304.802) (-305.882) (-304.088) -- 0:00:27
564500 -- (-302.568) [-306.368] (-304.342) (-305.586) * (-304.174) (-303.717) (-309.472) [-305.999] -- 0:00:27
565000 -- (-304.625) (-305.808) [-301.937] (-304.026) * [-303.222] (-304.204) (-303.746) (-304.702) -- 0:00:26
Average standard deviation of split frequencies: 0.013927
565500 -- (-303.576) (-303.920) [-304.101] (-307.687) * (-307.025) (-303.089) [-304.036] (-303.837) -- 0:00:26
566000 -- [-302.641] (-305.477) (-304.349) (-302.853) * [-302.257] (-304.099) (-303.988) (-303.601) -- 0:00:26
566500 -- [-302.306] (-310.171) (-302.869) (-303.305) * (-306.180) [-303.367] (-303.782) (-304.164) -- 0:00:26
567000 -- (-304.475) (-307.031) (-304.711) [-307.851] * (-305.108) (-309.120) [-304.705] (-302.826) -- 0:00:26
567500 -- (-304.618) (-303.380) [-303.351] (-302.741) * (-311.609) (-302.847) (-304.418) [-307.632] -- 0:00:26
568000 -- (-305.200) [-302.958] (-302.779) (-303.656) * (-303.846) (-303.401) [-302.870] (-304.051) -- 0:00:26
568500 -- (-303.327) (-303.915) [-305.298] (-303.158) * (-303.123) (-304.101) [-305.195] (-302.873) -- 0:00:26
569000 -- (-302.736) (-304.427) (-302.382) [-304.638] * (-302.765) (-306.164) [-306.922] (-304.961) -- 0:00:27
569500 -- (-304.252) (-303.092) [-302.819] (-304.612) * (-303.651) (-304.307) [-306.870] (-307.665) -- 0:00:27
570000 -- (-307.789) (-302.723) [-303.741] (-304.170) * [-302.244] (-303.960) (-305.672) (-308.108) -- 0:00:27
Average standard deviation of split frequencies: 0.014043
570500 -- (-304.942) [-302.794] (-304.642) (-308.954) * (-302.129) (-303.160) [-305.618] (-302.524) -- 0:00:27
571000 -- (-301.941) (-303.931) [-304.208] (-305.481) * (-303.084) [-302.950] (-303.730) (-302.737) -- 0:00:27
571500 -- [-302.437] (-302.542) (-302.748) (-302.763) * (-303.599) [-302.682] (-304.389) (-304.692) -- 0:00:26
572000 -- (-303.825) [-302.636] (-302.507) (-303.183) * (-303.656) (-302.290) (-303.130) [-305.419] -- 0:00:26
572500 -- (-310.326) [-303.389] (-306.626) (-304.967) * (-305.747) (-303.446) (-307.185) [-303.170] -- 0:00:26
573000 -- [-306.187] (-305.336) (-303.380) (-305.844) * (-303.565) (-307.595) [-302.328] (-304.010) -- 0:00:26
573500 -- [-302.924] (-303.691) (-303.878) (-312.678) * (-305.813) [-303.641] (-302.950) (-303.172) -- 0:00:26
574000 -- (-306.764) (-307.185) (-305.559) [-306.467] * (-307.070) (-307.100) (-303.164) [-304.472] -- 0:00:26
574500 -- (-305.113) (-307.064) (-304.827) [-308.036] * (-305.377) (-307.730) (-305.558) [-303.799] -- 0:00:26
575000 -- [-303.669] (-304.696) (-304.912) (-303.859) * (-307.012) (-306.376) [-305.421] (-302.760) -- 0:00:26
Average standard deviation of split frequencies: 0.015186
575500 -- (-304.846) (-306.002) [-304.363] (-304.826) * (-303.453) [-304.936] (-304.234) (-306.042) -- 0:00:26
576000 -- (-302.905) (-306.939) [-305.216] (-303.749) * (-303.308) [-303.172] (-305.007) (-301.982) -- 0:00:26
576500 -- (-306.282) (-302.790) [-304.285] (-306.298) * [-307.669] (-304.060) (-304.923) (-304.789) -- 0:00:26
577000 -- (-302.876) (-305.143) (-307.853) [-307.661] * (-305.436) (-303.705) [-304.694] (-303.881) -- 0:00:26
577500 -- (-306.273) [-304.020] (-303.537) (-310.773) * (-303.613) [-304.239] (-303.592) (-303.151) -- 0:00:26
578000 -- [-303.615] (-305.223) (-304.717) (-307.451) * [-304.373] (-307.769) (-303.112) (-305.088) -- 0:00:26
578500 -- (-307.488) (-302.302) [-305.113] (-312.781) * (-306.506) (-305.248) (-305.196) [-303.642] -- 0:00:26
579000 -- (-305.339) (-304.337) [-304.245] (-312.402) * [-302.294] (-306.443) (-304.126) (-307.176) -- 0:00:26
579500 -- (-305.723) [-302.753] (-304.626) (-303.940) * (-309.238) (-307.777) [-306.335] (-306.726) -- 0:00:26
580000 -- (-308.920) [-304.058] (-302.649) (-309.056) * (-306.552) (-303.643) (-304.289) [-303.460] -- 0:00:26
Average standard deviation of split frequencies: 0.014974
580500 -- (-302.862) [-304.143] (-303.525) (-304.697) * (-303.484) (-307.366) [-304.306] (-303.259) -- 0:00:26
581000 -- (-304.925) (-304.693) [-302.713] (-307.043) * (-309.532) [-304.273] (-305.765) (-304.970) -- 0:00:25
581500 -- (-304.623) (-302.551) (-305.527) [-303.399] * (-305.150) (-306.197) (-309.293) [-304.399] -- 0:00:25
582000 -- [-303.424] (-306.797) (-306.756) (-302.244) * (-306.055) (-309.206) (-305.113) [-304.391] -- 0:00:25
582500 -- [-304.625] (-306.048) (-305.018) (-304.394) * (-302.485) (-310.392) (-306.650) [-306.548] -- 0:00:25
583000 -- [-305.139] (-302.171) (-303.700) (-303.327) * [-301.994] (-306.880) (-305.093) (-302.535) -- 0:00:25
583500 -- (-304.495) [-303.289] (-302.484) (-303.627) * (-301.982) (-305.254) [-302.785] (-305.136) -- 0:00:25
584000 -- (-304.311) (-303.851) [-304.160] (-306.074) * (-303.056) [-307.209] (-304.534) (-308.268) -- 0:00:25
584500 -- [-304.073] (-306.015) (-302.244) (-304.602) * (-302.517) [-303.665] (-304.470) (-304.284) -- 0:00:25
585000 -- [-302.947] (-305.580) (-305.767) (-304.912) * (-302.502) (-303.470) (-302.125) [-304.204] -- 0:00:25
Average standard deviation of split frequencies: 0.014748
585500 -- (-302.955) [-304.285] (-304.287) (-304.570) * (-304.396) [-303.363] (-307.035) (-307.883) -- 0:00:25
586000 -- (-306.410) [-302.980] (-307.634) (-312.066) * (-302.789) [-307.255] (-305.290) (-305.195) -- 0:00:26
586500 -- (-302.814) (-303.489) (-304.448) [-305.364] * [-310.259] (-305.766) (-302.648) (-303.751) -- 0:00:26
587000 -- (-302.730) [-302.788] (-302.867) (-302.890) * (-303.389) (-302.380) [-304.055] (-309.104) -- 0:00:26
587500 -- (-304.269) [-304.735] (-302.951) (-303.284) * (-304.638) (-304.844) [-306.640] (-305.776) -- 0:00:25
588000 -- (-303.925) (-305.027) (-303.422) [-308.515] * (-303.589) (-302.935) [-307.602] (-304.127) -- 0:00:25
588500 -- (-306.441) (-305.601) (-306.608) [-306.648] * (-303.259) (-304.542) [-305.156] (-307.358) -- 0:00:25
589000 -- [-304.208] (-304.274) (-303.683) (-306.705) * [-305.161] (-305.010) (-303.528) (-303.715) -- 0:00:25
589500 -- (-304.784) (-303.021) (-303.764) [-303.384] * (-304.113) (-307.439) (-304.105) [-304.044] -- 0:00:25
590000 -- (-302.549) (-305.214) (-303.985) [-304.918] * (-302.378) [-305.793] (-305.215) (-303.887) -- 0:00:25
Average standard deviation of split frequencies: 0.014986
590500 -- (-304.784) (-306.614) (-305.430) [-305.383] * (-307.167) (-306.882) [-304.314] (-307.565) -- 0:00:25
591000 -- [-303.031] (-303.537) (-305.383) (-302.763) * (-303.072) (-304.265) [-305.822] (-304.803) -- 0:00:25
591500 -- (-302.858) (-303.554) (-311.113) [-302.675] * (-303.671) (-302.789) [-308.316] (-304.249) -- 0:00:25
592000 -- (-303.902) (-303.546) [-306.503] (-302.925) * (-304.330) (-302.742) [-304.598] (-303.206) -- 0:00:25
592500 -- (-304.777) (-305.614) [-302.933] (-304.623) * (-302.963) (-305.061) (-302.460) [-302.435] -- 0:00:25
593000 -- (-308.437) [-306.301] (-305.546) (-302.380) * (-303.564) (-308.002) (-302.592) [-302.997] -- 0:00:25
593500 -- (-306.526) (-304.512) [-303.265] (-303.268) * [-305.558] (-304.585) (-302.774) (-306.000) -- 0:00:25
594000 -- (-307.401) (-305.296) [-303.546] (-302.608) * [-305.692] (-303.065) (-306.265) (-306.149) -- 0:00:25
594500 -- (-305.575) (-306.634) [-304.492] (-303.193) * (-306.255) (-303.404) [-303.456] (-304.800) -- 0:00:25
595000 -- (-303.676) [-304.834] (-302.869) (-306.943) * (-312.666) (-303.458) [-303.830] (-303.516) -- 0:00:25
Average standard deviation of split frequencies: 0.014545
595500 -- (-307.737) (-304.344) [-304.309] (-303.642) * (-308.354) (-303.223) (-307.341) [-304.040] -- 0:00:25
596000 -- (-304.364) [-304.807] (-305.961) (-303.771) * (-312.788) (-304.953) (-303.973) [-304.948] -- 0:00:25
596500 -- (-304.291) (-306.184) [-302.619] (-308.778) * (-303.903) (-304.023) [-306.710] (-305.561) -- 0:00:25
597000 -- (-305.629) (-307.052) (-303.488) [-304.988] * [-305.047] (-305.548) (-303.862) (-303.836) -- 0:00:24
597500 -- (-305.610) (-304.388) (-303.778) [-304.174] * (-305.891) (-302.720) [-303.841] (-306.375) -- 0:00:24
598000 -- (-306.391) [-305.652] (-303.891) (-302.567) * [-303.273] (-302.967) (-305.101) (-305.609) -- 0:00:24
598500 -- [-302.144] (-302.880) (-304.485) (-303.491) * [-302.279] (-304.178) (-304.216) (-304.085) -- 0:00:24
599000 -- (-303.106) (-305.210) (-304.177) [-303.117] * (-303.324) (-309.505) [-302.716] (-302.105) -- 0:00:24
599500 -- (-306.776) [-308.803] (-302.766) (-302.815) * [-303.333] (-304.401) (-303.394) (-310.025) -- 0:00:24
600000 -- (-304.599) [-305.632] (-305.352) (-301.916) * (-302.373) (-303.214) (-302.448) [-308.506] -- 0:00:24
Average standard deviation of split frequencies: 0.015129
600500 -- [-304.054] (-303.072) (-305.124) (-303.820) * [-306.216] (-304.365) (-305.753) (-305.834) -- 0:00:24
601000 -- (-307.104) (-305.612) [-306.499] (-305.017) * (-305.272) (-303.998) (-302.447) [-303.815] -- 0:00:24
601500 -- (-304.255) (-307.819) [-303.555] (-307.088) * (-303.899) [-304.389] (-303.845) (-305.251) -- 0:00:24
602000 -- (-307.444) (-304.161) (-305.697) [-302.550] * (-302.721) (-304.382) (-304.551) [-303.980] -- 0:00:25
602500 -- (-305.119) (-305.744) (-302.710) [-303.491] * (-302.701) (-302.851) (-303.491) [-305.408] -- 0:00:25
603000 -- (-307.963) (-308.029) [-304.833] (-306.474) * [-302.461] (-302.590) (-304.799) (-307.574) -- 0:00:25
603500 -- [-306.975] (-307.214) (-305.825) (-302.331) * (-310.299) (-302.764) (-306.812) [-303.531] -- 0:00:24
604000 -- (-303.533) [-302.592] (-303.115) (-304.223) * [-308.498] (-303.809) (-302.976) (-306.977) -- 0:00:24
604500 -- (-305.072) [-304.620] (-304.943) (-304.467) * (-307.854) [-303.875] (-304.277) (-309.636) -- 0:00:24
605000 -- (-303.181) (-304.818) [-305.893] (-311.284) * (-304.554) (-303.383) (-302.086) [-305.283] -- 0:00:24
Average standard deviation of split frequencies: 0.014045
605500 -- (-303.801) [-304.110] (-303.905) (-313.622) * (-304.468) (-305.494) (-302.289) [-305.173] -- 0:00:24
606000 -- (-304.667) [-303.833] (-304.116) (-310.880) * [-302.882] (-305.591) (-302.792) (-306.995) -- 0:00:24
606500 -- (-305.720) [-305.258] (-305.118) (-305.835) * (-304.124) (-305.471) (-304.423) [-303.178] -- 0:00:24
607000 -- (-303.168) (-303.772) (-304.277) [-306.450] * (-304.001) (-304.209) [-304.455] (-302.072) -- 0:00:24
607500 -- (-305.192) (-304.609) (-303.851) [-309.157] * [-303.085] (-302.611) (-304.821) (-306.023) -- 0:00:24
608000 -- (-307.838) (-303.244) [-304.040] (-305.085) * (-306.082) (-305.832) [-303.237] (-308.473) -- 0:00:24
608500 -- [-303.806] (-307.113) (-303.160) (-302.875) * [-307.401] (-307.487) (-303.755) (-306.073) -- 0:00:24
609000 -- (-311.514) (-302.834) [-304.694] (-303.697) * (-305.689) (-303.043) (-304.291) [-303.662] -- 0:00:24
609500 -- (-305.641) (-303.514) [-303.703] (-302.644) * (-304.269) (-303.149) [-304.128] (-302.910) -- 0:00:24
610000 -- (-303.445) (-307.738) [-303.526] (-304.891) * [-304.237] (-305.198) (-302.415) (-302.908) -- 0:00:24
Average standard deviation of split frequencies: 0.013852
610500 -- [-305.294] (-307.597) (-305.022) (-303.126) * (-307.374) (-302.932) (-304.143) [-303.326] -- 0:00:24
611000 -- (-304.512) [-304.579] (-305.259) (-305.217) * (-308.278) (-302.900) (-306.305) [-303.374] -- 0:00:24
611500 -- (-303.335) (-305.742) [-309.655] (-307.777) * [-306.579] (-303.509) (-304.438) (-304.141) -- 0:00:24
612000 -- [-303.726] (-306.869) (-304.854) (-303.697) * [-306.156] (-302.282) (-306.735) (-304.698) -- 0:00:24
612500 -- [-304.497] (-305.909) (-303.184) (-302.968) * (-304.723) (-303.855) (-304.410) [-304.003] -- 0:00:24
613000 -- (-302.980) (-306.869) [-302.919] (-302.712) * (-305.128) (-302.844) [-303.164] (-304.823) -- 0:00:23
613500 -- (-304.012) [-302.147] (-302.384) (-303.961) * (-302.499) [-303.761] (-303.034) (-304.127) -- 0:00:23
614000 -- (-306.709) [-303.537] (-305.519) (-303.923) * (-303.943) (-302.214) [-307.052] (-303.641) -- 0:00:23
614500 -- [-306.245] (-303.490) (-306.121) (-304.851) * [-304.961] (-302.749) (-303.358) (-304.062) -- 0:00:23
615000 -- (-306.031) (-302.522) (-303.020) [-304.145] * (-305.391) (-304.122) (-305.790) [-303.825] -- 0:00:23
Average standard deviation of split frequencies: 0.012829
615500 -- (-303.519) [-304.570] (-303.902) (-303.174) * [-304.478] (-310.356) (-303.889) (-303.810) -- 0:00:23
616000 -- (-302.685) [-304.032] (-305.085) (-303.072) * (-309.372) [-307.053] (-305.090) (-304.732) -- 0:00:23
616500 -- (-304.214) (-303.312) (-306.703) [-304.239] * (-306.407) (-308.139) (-304.410) [-307.468] -- 0:00:23
617000 -- (-305.023) (-303.169) (-305.300) [-302.295] * [-306.352] (-303.905) (-305.254) (-305.027) -- 0:00:23
617500 -- (-303.644) (-304.889) (-305.062) [-305.080] * (-305.443) (-302.747) (-303.496) [-302.379] -- 0:00:23
618000 -- (-304.460) [-303.739] (-304.272) (-304.080) * (-307.473) [-304.378] (-304.295) (-308.462) -- 0:00:24
618500 -- [-302.460] (-303.772) (-303.504) (-305.374) * (-305.011) [-304.992] (-306.070) (-303.606) -- 0:00:24
619000 -- (-303.996) (-305.379) [-305.166] (-303.674) * (-302.843) [-305.056] (-307.320) (-312.525) -- 0:00:24
619500 -- (-305.025) [-305.617] (-303.088) (-304.357) * [-307.110] (-303.029) (-305.580) (-305.013) -- 0:00:23
620000 -- [-302.529] (-304.633) (-307.989) (-306.007) * [-303.680] (-304.784) (-303.850) (-303.524) -- 0:00:23
Average standard deviation of split frequencies: 0.012510
620500 -- (-306.339) [-303.124] (-304.117) (-307.939) * (-302.724) [-302.548] (-302.558) (-307.013) -- 0:00:23
621000 -- (-308.180) [-303.528] (-305.827) (-306.270) * [-302.710] (-302.403) (-303.624) (-310.185) -- 0:00:23
621500 -- (-303.277) (-302.369) [-305.867] (-307.726) * [-308.526] (-306.085) (-303.782) (-303.586) -- 0:00:23
622000 -- (-304.922) [-303.173] (-306.771) (-303.301) * (-305.596) (-302.518) [-304.375] (-304.282) -- 0:00:23
622500 -- (-303.230) (-306.833) (-306.469) [-307.693] * (-304.758) [-303.219] (-307.169) (-308.238) -- 0:00:23
623000 -- [-306.221] (-303.287) (-304.037) (-303.650) * (-302.723) (-304.266) (-308.524) [-303.722] -- 0:00:23
623500 -- (-308.911) (-308.528) [-303.333] (-303.823) * (-305.126) [-305.300] (-310.562) (-304.724) -- 0:00:23
624000 -- (-302.536) (-310.720) [-304.375] (-302.459) * (-305.064) (-306.178) [-305.849] (-306.543) -- 0:00:23
624500 -- [-302.569] (-305.349) (-303.429) (-305.838) * (-306.170) (-303.655) (-305.444) [-304.699] -- 0:00:23
625000 -- [-303.665] (-304.592) (-302.874) (-306.284) * (-309.970) [-303.156] (-307.083) (-306.145) -- 0:00:23
Average standard deviation of split frequencies: 0.013346
625500 -- [-303.192] (-303.827) (-303.164) (-302.856) * (-303.007) (-305.695) (-303.981) [-305.906] -- 0:00:23
626000 -- [-303.143] (-305.635) (-304.663) (-302.985) * (-304.120) (-302.566) (-302.105) [-306.139] -- 0:00:23
626500 -- (-306.147) [-304.474] (-303.391) (-304.102) * (-304.230) (-304.388) [-302.113] (-312.089) -- 0:00:23
627000 -- (-305.704) (-305.663) (-304.822) [-303.450] * [-304.185] (-306.604) (-302.846) (-314.436) -- 0:00:23
627500 -- (-303.700) (-302.769) [-303.508] (-311.394) * (-302.605) [-304.869] (-303.189) (-303.105) -- 0:00:23
628000 -- (-302.269) (-305.170) [-302.575] (-305.760) * (-302.651) (-304.398) (-303.774) [-303.334] -- 0:00:23
628500 -- (-302.618) (-311.665) (-302.875) [-304.745] * (-303.888) (-306.286) [-305.320] (-306.584) -- 0:00:23
629000 -- [-303.556] (-306.239) (-302.961) (-303.314) * (-304.255) [-302.766] (-303.526) (-304.573) -- 0:00:23
629500 -- (-303.687) (-302.463) [-303.881] (-306.396) * (-304.180) (-303.569) (-305.000) [-304.338] -- 0:00:22
630000 -- (-303.305) (-304.093) [-305.511] (-305.540) * (-303.652) [-304.108] (-302.238) (-309.204) -- 0:00:22
Average standard deviation of split frequencies: 0.012956
630500 -- (-304.410) [-303.300] (-302.081) (-303.388) * (-309.673) [-302.366] (-303.544) (-305.161) -- 0:00:22
631000 -- (-309.203) [-304.113] (-303.962) (-308.317) * (-303.948) [-308.369] (-302.473) (-303.057) -- 0:00:22
631500 -- (-304.194) (-305.563) [-302.333] (-305.496) * (-303.492) (-303.670) (-304.434) [-305.969] -- 0:00:22
632000 -- (-310.980) (-305.062) (-302.391) [-302.043] * (-304.997) (-308.896) (-303.000) [-302.556] -- 0:00:22
632500 -- (-304.769) (-309.415) [-302.884] (-302.162) * (-308.940) [-304.453] (-302.610) (-306.998) -- 0:00:22
633000 -- [-306.405] (-307.578) (-305.216) (-302.369) * (-303.807) [-304.092] (-302.913) (-307.023) -- 0:00:22
633500 -- (-305.340) (-305.533) (-311.547) [-305.732] * (-302.971) (-303.709) (-302.735) [-303.654] -- 0:00:22
634000 -- [-302.893] (-303.754) (-303.678) (-307.341) * (-302.935) (-302.701) (-307.288) [-302.838] -- 0:00:22
634500 -- (-305.560) (-303.250) (-303.697) [-302.492] * (-304.022) (-302.203) [-303.210] (-302.993) -- 0:00:23
635000 -- [-303.727] (-304.619) (-303.633) (-306.636) * [-303.850] (-302.441) (-304.298) (-304.136) -- 0:00:22
Average standard deviation of split frequencies: 0.013259
635500 -- [-304.008] (-305.614) (-303.836) (-304.957) * (-303.776) (-302.142) (-304.453) [-302.712] -- 0:00:22
636000 -- (-304.807) [-304.189] (-303.328) (-307.603) * (-304.349) (-302.444) [-304.048] (-306.129) -- 0:00:22
636500 -- (-302.888) [-305.535] (-303.167) (-302.934) * (-305.645) (-304.211) [-303.470] (-302.917) -- 0:00:22
637000 -- (-303.048) (-302.730) (-306.918) [-304.522] * (-303.747) [-304.124] (-306.861) (-303.614) -- 0:00:22
637500 -- [-303.782] (-302.903) (-306.809) (-302.518) * (-303.052) (-309.699) [-304.218] (-303.100) -- 0:00:22
638000 -- (-306.321) (-302.870) (-306.703) [-303.248] * (-303.724) (-306.250) [-303.982] (-305.853) -- 0:00:22
638500 -- (-303.329) (-302.435) [-304.691] (-304.656) * (-305.945) (-304.761) [-303.721] (-308.718) -- 0:00:22
639000 -- [-303.019] (-302.522) (-302.725) (-303.892) * (-303.673) [-303.627] (-303.107) (-303.655) -- 0:00:22
639500 -- (-307.131) (-303.435) (-304.109) [-302.022] * (-303.166) (-302.921) [-302.485] (-303.655) -- 0:00:22
640000 -- [-302.527] (-307.280) (-303.472) (-303.847) * (-304.802) (-303.368) (-302.977) [-305.812] -- 0:00:22
Average standard deviation of split frequencies: 0.011773
640500 -- (-304.107) (-309.406) (-304.959) [-309.995] * [-302.416] (-303.849) (-303.010) (-304.265) -- 0:00:22
641000 -- [-308.103] (-303.672) (-306.621) (-303.381) * (-305.360) (-304.026) [-305.736] (-303.459) -- 0:00:22
641500 -- (-304.823) [-304.490] (-303.186) (-306.603) * (-302.158) [-304.771] (-306.030) (-302.788) -- 0:00:22
642000 -- [-303.237] (-303.812) (-305.946) (-304.733) * (-303.399) (-312.783) [-303.307] (-303.585) -- 0:00:22
642500 -- (-305.021) (-303.235) (-303.569) [-305.695] * (-304.685) (-303.782) [-303.500] (-305.015) -- 0:00:22
643000 -- [-305.599] (-303.647) (-305.130) (-306.280) * (-305.388) (-303.275) [-302.971] (-302.202) -- 0:00:22
643500 -- (-306.339) (-306.315) (-310.442) [-303.694] * (-307.882) (-304.148) [-304.734] (-302.009) -- 0:00:22
644000 -- (-303.943) [-306.895] (-308.147) (-303.210) * (-304.820) [-305.851] (-302.997) (-301.829) -- 0:00:22
644500 -- (-305.710) [-302.351] (-308.707) (-302.425) * (-305.522) (-302.879) (-303.463) [-303.640] -- 0:00:22
645000 -- (-305.759) (-304.864) (-310.128) [-302.642] * (-307.772) (-304.272) [-302.420] (-305.721) -- 0:00:22
Average standard deviation of split frequencies: 0.011504
645500 -- (-303.472) (-304.847) [-303.849] (-303.952) * (-304.148) (-302.797) (-304.530) [-305.466] -- 0:00:21
646000 -- (-306.968) [-303.218] (-305.791) (-305.454) * (-307.190) [-303.372] (-308.297) (-305.600) -- 0:00:21
646500 -- (-306.520) (-309.035) (-307.974) [-303.349] * (-301.874) (-308.984) [-303.692] (-304.320) -- 0:00:21
647000 -- (-304.092) [-306.375] (-304.809) (-303.616) * [-305.150] (-303.241) (-308.848) (-302.288) -- 0:00:21
647500 -- (-303.345) (-304.161) (-304.816) [-304.414] * [-305.751] (-303.084) (-302.294) (-305.405) -- 0:00:21
648000 -- (-303.988) [-304.509] (-306.087) (-303.529) * [-303.657] (-308.250) (-303.004) (-304.262) -- 0:00:21
648500 -- (-301.868) (-304.461) [-304.528] (-304.444) * [-302.576] (-305.877) (-303.141) (-304.874) -- 0:00:21
649000 -- [-303.926] (-302.848) (-303.632) (-303.702) * (-302.498) (-303.178) [-302.768] (-305.399) -- 0:00:21
649500 -- (-302.896) (-308.136) (-302.061) [-306.785] * (-302.027) (-306.434) (-305.338) [-306.019] -- 0:00:21
650000 -- [-303.509] (-305.320) (-302.485) (-303.825) * (-305.832) (-304.213) (-302.426) [-302.882] -- 0:00:21
Average standard deviation of split frequencies: 0.011501
650500 -- (-304.649) (-305.957) (-304.426) [-302.330] * (-307.638) (-302.754) (-304.513) [-304.402] -- 0:00:21
651000 -- (-304.333) (-304.270) (-302.735) [-302.656] * (-303.885) (-306.950) (-307.171) [-304.520] -- 0:00:21
651500 -- (-303.140) [-302.693] (-302.135) (-304.470) * (-303.564) (-304.215) [-307.357] (-303.905) -- 0:00:21
652000 -- (-304.620) (-303.259) [-302.612] (-304.454) * (-303.901) (-303.404) [-305.297] (-302.791) -- 0:00:21
652500 -- (-302.564) (-304.542) (-304.599) [-304.078] * [-308.508] (-305.448) (-306.125) (-302.655) -- 0:00:21
653000 -- (-305.393) [-302.387] (-304.570) (-310.384) * (-308.269) (-307.193) [-302.422] (-302.315) -- 0:00:21
653500 -- (-303.995) (-302.359) (-306.342) [-304.436] * (-305.757) (-304.599) [-303.859] (-307.430) -- 0:00:21
654000 -- (-303.261) (-306.126) (-305.398) [-305.586] * [-301.987] (-305.152) (-307.604) (-302.865) -- 0:00:21
654500 -- (-305.730) [-303.479] (-304.379) (-306.173) * [-302.582] (-306.263) (-307.504) (-305.177) -- 0:00:21
655000 -- (-304.296) (-307.150) (-301.941) [-303.125] * [-302.519] (-307.214) (-304.285) (-305.141) -- 0:00:21
Average standard deviation of split frequencies: 0.011371
655500 -- (-307.020) (-307.902) [-303.754] (-305.604) * [-305.620] (-308.093) (-304.279) (-303.790) -- 0:00:21
656000 -- [-303.679] (-302.823) (-303.754) (-304.551) * (-304.075) (-304.055) (-302.715) [-303.103] -- 0:00:21
656500 -- (-305.228) (-307.140) (-306.761) [-303.126] * (-303.930) (-306.972) [-303.427] (-303.554) -- 0:00:21
657000 -- (-305.108) (-307.188) (-302.987) [-303.873] * (-305.008) (-303.771) [-304.197] (-302.060) -- 0:00:21
657500 -- (-305.171) [-306.919] (-302.426) (-307.266) * [-303.133] (-306.960) (-304.290) (-303.095) -- 0:00:21
658000 -- (-304.878) (-303.857) (-303.066) [-302.914] * (-303.730) [-302.916] (-303.092) (-305.132) -- 0:00:21
658500 -- [-303.005] (-301.914) (-302.788) (-303.021) * (-305.701) [-306.064] (-303.642) (-304.681) -- 0:00:21
659000 -- [-303.049] (-303.117) (-302.971) (-303.464) * (-302.848) (-305.129) [-303.724] (-309.225) -- 0:00:21
659500 -- (-304.922) [-302.121] (-304.953) (-306.072) * (-303.540) (-302.823) [-303.477] (-305.288) -- 0:00:21
660000 -- [-305.067] (-308.092) (-304.307) (-308.024) * [-304.064] (-303.582) (-306.041) (-305.416) -- 0:00:21
Average standard deviation of split frequencies: 0.010787
660500 -- (-304.818) (-309.434) (-302.830) [-302.713] * [-305.729] (-303.281) (-304.167) (-303.953) -- 0:00:21
661000 -- (-306.241) (-302.596) (-304.313) [-303.412] * (-302.826) [-304.251] (-306.541) (-304.391) -- 0:00:21
661500 -- [-306.343] (-304.816) (-306.377) (-303.369) * [-306.465] (-302.888) (-304.153) (-305.975) -- 0:00:20
662000 -- (-305.549) (-302.643) (-307.801) [-303.793] * [-303.701] (-304.099) (-305.101) (-304.045) -- 0:00:20
662500 -- (-304.898) [-304.275] (-303.373) (-306.789) * [-310.231] (-305.676) (-303.678) (-306.669) -- 0:00:20
663000 -- (-302.752) (-305.001) [-303.083] (-303.078) * [-305.269] (-306.298) (-304.732) (-304.062) -- 0:00:20
663500 -- (-302.898) (-303.110) [-302.422] (-303.192) * (-304.865) (-304.715) (-303.920) [-303.820] -- 0:00:20
664000 -- (-302.881) [-302.542] (-306.084) (-305.631) * (-303.300) (-306.144) [-303.661] (-304.479) -- 0:00:20
664500 -- (-304.495) (-302.743) (-302.397) [-303.686] * (-305.052) (-304.240) (-305.419) [-306.860] -- 0:00:20
665000 -- (-302.574) [-305.671] (-303.504) (-302.847) * [-303.718] (-304.629) (-310.907) (-307.911) -- 0:00:20
Average standard deviation of split frequencies: 0.010742
665500 -- (-303.640) (-303.462) [-305.463] (-303.142) * [-305.202] (-303.250) (-303.549) (-309.493) -- 0:00:20
666000 -- (-302.214) (-304.389) (-304.449) [-302.251] * (-308.617) [-303.180] (-303.757) (-303.216) -- 0:00:20
666500 -- (-304.876) (-303.359) (-306.652) [-303.419] * [-305.070] (-302.708) (-303.687) (-303.490) -- 0:00:20
667000 -- (-304.485) (-302.695) [-304.781] (-304.767) * (-304.146) (-303.390) [-308.044] (-304.107) -- 0:00:20
667500 -- (-306.649) (-305.233) (-303.555) [-304.266] * (-304.644) [-304.216] (-304.843) (-304.576) -- 0:00:20
668000 -- [-302.154] (-302.907) (-303.759) (-305.088) * (-303.557) [-305.494] (-305.208) (-305.073) -- 0:00:20
668500 -- [-302.613] (-304.047) (-303.856) (-307.240) * (-302.532) [-303.522] (-304.925) (-304.681) -- 0:00:20
669000 -- (-305.272) (-307.084) [-304.652] (-303.200) * (-305.907) (-304.544) (-302.643) [-303.904] -- 0:00:20
669500 -- (-304.432) [-303.000] (-305.782) (-303.351) * (-308.177) [-303.686] (-306.677) (-302.949) -- 0:00:20
670000 -- (-303.493) (-303.919) [-303.213] (-303.811) * [-304.031] (-303.257) (-307.869) (-306.668) -- 0:00:20
Average standard deviation of split frequencies: 0.010957
670500 -- [-302.569] (-305.128) (-303.490) (-308.108) * [-304.565] (-303.281) (-305.621) (-306.333) -- 0:00:20
671000 -- (-303.602) [-304.005] (-302.371) (-306.395) * (-304.865) (-303.136) [-304.032] (-306.241) -- 0:00:20
671500 -- [-303.267] (-302.748) (-304.427) (-303.283) * (-310.949) (-304.117) [-302.790] (-302.351) -- 0:00:20
672000 -- [-305.710] (-303.565) (-306.156) (-306.390) * (-304.813) (-305.289) [-303.058] (-303.166) -- 0:00:20
672500 -- (-305.978) (-304.079) [-302.894] (-307.016) * (-306.035) [-303.992] (-307.766) (-302.456) -- 0:00:20
673000 -- (-306.771) [-302.639] (-302.526) (-308.079) * [-303.769] (-303.542) (-303.442) (-302.451) -- 0:00:20
673500 -- (-303.978) (-304.057) (-303.792) [-303.097] * (-309.969) [-302.537] (-305.604) (-307.622) -- 0:00:20
674000 -- (-304.979) (-312.128) (-302.826) [-304.469] * (-306.378) (-303.875) (-302.753) [-304.990] -- 0:00:20
674500 -- (-305.135) (-305.125) (-302.739) [-308.571] * [-303.213] (-304.935) (-304.152) (-303.322) -- 0:00:20
675000 -- (-307.635) [-306.029] (-302.068) (-308.232) * (-303.055) (-304.690) [-302.864] (-308.389) -- 0:00:20
Average standard deviation of split frequencies: 0.011527
675500 -- [-304.701] (-304.307) (-303.753) (-303.362) * (-304.980) [-305.936] (-303.717) (-303.208) -- 0:00:20
676000 -- [-303.324] (-304.709) (-305.423) (-303.820) * (-303.953) [-303.399] (-303.358) (-304.789) -- 0:00:20
676500 -- (-307.440) (-310.234) (-307.437) [-302.566] * (-304.810) (-302.922) (-303.162) [-303.776] -- 0:00:20
677000 -- (-304.213) (-305.604) (-305.571) [-304.221] * (-305.281) (-305.193) [-302.636] (-302.791) -- 0:00:20
677500 -- [-303.378] (-303.943) (-304.340) (-303.022) * (-303.568) [-303.146] (-303.140) (-303.106) -- 0:00:19
678000 -- (-306.114) (-305.019) (-305.715) [-303.012] * (-307.943) (-302.732) (-304.544) [-302.670] -- 0:00:19
678500 -- (-305.478) (-305.566) (-306.189) [-302.786] * [-304.304] (-304.986) (-303.002) (-303.807) -- 0:00:19
679000 -- (-303.675) [-304.678] (-302.712) (-302.944) * (-302.514) [-303.954] (-302.719) (-306.617) -- 0:00:19
679500 -- (-304.238) [-302.742] (-303.325) (-303.500) * (-305.897) (-303.888) [-304.153] (-306.589) -- 0:00:19
680000 -- [-304.581] (-303.835) (-304.092) (-304.590) * [-302.504] (-302.592) (-304.169) (-302.701) -- 0:00:19
Average standard deviation of split frequencies: 0.010778
680500 -- (-307.487) (-302.086) [-303.292] (-305.008) * (-305.667) [-303.455] (-303.532) (-302.352) -- 0:00:19
681000 -- (-303.377) [-304.080] (-303.159) (-303.828) * (-304.220) [-306.083] (-302.389) (-303.062) -- 0:00:19
681500 -- (-303.421) (-303.624) [-303.964] (-304.638) * (-304.588) (-302.928) [-302.748] (-304.297) -- 0:00:19
682000 -- (-307.026) (-304.889) (-304.306) [-303.427] * (-303.658) [-304.329] (-304.750) (-304.966) -- 0:00:19
682500 -- (-304.944) [-302.093] (-304.781) (-303.475) * (-308.844) (-302.300) (-305.072) [-305.152] -- 0:00:19
683000 -- (-302.558) (-307.665) [-305.154] (-303.548) * (-307.921) (-303.436) (-302.240) [-303.036] -- 0:00:19
683500 -- (-303.405) [-304.440] (-302.758) (-303.676) * (-306.869) [-305.325] (-302.624) (-309.070) -- 0:00:19
684000 -- [-303.536] (-304.186) (-303.883) (-305.512) * (-305.922) (-308.099) (-302.166) [-302.924] -- 0:00:19
684500 -- (-306.036) (-304.044) (-306.603) [-305.041] * (-305.708) (-305.940) [-302.718] (-303.007) -- 0:00:19
685000 -- (-305.867) [-302.285] (-303.171) (-304.900) * (-304.069) (-305.172) [-303.563] (-312.543) -- 0:00:19
Average standard deviation of split frequencies: 0.011210
685500 -- (-307.713) (-303.360) (-302.886) [-304.200] * (-303.018) (-307.662) [-303.639] (-303.406) -- 0:00:19
686000 -- (-305.757) (-306.023) (-304.293) [-305.849] * (-303.362) (-306.974) (-304.332) [-305.977] -- 0:00:19
686500 -- [-306.274] (-304.049) (-305.038) (-305.422) * (-305.508) [-303.890] (-303.655) (-305.121) -- 0:00:19
687000 -- (-306.620) (-305.019) (-302.549) [-303.646] * (-307.123) [-303.246] (-304.408) (-303.067) -- 0:00:19
687500 -- (-302.562) (-306.014) [-302.643] (-307.385) * (-304.304) (-301.925) (-302.818) [-303.875] -- 0:00:19
688000 -- (-302.940) [-304.960] (-303.543) (-303.715) * [-303.322] (-302.370) (-304.400) (-303.704) -- 0:00:19
688500 -- (-303.429) (-308.286) [-304.752] (-303.424) * (-302.375) (-304.371) (-304.344) [-304.164] -- 0:00:19
689000 -- (-304.253) [-302.723] (-315.557) (-302.642) * (-303.866) [-304.393] (-305.870) (-309.732) -- 0:00:19
689500 -- [-302.598] (-307.976) (-303.160) (-302.011) * (-304.043) (-303.420) [-302.153] (-302.515) -- 0:00:19
690000 -- (-304.798) (-304.335) (-308.295) [-303.096] * [-303.708] (-303.362) (-303.481) (-302.686) -- 0:00:19
Average standard deviation of split frequencies: 0.011432
690500 -- (-302.166) (-304.140) [-303.749] (-304.048) * (-307.337) [-302.304] (-305.616) (-307.106) -- 0:00:19
691000 -- (-302.154) (-304.207) (-306.458) [-304.792] * (-308.147) (-306.074) (-304.104) [-307.797] -- 0:00:19
691500 -- (-302.646) [-302.288] (-305.950) (-306.346) * [-303.860] (-303.165) (-304.219) (-304.414) -- 0:00:19
692000 -- (-303.637) (-304.953) [-303.213] (-305.320) * (-302.604) [-307.672] (-304.978) (-304.250) -- 0:00:19
692500 -- [-303.843] (-306.563) (-303.394) (-304.838) * (-307.510) (-304.322) [-303.049] (-303.332) -- 0:00:19
693000 -- (-302.102) (-303.743) (-303.984) [-305.081] * (-303.819) (-302.370) (-307.995) [-304.772] -- 0:00:19
693500 -- [-306.156] (-309.229) (-303.509) (-305.780) * (-303.866) [-302.425] (-304.440) (-307.162) -- 0:00:19
694000 -- (-302.900) (-304.622) [-303.747] (-306.021) * [-304.523] (-302.467) (-305.986) (-306.753) -- 0:00:18
694500 -- (-302.725) (-306.198) (-303.695) [-304.478] * (-303.313) (-302.818) (-303.992) [-302.899] -- 0:00:18
695000 -- (-303.207) (-303.927) (-304.681) [-307.463] * (-305.379) (-302.813) [-302.994] (-303.273) -- 0:00:18
Average standard deviation of split frequencies: 0.011430
695500 -- (-306.938) (-306.517) (-303.625) [-303.784] * (-302.578) [-306.129] (-303.601) (-303.581) -- 0:00:18
696000 -- (-305.329) (-303.258) (-304.217) [-303.962] * (-304.922) (-308.916) (-302.546) [-303.205] -- 0:00:18
696500 -- [-302.527] (-305.853) (-302.474) (-307.436) * (-304.452) [-304.125] (-302.309) (-302.368) -- 0:00:18
697000 -- (-303.725) [-303.770] (-308.696) (-307.273) * [-303.683] (-303.512) (-306.634) (-303.283) -- 0:00:18
697500 -- (-303.863) [-303.459] (-306.004) (-302.726) * [-304.243] (-302.269) (-309.444) (-303.885) -- 0:00:18
698000 -- [-303.812] (-304.327) (-303.067) (-304.094) * (-306.517) (-308.922) [-302.724] (-305.512) -- 0:00:18
698500 -- (-302.912) (-302.390) [-305.186] (-302.402) * (-307.022) (-304.433) [-303.601] (-305.676) -- 0:00:18
699000 -- (-304.506) [-304.374] (-303.561) (-306.663) * (-303.336) [-304.246] (-308.226) (-303.123) -- 0:00:18
699500 -- [-303.358] (-304.488) (-305.084) (-303.203) * (-305.906) [-305.021] (-305.606) (-303.278) -- 0:00:18
700000 -- [-303.149] (-304.876) (-306.200) (-302.868) * [-306.141] (-305.289) (-304.867) (-306.352) -- 0:00:18
Average standard deviation of split frequencies: 0.011227
700500 -- (-302.232) [-306.833] (-302.787) (-303.623) * (-303.990) (-307.203) (-304.351) [-303.100] -- 0:00:18
701000 -- (-305.513) (-305.987) (-306.527) [-303.274] * (-302.991) [-304.007] (-303.319) (-304.251) -- 0:00:18
701500 -- (-303.827) [-305.473] (-305.277) (-304.774) * (-305.067) (-304.644) (-305.607) [-302.930] -- 0:00:18
702000 -- (-305.165) [-307.598] (-303.481) (-309.178) * (-303.202) (-303.382) [-306.962] (-302.884) -- 0:00:18
702500 -- (-303.059) (-304.105) (-311.366) [-302.719] * (-305.821) (-303.044) (-304.554) [-304.368] -- 0:00:18
703000 -- (-303.553) (-302.845) [-303.205] (-303.171) * [-304.494] (-303.660) (-306.990) (-303.619) -- 0:00:18
703500 -- [-305.466] (-302.431) (-303.575) (-305.024) * (-303.326) (-303.840) (-308.615) [-304.907] -- 0:00:18
704000 -- (-304.640) (-303.726) [-303.186] (-306.638) * (-303.955) [-303.255] (-302.518) (-309.557) -- 0:00:18
704500 -- [-305.158] (-304.128) (-304.098) (-307.904) * (-309.421) [-304.320] (-305.557) (-312.194) -- 0:00:18
705000 -- (-306.710) (-305.412) [-307.450] (-304.533) * (-304.460) (-302.708) [-304.693] (-304.034) -- 0:00:18
Average standard deviation of split frequencies: 0.011822
705500 -- (-310.355) (-306.183) [-305.810] (-304.079) * (-307.231) [-304.000] (-304.276) (-306.234) -- 0:00:18
706000 -- (-303.124) (-304.836) [-304.478] (-304.842) * [-302.717] (-303.400) (-304.615) (-304.388) -- 0:00:18
706500 -- (-305.922) [-304.035] (-303.314) (-304.606) * [-303.245] (-304.460) (-303.775) (-306.481) -- 0:00:18
707000 -- [-305.390] (-304.475) (-303.366) (-302.571) * (-303.319) [-305.582] (-308.814) (-303.002) -- 0:00:18
707500 -- [-303.592] (-306.350) (-306.178) (-302.798) * (-303.219) (-302.791) (-305.901) [-303.623] -- 0:00:18
708000 -- [-303.404] (-305.072) (-304.712) (-303.351) * (-303.555) [-303.146] (-303.785) (-303.602) -- 0:00:18
708500 -- [-304.334] (-303.688) (-306.680) (-302.599) * (-303.667) (-305.696) [-303.499] (-305.543) -- 0:00:18
709000 -- (-304.387) (-306.660) (-310.573) [-302.191] * (-303.140) (-304.057) [-302.728] (-303.491) -- 0:00:18
709500 -- (-307.601) [-303.485] (-308.283) (-305.611) * (-304.585) [-306.049] (-303.501) (-305.323) -- 0:00:18
710000 -- [-303.257] (-304.020) (-303.486) (-304.465) * (-308.254) (-311.068) [-304.496] (-307.196) -- 0:00:17
Average standard deviation of split frequencies: 0.011120
710500 -- [-305.997] (-303.760) (-303.810) (-303.980) * (-307.205) (-302.670) [-302.726] (-303.803) -- 0:00:17
711000 -- (-303.941) (-303.790) (-303.293) [-306.966] * [-302.814] (-303.718) (-304.871) (-305.235) -- 0:00:17
711500 -- [-307.912] (-304.981) (-303.204) (-303.350) * [-302.784] (-305.776) (-302.713) (-305.537) -- 0:00:17
712000 -- (-303.531) (-302.933) [-306.094] (-307.388) * (-302.815) (-311.782) (-302.582) [-302.405] -- 0:00:17
712500 -- (-304.362) [-303.313] (-304.928) (-305.421) * [-303.252] (-303.614) (-304.360) (-304.683) -- 0:00:17
713000 -- (-303.999) [-303.190] (-303.349) (-302.018) * (-306.532) (-305.064) (-304.746) [-306.469] -- 0:00:17
713500 -- [-303.472] (-308.352) (-306.191) (-303.192) * (-303.216) (-302.943) [-304.597] (-304.185) -- 0:00:17
714000 -- (-307.452) (-303.371) (-301.916) [-304.289] * [-303.340] (-304.289) (-305.282) (-305.350) -- 0:00:17
714500 -- (-304.190) (-303.672) (-304.477) [-304.935] * [-302.511] (-303.906) (-309.639) (-304.041) -- 0:00:17
715000 -- (-303.391) [-302.730] (-304.139) (-307.187) * (-304.517) [-306.426] (-304.885) (-304.879) -- 0:00:17
Average standard deviation of split frequencies: 0.010728
715500 -- (-302.638) [-305.748] (-303.622) (-305.691) * (-306.969) (-305.582) [-304.661] (-304.146) -- 0:00:17
716000 -- (-303.307) [-303.062] (-304.231) (-305.824) * (-304.163) (-304.579) [-304.173] (-310.770) -- 0:00:17
716500 -- (-305.164) (-302.760) [-306.952] (-306.931) * [-310.595] (-304.913) (-305.112) (-303.565) -- 0:00:17
717000 -- (-304.741) (-303.869) [-303.072] (-307.773) * [-303.709] (-306.391) (-311.602) (-304.928) -- 0:00:17
717500 -- (-303.337) (-302.313) (-304.578) [-302.486] * (-304.622) (-305.044) [-306.436] (-306.745) -- 0:00:17
718000 -- (-305.439) [-304.733] (-303.707) (-303.881) * (-304.765) [-302.809] (-305.167) (-307.738) -- 0:00:17
718500 -- (-306.792) (-304.095) (-305.591) [-302.435] * [-302.120] (-305.167) (-304.128) (-303.969) -- 0:00:17
719000 -- (-303.930) [-304.086] (-303.188) (-302.737) * (-303.297) (-303.189) [-303.214] (-307.580) -- 0:00:17
719500 -- (-303.354) [-303.458] (-302.197) (-305.462) * (-303.533) [-304.671] (-306.116) (-306.520) -- 0:00:17
720000 -- (-307.903) [-304.905] (-302.497) (-305.975) * (-305.947) (-306.800) (-304.652) [-304.390] -- 0:00:17
Average standard deviation of split frequencies: 0.010697
720500 -- (-302.546) (-305.440) (-304.527) [-303.786] * (-304.829) (-302.636) (-302.658) [-303.785] -- 0:00:17
721000 -- (-303.090) (-305.761) (-305.194) [-305.218] * (-303.913) [-304.115] (-304.736) (-308.161) -- 0:00:17
721500 -- (-303.988) (-307.673) (-302.732) [-304.186] * [-303.506] (-305.126) (-303.133) (-304.257) -- 0:00:17
722000 -- (-302.818) (-308.105) [-303.424] (-302.426) * (-304.959) (-306.842) [-305.842] (-304.523) -- 0:00:17
722500 -- (-303.471) [-306.768] (-306.703) (-303.605) * (-305.406) (-305.209) (-303.538) [-304.177] -- 0:00:17
723000 -- (-307.653) (-306.186) [-304.135] (-303.238) * (-307.341) (-305.092) [-304.149] (-303.805) -- 0:00:17
723500 -- (-306.472) [-302.858] (-302.666) (-303.472) * (-304.795) (-304.237) (-304.723) [-302.475] -- 0:00:17
724000 -- (-305.172) (-305.738) [-302.568] (-304.027) * (-302.479) [-303.411] (-304.298) (-306.380) -- 0:00:17
724500 -- (-302.296) (-309.287) (-303.210) [-303.501] * (-302.835) (-307.243) (-302.469) [-304.504] -- 0:00:17
725000 -- [-302.553] (-304.477) (-304.520) (-305.384) * (-304.780) (-303.046) [-303.047] (-303.920) -- 0:00:17
Average standard deviation of split frequencies: 0.010809
725500 -- (-307.226) (-303.596) [-302.931] (-306.187) * (-303.364) (-304.537) (-306.317) [-303.081] -- 0:00:17
726000 -- (-303.726) (-303.597) [-302.692] (-304.626) * [-302.285] (-303.262) (-305.163) (-304.444) -- 0:00:16
726500 -- (-308.325) (-305.578) [-305.507] (-303.978) * (-304.806) (-302.870) [-302.764] (-305.329) -- 0:00:16
727000 -- (-305.195) [-304.944] (-306.275) (-307.747) * (-304.448) [-304.526] (-304.225) (-305.345) -- 0:00:16
727500 -- (-316.729) [-304.222] (-304.629) (-308.972) * (-305.667) (-305.470) [-306.378] (-309.397) -- 0:00:16
728000 -- (-309.791) (-303.826) [-305.259] (-303.681) * (-303.984) (-306.318) [-305.483] (-308.502) -- 0:00:16
728500 -- (-305.715) (-302.985) (-303.923) [-306.823] * [-305.481] (-304.783) (-304.631) (-308.425) -- 0:00:16
729000 -- (-302.304) [-303.909] (-306.238) (-303.023) * (-303.998) (-303.200) [-306.717] (-304.518) -- 0:00:16
729500 -- (-302.699) (-304.793) (-304.076) [-304.742] * (-305.278) [-303.167] (-303.714) (-304.960) -- 0:00:16
730000 -- (-305.215) (-309.136) [-303.291] (-304.591) * (-303.231) [-304.274] (-304.012) (-308.716) -- 0:00:16
Average standard deviation of split frequencies: 0.011044
730500 -- (-306.677) (-303.333) (-304.227) [-307.303] * (-304.333) (-305.170) [-302.265] (-303.297) -- 0:00:16
731000 -- (-310.077) [-303.234] (-306.636) (-303.648) * (-303.313) (-305.970) (-305.244) [-302.751] -- 0:00:16
731500 -- (-307.520) [-303.723] (-304.942) (-304.318) * (-302.606) (-302.547) [-303.575] (-305.533) -- 0:00:16
732000 -- (-306.698) [-306.216] (-305.278) (-303.946) * (-303.436) (-303.219) [-305.246] (-306.376) -- 0:00:16
732500 -- (-304.873) (-305.389) [-306.700] (-302.468) * (-305.900) (-304.899) (-303.330) [-305.991] -- 0:00:16
733000 -- (-303.654) (-303.024) (-303.901) [-302.914] * (-305.160) [-303.754] (-304.976) (-304.796) -- 0:00:16
733500 -- (-304.939) [-303.372] (-303.398) (-305.468) * (-303.088) (-303.425) [-304.613] (-303.863) -- 0:00:16
734000 -- [-303.409] (-302.381) (-311.320) (-305.890) * (-303.325) (-306.287) (-308.494) [-304.523] -- 0:00:16
734500 -- (-304.170) (-303.753) (-305.008) [-305.019] * (-303.724) (-304.308) [-303.699] (-303.832) -- 0:00:16
735000 -- [-301.879] (-303.763) (-302.342) (-303.790) * (-307.079) [-303.773] (-303.314) (-303.013) -- 0:00:16
Average standard deviation of split frequencies: 0.011077
735500 -- [-307.793] (-303.402) (-302.894) (-302.931) * (-304.598) (-305.494) (-303.993) [-302.824] -- 0:00:16
736000 -- (-305.304) [-305.056] (-303.376) (-307.080) * (-303.861) (-305.411) [-308.679] (-303.774) -- 0:00:16
736500 -- [-302.574] (-302.691) (-305.903) (-308.206) * (-304.265) (-305.501) (-303.603) [-303.287] -- 0:00:16
737000 -- (-302.992) (-303.321) (-304.843) [-304.075] * [-304.804] (-303.803) (-302.799) (-303.221) -- 0:00:16
737500 -- (-305.550) [-306.615] (-309.432) (-302.785) * [-306.781] (-304.996) (-302.704) (-305.066) -- 0:00:16
738000 -- (-304.932) [-305.299] (-304.333) (-303.097) * (-310.702) (-303.800) [-302.347] (-303.937) -- 0:00:16
738500 -- (-305.478) (-303.792) [-308.039] (-303.579) * (-308.634) (-305.241) (-306.405) [-302.777] -- 0:00:16
739000 -- (-303.589) [-304.985] (-302.390) (-304.383) * (-306.632) (-303.812) [-305.904] (-303.578) -- 0:00:16
739500 -- (-305.535) (-303.516) [-307.753] (-304.050) * (-309.136) (-304.782) [-303.645] (-302.721) -- 0:00:16
740000 -- (-303.370) (-303.565) (-304.794) [-306.208] * (-307.441) (-306.740) (-304.579) [-303.704] -- 0:00:16
Average standard deviation of split frequencies: 0.011119
740500 -- (-303.744) [-302.810] (-307.811) (-303.409) * (-302.703) (-309.484) (-305.105) [-302.548] -- 0:00:16
741000 -- (-309.832) (-303.250) (-307.589) [-304.847] * (-305.574) (-302.519) [-303.574] (-302.591) -- 0:00:16
741500 -- (-308.272) (-305.300) [-307.799] (-303.444) * [-303.390] (-308.231) (-309.114) (-304.260) -- 0:00:16
742000 -- (-303.258) [-303.549] (-304.042) (-307.444) * [-304.947] (-302.908) (-305.792) (-308.248) -- 0:00:15
742500 -- (-310.026) [-304.075] (-304.709) (-302.420) * (-305.590) [-305.800] (-305.191) (-302.765) -- 0:00:15
743000 -- (-309.847) [-303.404] (-302.997) (-302.501) * (-304.415) (-305.076) [-310.206] (-310.135) -- 0:00:15
743500 -- (-305.216) [-302.911] (-302.679) (-302.475) * [-303.775] (-304.017) (-306.522) (-306.847) -- 0:00:15
744000 -- (-302.747) (-307.837) [-303.956] (-304.263) * [-304.933] (-303.714) (-303.545) (-302.957) -- 0:00:15
744500 -- [-304.305] (-303.826) (-302.983) (-305.790) * (-302.354) [-303.967] (-302.724) (-307.283) -- 0:00:15
745000 -- (-303.580) (-303.510) (-303.650) [-302.571] * (-304.999) [-303.779] (-304.465) (-302.978) -- 0:00:15
Average standard deviation of split frequencies: 0.011077
745500 -- (-303.151) (-308.627) (-303.082) [-308.095] * (-309.625) [-303.878] (-303.338) (-307.513) -- 0:00:15
746000 -- (-303.298) (-302.808) [-303.854] (-303.826) * [-303.267] (-302.901) (-303.922) (-307.059) -- 0:00:15
746500 -- (-303.567) (-307.471) [-303.486] (-305.036) * (-302.553) [-304.005] (-308.084) (-305.204) -- 0:00:15
747000 -- (-304.080) (-303.728) (-302.900) [-304.163] * [-303.105] (-303.553) (-302.151) (-305.260) -- 0:00:15
747500 -- (-303.702) (-306.135) (-303.449) [-303.013] * (-302.611) (-303.983) (-303.758) [-304.231] -- 0:00:15
748000 -- (-304.366) (-303.609) [-303.902] (-304.738) * (-304.797) [-305.638] (-303.232) (-307.846) -- 0:00:15
748500 -- (-303.020) (-306.674) [-303.321] (-303.129) * (-307.586) [-305.315] (-307.039) (-303.322) -- 0:00:15
749000 -- [-302.752] (-306.282) (-305.906) (-306.493) * [-306.511] (-302.748) (-306.118) (-302.263) -- 0:00:15
749500 -- [-304.060] (-303.858) (-309.840) (-304.870) * [-303.767] (-305.186) (-305.135) (-302.714) -- 0:00:15
750000 -- (-309.142) [-304.726] (-304.931) (-304.039) * [-303.063] (-304.577) (-303.915) (-302.637) -- 0:00:15
Average standard deviation of split frequencies: 0.011461
750500 -- (-305.925) (-303.365) [-306.551] (-304.494) * (-305.654) (-309.437) (-303.431) [-304.231] -- 0:00:15
751000 -- (-305.735) (-302.937) [-304.966] (-305.507) * [-302.846] (-306.704) (-304.353) (-304.929) -- 0:00:15
751500 -- (-309.195) [-304.627] (-302.784) (-306.245) * (-302.968) (-305.761) [-307.011] (-305.593) -- 0:00:15
752000 -- (-305.400) [-303.610] (-302.167) (-304.308) * (-303.616) (-302.561) [-307.282] (-303.789) -- 0:00:15
752500 -- (-305.754) (-304.774) (-304.610) [-304.475] * (-306.274) [-303.351] (-303.559) (-304.822) -- 0:00:15
753000 -- (-304.381) (-302.367) [-302.591] (-308.156) * [-303.293] (-304.467) (-304.308) (-302.405) -- 0:00:15
753500 -- (-309.537) [-303.164] (-305.084) (-310.963) * (-306.040) (-305.630) (-303.579) [-303.100] -- 0:00:15
754000 -- (-305.289) (-303.216) [-303.756] (-303.087) * (-303.779) (-303.786) [-307.240] (-305.749) -- 0:00:15
754500 -- (-306.153) (-307.517) [-302.531] (-302.543) * (-303.090) (-306.162) (-303.791) [-305.371] -- 0:00:15
755000 -- [-304.463] (-304.241) (-304.957) (-304.226) * (-303.930) (-305.710) [-302.347] (-303.211) -- 0:00:15
Average standard deviation of split frequencies: 0.011419
755500 -- (-303.624) [-303.690] (-303.014) (-305.065) * (-304.860) [-307.613] (-303.766) (-306.599) -- 0:00:15
756000 -- (-304.018) (-304.506) (-303.093) [-304.341] * (-305.520) [-305.573] (-306.980) (-302.495) -- 0:00:15
756500 -- (-303.490) (-303.274) (-304.264) [-304.035] * (-304.702) [-304.510] (-305.116) (-302.422) -- 0:00:15
757000 -- (-303.984) (-302.429) [-303.074] (-302.263) * (-304.311) (-304.869) (-304.833) [-302.939] -- 0:00:15
757500 -- [-307.246] (-304.109) (-303.673) (-304.557) * (-305.633) [-304.556] (-304.697) (-305.321) -- 0:00:15
758000 -- [-309.139] (-304.067) (-308.402) (-305.929) * [-302.369] (-305.433) (-302.705) (-303.795) -- 0:00:15
758500 -- (-304.217) (-303.456) (-304.628) [-304.469] * (-303.546) (-304.380) (-302.812) [-302.658] -- 0:00:14
759000 -- [-302.876] (-304.408) (-303.652) (-304.460) * (-306.420) [-302.596] (-303.487) (-305.356) -- 0:00:14
759500 -- (-303.141) (-303.989) [-305.122] (-304.701) * (-305.733) [-304.301] (-305.276) (-303.178) -- 0:00:14
760000 -- (-303.815) (-306.485) (-308.536) [-305.618] * (-302.754) [-303.099] (-304.417) (-304.466) -- 0:00:14
Average standard deviation of split frequencies: 0.011039
760500 -- [-302.547] (-305.264) (-306.358) (-306.851) * (-302.746) (-307.389) [-304.893] (-303.314) -- 0:00:14
761000 -- (-306.294) (-304.493) (-303.720) [-302.899] * (-305.721) (-305.395) (-309.043) [-302.587] -- 0:00:14
761500 -- (-303.159) (-303.572) (-303.624) [-303.847] * [-302.178] (-303.256) (-304.990) (-302.445) -- 0:00:14
762000 -- (-303.868) (-303.796) [-304.841] (-306.101) * [-302.384] (-306.448) (-306.422) (-307.902) -- 0:00:14
762500 -- (-305.442) (-304.286) [-303.853] (-305.476) * (-307.731) (-305.168) (-308.814) [-304.250] -- 0:00:14
763000 -- (-305.754) [-303.902] (-304.356) (-304.391) * (-302.649) (-303.687) (-308.014) [-305.541] -- 0:00:14
763500 -- [-305.122] (-306.348) (-304.127) (-306.370) * (-304.273) (-307.840) (-309.788) [-304.649] -- 0:00:14
764000 -- (-302.871) (-306.776) [-304.226] (-303.528) * [-303.134] (-304.361) (-306.296) (-304.257) -- 0:00:14
764500 -- (-304.750) [-306.153] (-305.714) (-305.262) * (-303.216) (-307.486) [-305.536] (-305.437) -- 0:00:14
765000 -- (-302.522) [-303.980] (-305.632) (-304.309) * [-303.205] (-307.352) (-305.014) (-303.717) -- 0:00:14
Average standard deviation of split frequencies: 0.010731
765500 -- (-303.376) [-303.376] (-304.301) (-302.812) * (-304.126) [-304.005] (-302.654) (-308.480) -- 0:00:14
766000 -- (-303.250) [-303.389] (-305.768) (-311.032) * [-303.585] (-302.965) (-303.085) (-305.147) -- 0:00:14
766500 -- [-307.471] (-304.363) (-303.114) (-306.297) * (-304.232) (-305.718) (-304.305) [-309.198] -- 0:00:14
767000 -- [-303.474] (-303.037) (-302.974) (-305.741) * (-303.101) (-307.163) [-306.320] (-310.566) -- 0:00:14
767500 -- (-302.618) [-302.687] (-302.884) (-303.281) * [-307.187] (-303.895) (-303.648) (-310.490) -- 0:00:14
768000 -- (-302.648) (-302.662) (-305.553) [-302.782] * (-308.417) (-304.950) (-305.760) [-306.791] -- 0:00:14
768500 -- (-303.907) (-303.705) [-308.303] (-303.265) * (-303.019) [-302.541] (-304.758) (-303.789) -- 0:00:14
769000 -- (-302.674) (-305.812) [-310.609] (-306.451) * (-305.276) [-302.993] (-303.562) (-303.542) -- 0:00:14
769500 -- (-303.692) (-305.187) (-304.207) [-302.507] * [-305.957] (-304.152) (-304.093) (-302.977) -- 0:00:14
770000 -- [-304.522] (-303.376) (-305.191) (-303.844) * (-311.794) [-303.202] (-303.997) (-303.248) -- 0:00:14
Average standard deviation of split frequencies: 0.009665
770500 -- (-305.952) [-306.300] (-305.425) (-302.903) * (-305.743) (-303.672) [-304.696] (-302.387) -- 0:00:14
771000 -- (-305.321) [-306.703] (-303.272) (-305.093) * [-313.569] (-306.665) (-306.042) (-306.362) -- 0:00:14
771500 -- (-304.143) [-303.263] (-304.310) (-306.335) * (-303.758) (-303.476) [-302.776] (-306.958) -- 0:00:14
772000 -- (-307.096) [-302.629] (-309.817) (-304.156) * (-304.079) [-307.108] (-303.834) (-306.827) -- 0:00:14
772500 -- (-306.110) [-302.213] (-304.243) (-303.094) * (-306.726) (-302.281) (-303.051) [-305.638] -- 0:00:14
773000 -- (-305.884) (-302.252) [-304.437] (-302.369) * (-305.822) (-302.326) (-305.989) [-303.649] -- 0:00:14
773500 -- (-305.523) [-302.179] (-304.441) (-302.458) * (-308.801) [-304.010] (-306.941) (-305.554) -- 0:00:14
774000 -- [-303.383] (-303.064) (-303.510) (-304.668) * (-304.348) [-304.756] (-302.826) (-305.306) -- 0:00:14
774500 -- (-307.075) (-302.985) [-303.209] (-306.607) * (-303.740) (-303.114) (-304.292) [-305.617] -- 0:00:13
775000 -- (-304.097) (-306.021) (-304.717) [-305.270] * [-304.848] (-303.071) (-303.192) (-305.892) -- 0:00:13
Average standard deviation of split frequencies: 0.009682
775500 -- [-302.993] (-306.480) (-304.651) (-303.051) * (-305.350) (-306.436) [-303.289] (-305.773) -- 0:00:13
776000 -- (-303.718) [-307.026] (-304.410) (-306.124) * (-302.283) (-303.186) [-302.271] (-303.795) -- 0:00:13
776500 -- [-304.194] (-305.594) (-303.354) (-304.206) * [-304.904] (-305.020) (-303.801) (-304.015) -- 0:00:13
777000 -- (-304.216) (-305.599) [-303.224] (-303.467) * (-304.720) (-304.339) (-302.382) [-306.588] -- 0:00:13
777500 -- (-306.346) (-304.500) (-304.262) [-302.137] * [-303.055] (-303.406) (-307.754) (-303.288) -- 0:00:13
778000 -- (-309.655) (-305.656) (-303.832) [-304.038] * (-302.606) [-307.135] (-304.477) (-302.668) -- 0:00:13
778500 -- (-303.683) (-305.155) [-306.918] (-307.507) * (-304.170) (-307.502) [-303.992] (-304.985) -- 0:00:13
779000 -- (-305.003) (-304.092) [-303.880] (-305.615) * (-302.666) [-307.261] (-306.902) (-302.492) -- 0:00:13
779500 -- (-304.280) (-305.082) [-307.404] (-305.228) * [-302.022] (-305.685) (-304.140) (-303.246) -- 0:00:13
780000 -- (-303.389) [-310.438] (-303.703) (-306.023) * (-304.945) [-305.406] (-305.069) (-303.555) -- 0:00:13
Average standard deviation of split frequencies: 0.009926
780500 -- (-305.645) [-308.274] (-302.916) (-304.673) * (-305.333) (-304.490) [-303.374] (-303.330) -- 0:00:13
781000 -- (-307.936) (-308.761) [-304.096] (-304.473) * (-306.474) [-306.507] (-303.643) (-302.917) -- 0:00:13
781500 -- [-309.009] (-305.147) (-303.369) (-303.832) * (-302.974) (-304.258) [-303.984] (-302.503) -- 0:00:13
782000 -- [-304.031] (-304.412) (-304.148) (-310.672) * (-304.567) [-304.567] (-306.926) (-303.261) -- 0:00:13
782500 -- (-304.080) [-305.380] (-303.967) (-303.215) * (-302.840) (-303.291) (-304.856) [-304.884] -- 0:00:13
783000 -- (-304.914) [-302.228] (-304.921) (-306.195) * [-304.387] (-303.586) (-304.142) (-302.168) -- 0:00:13
783500 -- [-302.000] (-303.319) (-303.045) (-302.114) * (-302.947) [-302.707] (-303.427) (-302.379) -- 0:00:13
784000 -- [-304.736] (-303.719) (-302.720) (-302.263) * [-302.931] (-304.751) (-302.242) (-303.794) -- 0:00:13
784500 -- (-304.205) (-304.752) [-305.206] (-303.540) * (-303.039) [-303.883] (-302.786) (-307.493) -- 0:00:13
785000 -- (-304.811) (-304.261) [-306.465] (-305.809) * (-302.954) (-304.668) [-304.850] (-305.820) -- 0:00:13
Average standard deviation of split frequencies: 0.010008
785500 -- (-306.468) [-302.311] (-306.781) (-305.617) * [-303.150] (-303.886) (-303.060) (-305.146) -- 0:00:13
786000 -- (-303.601) (-302.332) [-303.459] (-305.706) * (-304.003) (-302.528) (-304.555) [-302.894] -- 0:00:13
786500 -- [-302.198] (-306.847) (-305.214) (-302.890) * (-303.615) (-306.367) [-303.585] (-303.431) -- 0:00:13
787000 -- (-309.479) (-305.811) (-305.088) [-303.248] * (-304.465) (-303.633) (-306.225) [-304.256] -- 0:00:13
787500 -- (-304.540) [-306.905] (-303.296) (-302.660) * (-303.764) (-302.219) [-303.359] (-302.435) -- 0:00:13
788000 -- (-313.184) (-308.537) (-303.678) [-303.324] * (-304.242) (-304.831) [-303.085] (-306.113) -- 0:00:13
788500 -- (-305.969) [-307.372] (-303.237) (-305.947) * [-303.847] (-304.199) (-302.292) (-308.456) -- 0:00:13
789000 -- [-304.523] (-303.466) (-303.612) (-306.274) * [-307.643] (-302.474) (-308.680) (-303.045) -- 0:00:13
789500 -- (-302.607) [-304.617] (-307.428) (-306.507) * (-305.694) (-302.728) [-303.680] (-303.450) -- 0:00:13
790000 -- [-303.648] (-302.413) (-306.292) (-305.674) * (-303.145) [-303.118] (-306.243) (-304.016) -- 0:00:13
Average standard deviation of split frequencies: 0.010173
790500 -- (-304.822) (-304.704) [-304.806] (-306.271) * (-302.922) (-303.761) (-304.055) [-305.786] -- 0:00:12
791000 -- (-304.756) [-302.668] (-306.160) (-304.178) * [-304.403] (-306.208) (-308.367) (-305.952) -- 0:00:12
791500 -- (-302.746) (-304.914) [-307.819] (-303.661) * (-302.600) (-304.016) (-307.913) [-303.115] -- 0:00:12
792000 -- (-305.297) [-307.091] (-309.425) (-303.004) * (-304.361) (-305.645) [-303.608] (-305.504) -- 0:00:12
792500 -- (-305.221) [-306.315] (-303.414) (-303.336) * (-302.330) (-302.615) (-303.108) [-302.621] -- 0:00:12
793000 -- (-306.086) (-304.876) [-303.204] (-303.587) * [-304.924] (-302.947) (-304.715) (-305.438) -- 0:00:12
793500 -- (-303.503) (-303.598) (-304.421) [-304.219] * (-308.394) (-303.002) [-303.043] (-306.087) -- 0:00:12
794000 -- (-304.957) (-305.668) [-303.233] (-306.853) * (-302.840) (-302.305) [-305.221] (-302.941) -- 0:00:12
794500 -- [-302.927] (-304.341) (-306.802) (-302.597) * [-302.093] (-304.692) (-306.112) (-305.586) -- 0:00:12
795000 -- [-306.135] (-302.225) (-307.937) (-302.796) * [-304.116] (-304.453) (-304.038) (-304.779) -- 0:00:12
Average standard deviation of split frequencies: 0.010697
795500 -- [-304.225] (-303.380) (-302.858) (-302.810) * (-302.883) (-303.953) (-304.629) [-305.142] -- 0:00:12
796000 -- [-304.610] (-302.956) (-302.524) (-301.896) * [-303.353] (-303.462) (-302.312) (-307.621) -- 0:00:12
796500 -- (-305.293) [-302.285] (-302.600) (-307.177) * (-303.183) (-302.761) [-302.306] (-306.712) -- 0:00:12
797000 -- (-302.508) (-302.553) (-304.058) [-307.646] * (-305.536) (-304.400) (-305.140) [-305.656] -- 0:00:12
797500 -- (-303.487) (-302.996) (-303.833) [-306.852] * [-305.951] (-305.817) (-307.559) (-305.310) -- 0:00:12
798000 -- [-306.382] (-303.279) (-303.376) (-303.058) * (-306.917) (-305.654) [-303.072] (-309.450) -- 0:00:12
798500 -- (-304.656) [-303.519] (-304.202) (-302.377) * (-306.069) (-311.492) (-302.577) [-307.035] -- 0:00:12
799000 -- [-305.742] (-306.149) (-308.902) (-305.623) * (-303.665) (-304.659) (-303.413) [-306.270] -- 0:00:12
799500 -- (-302.600) [-303.724] (-308.685) (-303.618) * (-303.324) (-303.244) [-303.570] (-306.459) -- 0:00:12
800000 -- [-304.394] (-306.246) (-302.994) (-305.678) * (-307.334) (-306.676) (-304.943) [-303.931] -- 0:00:12
Average standard deviation of split frequencies: 0.010524
800500 -- (-303.213) (-303.868) (-304.501) [-304.094] * (-307.654) (-304.948) [-302.295] (-304.235) -- 0:00:12
801000 -- (-304.857) [-302.276] (-304.674) (-303.115) * (-305.396) [-303.369] (-304.884) (-305.073) -- 0:00:12
801500 -- (-303.398) (-305.844) [-302.592] (-302.647) * (-303.159) [-303.568] (-302.751) (-302.680) -- 0:00:12
802000 -- (-306.964) (-307.772) [-304.660] (-305.586) * (-303.013) (-303.570) [-302.502] (-303.185) -- 0:00:12
802500 -- (-304.116) [-302.184] (-304.666) (-304.123) * (-307.412) (-305.321) [-302.862] (-304.464) -- 0:00:12
803000 -- (-303.238) [-302.403] (-305.853) (-308.827) * (-305.179) [-305.523] (-303.064) (-305.417) -- 0:00:12
803500 -- (-303.191) (-305.173) [-305.477] (-303.819) * [-307.188] (-303.748) (-308.083) (-302.746) -- 0:00:12
804000 -- (-303.466) [-302.371] (-303.311) (-311.299) * (-304.851) (-303.528) [-302.216] (-304.403) -- 0:00:12
804500 -- (-306.568) (-305.034) (-305.348) [-304.394] * (-306.615) (-303.509) (-302.611) [-303.896] -- 0:00:12
805000 -- (-307.040) (-303.511) (-304.630) [-306.570] * (-305.367) [-306.954] (-304.907) (-304.492) -- 0:00:12
Average standard deviation of split frequencies: 0.010235
805500 -- (-306.193) (-305.682) (-306.198) [-304.463] * (-303.318) (-304.016) (-305.678) [-304.075] -- 0:00:12
806000 -- (-302.853) (-304.471) [-303.916] (-303.524) * (-302.750) (-304.960) (-304.021) [-303.391] -- 0:00:12
806500 -- (-303.466) (-303.835) [-302.409] (-302.148) * [-303.232] (-302.625) (-304.641) (-303.565) -- 0:00:11
807000 -- (-303.328) (-304.072) [-304.121] (-303.906) * (-305.770) [-304.661] (-305.146) (-304.638) -- 0:00:11
807500 -- (-307.205) (-303.622) [-303.433] (-303.304) * (-302.846) [-306.420] (-303.949) (-307.614) -- 0:00:11
808000 -- (-302.928) (-304.827) (-304.231) [-302.966] * (-305.907) [-302.957] (-302.907) (-302.682) -- 0:00:11
808500 -- (-303.510) [-303.237] (-306.053) (-303.036) * [-305.381] (-302.745) (-303.082) (-306.409) -- 0:00:11
809000 -- (-303.798) (-303.406) (-303.605) [-305.466] * (-303.513) (-302.984) (-306.113) [-304.085] -- 0:00:11
809500 -- (-305.561) (-303.978) (-304.989) [-302.760] * (-304.817) [-307.565] (-307.051) (-302.537) -- 0:00:11
810000 -- (-305.812) [-303.398] (-302.825) (-306.117) * (-304.424) (-305.001) [-302.748] (-305.124) -- 0:00:11
Average standard deviation of split frequencies: 0.010031
810500 -- (-303.601) (-303.457) [-302.097] (-306.565) * (-305.560) (-302.838) [-303.606] (-304.226) -- 0:00:11
811000 -- (-305.092) (-302.642) [-305.945] (-306.348) * (-303.071) (-303.337) (-307.686) [-303.927] -- 0:00:11
811500 -- (-302.482) (-302.662) [-305.777] (-304.727) * (-305.611) (-304.250) [-305.712] (-305.086) -- 0:00:11
812000 -- (-303.584) (-303.407) [-302.622] (-305.571) * (-304.737) (-306.997) (-305.930) [-310.156] -- 0:00:11
812500 -- [-303.032] (-305.619) (-303.356) (-306.948) * [-304.283] (-303.869) (-302.271) (-307.911) -- 0:00:11
813000 -- (-304.577) (-303.582) [-303.973] (-305.294) * (-305.557) (-301.978) [-302.292] (-305.058) -- 0:00:11
813500 -- (-302.879) [-303.466] (-303.796) (-303.619) * (-304.915) (-303.601) [-304.213] (-302.785) -- 0:00:11
814000 -- (-303.524) (-303.807) [-304.382] (-304.925) * (-302.774) (-303.171) (-304.936) [-304.395] -- 0:00:11
814500 -- [-304.309] (-304.102) (-305.064) (-306.697) * [-302.767] (-303.977) (-304.019) (-302.946) -- 0:00:11
815000 -- [-305.321] (-304.033) (-304.948) (-306.450) * [-304.117] (-308.054) (-303.946) (-302.926) -- 0:00:11
Average standard deviation of split frequencies: 0.009929
815500 -- (-305.650) (-303.506) [-304.255] (-302.918) * (-303.516) (-303.971) [-303.847] (-303.776) -- 0:00:11
816000 -- (-303.504) (-307.404) (-303.993) [-302.241] * (-303.621) (-306.452) (-302.999) [-303.426] -- 0:00:11
816500 -- (-304.324) [-302.530] (-305.625) (-303.436) * (-308.032) (-304.452) [-304.451] (-305.661) -- 0:00:11
817000 -- [-304.357] (-305.834) (-305.946) (-303.859) * (-303.591) (-305.539) (-308.176) [-303.216] -- 0:00:11
817500 -- (-302.910) (-306.702) (-302.594) [-302.827] * (-304.893) (-305.962) [-306.014] (-304.283) -- 0:00:11
818000 -- (-303.459) [-302.480] (-303.819) (-307.790) * (-303.858) (-305.384) [-303.124] (-302.713) -- 0:00:11
818500 -- (-305.875) (-307.471) [-305.161] (-302.422) * (-306.830) [-303.808] (-303.428) (-303.261) -- 0:00:11
819000 -- (-303.146) [-305.151] (-305.724) (-306.569) * [-304.714] (-305.673) (-305.360) (-303.215) -- 0:00:11
819500 -- (-303.506) (-303.287) [-305.104] (-304.548) * (-303.511) [-302.632] (-302.763) (-303.949) -- 0:00:11
820000 -- (-305.362) (-302.188) [-305.036] (-306.109) * (-305.842) (-303.466) [-306.287] (-304.309) -- 0:00:11
Average standard deviation of split frequencies: 0.009765
820500 -- (-305.312) (-303.940) [-303.173] (-304.941) * (-303.194) (-305.637) [-305.763] (-305.357) -- 0:00:11
821000 -- (-304.333) [-302.572] (-304.241) (-305.478) * (-305.249) (-306.695) (-304.145) [-302.582] -- 0:00:11
821500 -- (-303.752) (-303.534) [-303.186] (-303.574) * (-303.718) [-302.834] (-302.963) (-304.368) -- 0:00:11
822000 -- (-305.163) (-305.870) [-304.048] (-303.604) * (-304.968) [-304.024] (-305.359) (-303.779) -- 0:00:11
822500 -- (-305.862) (-305.352) [-304.108] (-305.352) * (-306.381) [-302.865] (-304.435) (-305.651) -- 0:00:11
823000 -- (-305.774) (-305.282) [-306.297] (-303.241) * (-305.918) [-302.258] (-303.622) (-303.388) -- 0:00:10
823500 -- [-302.156] (-304.507) (-305.934) (-303.430) * (-304.461) (-303.812) [-303.850] (-305.761) -- 0:00:10
824000 -- (-305.247) [-303.612] (-310.163) (-305.490) * [-303.894] (-302.263) (-302.585) (-305.380) -- 0:00:10
824500 -- [-305.493] (-309.800) (-304.368) (-305.220) * (-305.763) (-303.542) (-302.884) [-304.713] -- 0:00:10
825000 -- (-305.167) (-308.973) (-302.138) [-304.750] * [-305.624] (-303.925) (-305.639) (-305.506) -- 0:00:10
Average standard deviation of split frequencies: 0.009167
825500 -- [-302.757] (-306.843) (-303.050) (-305.094) * (-303.905) (-303.560) [-305.885] (-302.832) -- 0:00:10
826000 -- (-308.713) (-306.482) [-309.307] (-303.702) * (-304.320) [-302.043] (-305.185) (-302.708) -- 0:00:10
826500 -- (-307.401) (-303.461) (-306.862) [-304.731] * (-304.731) (-303.352) (-306.882) [-302.243] -- 0:00:10
827000 -- (-306.227) (-303.144) [-305.993] (-304.898) * [-305.107] (-304.749) (-303.407) (-305.561) -- 0:00:10
827500 -- (-303.493) (-304.910) [-305.607] (-305.392) * (-306.027) (-304.381) (-303.732) [-303.181] -- 0:00:10
828000 -- (-302.891) (-307.404) (-307.161) [-302.297] * (-304.998) (-303.272) [-303.540] (-305.483) -- 0:00:10
828500 -- (-304.190) (-302.484) (-309.144) [-303.253] * (-308.546) [-303.493] (-305.391) (-304.950) -- 0:00:10
829000 -- (-303.282) [-306.007] (-304.160) (-302.506) * (-304.065) (-307.815) [-304.903] (-309.947) -- 0:00:10
829500 -- [-304.703] (-306.561) (-305.040) (-303.783) * (-307.161) (-308.850) (-307.170) [-306.908] -- 0:00:10
830000 -- (-304.584) [-303.307] (-303.605) (-303.370) * [-304.082] (-307.421) (-304.552) (-305.040) -- 0:00:10
Average standard deviation of split frequencies: 0.008690
830500 -- (-304.714) (-302.781) (-302.622) [-304.265] * (-304.288) (-304.062) [-303.160] (-305.402) -- 0:00:10
831000 -- [-303.679] (-302.891) (-302.371) (-306.732) * (-303.025) (-303.702) [-303.586] (-306.688) -- 0:00:10
831500 -- (-305.811) (-303.162) [-306.055] (-303.282) * (-303.566) (-307.841) (-302.975) [-306.065] -- 0:00:10
832000 -- (-303.678) (-302.834) [-304.902] (-302.898) * (-305.350) [-302.663] (-302.483) (-304.548) -- 0:00:10
832500 -- (-304.644) (-302.677) [-304.182] (-304.588) * [-303.989] (-305.497) (-302.417) (-305.756) -- 0:00:10
833000 -- [-302.189] (-304.309) (-303.474) (-303.960) * (-305.019) (-303.167) [-309.168] (-303.317) -- 0:00:10
833500 -- [-302.481] (-303.560) (-306.874) (-304.821) * (-303.025) (-303.549) [-304.980] (-302.607) -- 0:00:10
834000 -- [-304.070] (-302.976) (-307.498) (-302.205) * [-303.118] (-305.484) (-306.856) (-302.303) -- 0:00:10
834500 -- (-303.384) (-303.943) (-306.543) [-303.909] * (-304.070) [-304.282] (-309.006) (-306.394) -- 0:00:10
835000 -- (-302.661) (-305.935) (-305.458) [-304.193] * (-303.320) (-307.093) (-305.625) [-306.346] -- 0:00:10
Average standard deviation of split frequencies: 0.008599
835500 -- (-302.700) [-305.863] (-304.926) (-306.432) * [-307.269] (-304.237) (-304.891) (-305.306) -- 0:00:10
836000 -- (-304.529) (-303.798) (-308.376) [-308.087] * (-304.122) [-305.530] (-306.504) (-303.288) -- 0:00:10
836500 -- [-302.495] (-304.428) (-302.602) (-304.532) * (-308.643) [-307.983] (-304.578) (-303.894) -- 0:00:10
837000 -- [-302.815] (-308.586) (-307.945) (-303.514) * (-308.944) [-303.828] (-306.527) (-304.220) -- 0:00:10
837500 -- [-304.550] (-303.844) (-305.490) (-304.287) * [-303.077] (-304.797) (-312.055) (-303.603) -- 0:00:10
838000 -- (-307.578) (-305.111) [-305.161] (-303.936) * [-308.121] (-305.508) (-308.381) (-303.216) -- 0:00:10
838500 -- (-303.307) (-304.434) (-305.713) [-304.333] * (-303.603) (-302.657) [-304.760] (-303.720) -- 0:00:10
839000 -- (-303.249) (-303.567) (-302.286) [-307.555] * (-303.160) [-303.595] (-305.974) (-302.979) -- 0:00:09
839500 -- (-304.121) [-303.038] (-303.559) (-306.528) * [-305.141] (-305.451) (-302.384) (-304.463) -- 0:00:09
840000 -- (-304.998) [-305.830] (-305.443) (-302.163) * (-310.080) [-305.933] (-302.903) (-304.570) -- 0:00:09
Average standard deviation of split frequencies: 0.008832
840500 -- (-307.170) (-302.920) [-303.559] (-302.471) * (-303.514) (-302.362) [-304.858] (-305.429) -- 0:00:09
841000 -- (-305.831) (-302.117) (-305.762) [-302.707] * [-302.323] (-304.005) (-303.905) (-303.394) -- 0:00:09
841500 -- (-305.102) [-302.680] (-306.557) (-301.993) * (-303.637) [-304.827] (-304.384) (-302.478) -- 0:00:09
842000 -- (-304.583) (-302.897) [-303.818] (-305.300) * (-303.510) (-303.180) (-308.088) [-303.829] -- 0:00:09
842500 -- (-305.541) [-302.576] (-304.099) (-308.546) * (-302.999) (-303.010) (-306.664) [-302.162] -- 0:00:09
843000 -- [-304.894] (-302.843) (-303.789) (-304.565) * [-306.796] (-304.085) (-305.063) (-301.992) -- 0:00:09
843500 -- (-303.384) (-303.040) (-307.957) [-306.840] * (-303.531) (-303.631) (-307.223) [-304.165] -- 0:00:09
844000 -- (-302.896) (-303.040) (-302.326) [-302.885] * (-305.078) (-302.826) (-304.249) [-304.251] -- 0:00:09
844500 -- (-303.036) (-302.501) [-303.575] (-304.659) * [-303.400] (-302.675) (-302.773) (-305.402) -- 0:00:09
845000 -- [-303.899] (-302.677) (-304.039) (-305.172) * (-307.640) (-304.331) (-303.495) [-305.374] -- 0:00:09
Average standard deviation of split frequencies: 0.009124
845500 -- [-303.360] (-303.687) (-310.122) (-302.139) * [-304.844] (-304.520) (-305.027) (-305.428) -- 0:00:09
846000 -- (-306.013) (-304.465) (-305.385) [-305.712] * [-304.259] (-306.903) (-304.099) (-305.888) -- 0:00:09
846500 -- (-303.477) [-303.260] (-305.665) (-305.564) * (-310.181) (-304.553) [-303.424] (-303.672) -- 0:00:09
847000 -- (-302.255) [-306.118] (-309.442) (-303.026) * [-306.174] (-305.219) (-307.176) (-303.095) -- 0:00:09
847500 -- (-305.631) (-304.054) (-304.653) [-304.696] * (-302.828) [-305.819] (-304.476) (-308.412) -- 0:00:09
848000 -- (-302.516) (-303.460) (-303.683) [-302.782] * (-304.233) (-305.871) (-304.715) [-304.302] -- 0:00:09
848500 -- [-303.352] (-305.382) (-302.029) (-304.180) * (-303.184) [-303.572] (-303.890) (-304.940) -- 0:00:09
849000 -- (-304.012) [-305.316] (-304.069) (-304.205) * (-302.768) [-303.500] (-307.214) (-305.286) -- 0:00:09
849500 -- (-313.656) (-303.576) (-303.228) [-307.246] * [-306.539] (-304.764) (-303.446) (-304.021) -- 0:00:09
850000 -- (-314.041) (-304.579) [-302.597] (-307.797) * [-305.726] (-305.203) (-305.029) (-303.912) -- 0:00:09
Average standard deviation of split frequencies: 0.009836
850500 -- (-306.685) [-303.811] (-302.514) (-304.654) * (-303.819) [-303.941] (-304.670) (-309.428) -- 0:00:09
851000 -- (-304.284) (-302.564) (-305.956) [-303.322] * (-302.859) [-302.747] (-302.141) (-303.060) -- 0:00:09
851500 -- (-305.308) (-303.258) [-303.452] (-306.719) * (-306.707) (-305.052) (-305.321) [-304.658] -- 0:00:09
852000 -- [-304.897] (-305.454) (-303.177) (-306.145) * (-303.374) (-303.525) (-306.292) [-305.720] -- 0:00:09
852500 -- (-304.095) [-305.695] (-302.707) (-304.611) * (-304.175) (-309.762) (-304.253) [-305.206] -- 0:00:09
853000 -- [-304.203] (-302.359) (-304.328) (-308.455) * (-309.808) (-302.627) (-303.004) [-303.567] -- 0:00:09
853500 -- (-304.073) (-303.728) (-308.472) [-304.705] * (-304.384) [-305.734] (-309.727) (-304.483) -- 0:00:09
854000 -- (-306.019) (-302.640) (-307.112) [-304.198] * (-302.562) (-303.049) (-305.955) [-305.455] -- 0:00:09
854500 -- (-303.169) (-303.226) (-303.931) [-305.722] * (-305.520) [-304.623] (-304.822) (-303.498) -- 0:00:09
855000 -- (-303.094) (-303.931) [-303.493] (-303.460) * (-306.981) [-302.628] (-303.557) (-303.711) -- 0:00:08
Average standard deviation of split frequencies: 0.009913
855500 -- (-302.394) (-303.114) (-303.269) [-307.788] * (-304.570) (-306.450) (-304.575) [-304.058] -- 0:00:08
856000 -- (-302.543) [-304.483] (-306.037) (-305.974) * (-307.214) (-308.120) (-303.140) [-303.197] -- 0:00:08
856500 -- (-304.687) (-303.566) (-305.923) [-306.769] * (-305.457) (-306.273) (-304.272) [-302.601] -- 0:00:08
857000 -- (-303.739) [-304.199] (-303.450) (-304.335) * (-305.834) (-309.878) (-305.570) [-303.031] -- 0:00:08
857500 -- (-304.150) (-303.528) [-305.180] (-305.160) * (-302.349) (-306.522) (-310.302) [-302.521] -- 0:00:08
858000 -- (-304.447) (-302.905) [-304.236] (-306.818) * [-302.009] (-303.555) (-304.521) (-306.885) -- 0:00:08
858500 -- (-304.100) (-302.644) (-303.295) [-303.894] * (-303.840) [-303.682] (-303.599) (-304.329) -- 0:00:08
859000 -- (-307.210) (-303.229) (-307.154) [-304.513] * [-304.363] (-304.775) (-304.656) (-305.968) -- 0:00:08
859500 -- [-304.575] (-303.966) (-306.747) (-302.203) * [-308.747] (-303.471) (-306.113) (-303.124) -- 0:00:08
860000 -- [-304.526] (-302.736) (-305.096) (-303.208) * [-304.396] (-303.044) (-303.273) (-303.372) -- 0:00:08
Average standard deviation of split frequencies: 0.009688
860500 -- (-303.387) (-302.283) [-302.094] (-303.654) * (-303.019) (-303.245) (-303.812) [-303.431] -- 0:00:08
861000 -- [-302.913] (-302.024) (-304.076) (-304.548) * [-302.510] (-302.452) (-304.122) (-305.455) -- 0:00:08
861500 -- (-304.646) (-303.232) (-308.450) [-302.566] * (-303.127) (-302.435) [-303.070] (-305.388) -- 0:00:08
862000 -- (-302.860) (-303.888) [-302.551] (-302.976) * (-304.375) [-306.566] (-302.352) (-304.685) -- 0:00:08
862500 -- (-302.777) (-304.339) (-304.481) [-305.744] * [-304.173] (-304.256) (-304.477) (-302.517) -- 0:00:08
863000 -- (-303.289) [-306.974] (-306.149) (-307.914) * [-304.002] (-303.564) (-309.192) (-302.363) -- 0:00:08
863500 -- (-308.264) [-302.504] (-302.516) (-303.208) * (-302.807) [-304.291] (-308.265) (-303.738) -- 0:00:08
864000 -- (-303.623) (-305.229) [-306.300] (-309.541) * (-302.497) (-307.502) (-303.267) [-302.911] -- 0:00:08
864500 -- [-307.614] (-305.614) (-304.419) (-303.640) * [-303.039] (-306.627) (-303.249) (-303.843) -- 0:00:08
865000 -- [-305.414] (-304.043) (-303.345) (-305.729) * (-306.601) [-303.448] (-302.510) (-302.800) -- 0:00:08
Average standard deviation of split frequencies: 0.009730
865500 -- (-310.210) (-306.492) [-302.975] (-302.796) * (-311.289) [-303.273] (-302.630) (-302.776) -- 0:00:08
866000 -- (-307.379) (-307.266) (-302.196) [-303.242] * (-304.035) (-310.429) [-303.567] (-307.563) -- 0:00:08
866500 -- [-302.769] (-304.974) (-303.245) (-304.435) * [-304.734] (-303.305) (-305.793) (-302.132) -- 0:00:08
867000 -- [-308.842] (-304.711) (-304.836) (-303.875) * [-303.666] (-309.033) (-305.272) (-302.976) -- 0:00:08
867500 -- (-305.401) (-302.869) (-302.470) [-303.311] * (-304.813) (-308.353) (-304.303) [-303.903] -- 0:00:08
868000 -- [-307.517] (-305.144) (-302.846) (-304.216) * (-304.077) [-304.226] (-303.442) (-303.014) -- 0:00:08
868500 -- (-304.954) [-303.731] (-305.248) (-302.806) * (-303.725) (-303.161) (-303.317) [-303.748] -- 0:00:08
869000 -- [-303.824] (-307.208) (-306.147) (-302.119) * (-304.198) (-303.296) [-302.503] (-303.924) -- 0:00:07
869500 -- (-307.223) [-304.646] (-304.218) (-302.791) * (-303.765) [-305.469] (-304.478) (-307.018) -- 0:00:08
870000 -- (-305.150) [-303.633] (-309.184) (-302.774) * (-311.458) [-304.583] (-305.031) (-304.167) -- 0:00:08
Average standard deviation of split frequencies: 0.009610
870500 -- (-302.820) (-304.332) [-305.268] (-304.581) * (-303.577) (-304.063) [-303.831] (-306.509) -- 0:00:08
871000 -- (-304.149) [-302.932] (-307.213) (-305.849) * (-302.642) (-304.348) (-303.487) [-303.260] -- 0:00:07
871500 -- (-306.147) (-305.799) [-305.750] (-304.102) * (-302.298) [-304.896] (-304.435) (-302.400) -- 0:00:07
872000 -- [-303.820] (-305.202) (-304.207) (-305.002) * (-303.506) (-307.774) [-302.643] (-302.586) -- 0:00:07
872500 -- (-302.296) (-303.512) (-307.700) [-309.003] * (-303.713) (-305.762) (-304.962) [-304.798] -- 0:00:07
873000 -- [-303.428] (-304.440) (-307.163) (-307.795) * [-303.320] (-304.089) (-303.429) (-305.284) -- 0:00:07
873500 -- [-304.549] (-309.014) (-302.720) (-302.994) * (-303.131) (-302.747) (-303.032) [-304.568] -- 0:00:07
874000 -- (-307.812) (-302.388) (-303.354) [-302.012] * (-306.203) (-303.758) (-302.773) [-307.395] -- 0:00:07
874500 -- (-307.487) (-308.378) [-303.375] (-305.805) * [-306.414] (-303.418) (-311.479) (-304.204) -- 0:00:07
875000 -- (-303.537) (-304.038) (-303.020) [-303.593] * (-304.655) (-302.997) (-309.536) [-302.114] -- 0:00:07
Average standard deviation of split frequencies: 0.009787
875500 -- (-303.621) (-302.800) [-303.451] (-302.774) * (-307.760) (-304.863) [-308.104] (-305.391) -- 0:00:07
876000 -- (-302.897) [-303.626] (-305.362) (-304.731) * (-304.488) (-303.043) (-304.283) [-308.475] -- 0:00:07
876500 -- [-303.245] (-304.350) (-303.195) (-303.607) * (-304.869) [-302.901] (-303.536) (-303.896) -- 0:00:07
877000 -- (-302.378) (-306.265) (-303.994) [-303.469] * (-302.816) (-305.384) (-309.137) [-303.022] -- 0:00:07
877500 -- (-302.707) [-307.515] (-302.590) (-303.791) * (-305.725) (-303.459) [-305.703] (-303.598) -- 0:00:07
878000 -- [-303.660] (-303.348) (-305.935) (-304.069) * (-303.482) (-311.624) (-302.287) [-303.356] -- 0:00:07
878500 -- (-302.571) (-303.922) (-302.893) [-303.529] * (-304.576) (-304.159) (-303.543) [-304.365] -- 0:00:07
879000 -- (-302.686) [-303.074] (-302.895) (-304.456) * (-303.902) (-302.770) [-307.026] (-309.111) -- 0:00:07
879500 -- [-306.488] (-303.189) (-305.369) (-305.997) * [-304.288] (-306.166) (-304.179) (-306.070) -- 0:00:07
880000 -- (-306.794) (-307.073) (-305.221) [-303.543] * (-303.335) (-303.669) (-303.867) [-308.833] -- 0:00:07
Average standard deviation of split frequencies: 0.009501
880500 -- (-307.646) (-303.069) [-305.215] (-303.099) * (-302.995) (-304.380) [-304.179] (-304.838) -- 0:00:07
881000 -- (-304.347) (-306.930) (-304.144) [-303.289] * [-302.640] (-303.593) (-303.523) (-307.412) -- 0:00:07
881500 -- (-303.468) (-308.113) (-302.243) [-304.180] * (-303.682) [-303.259] (-303.755) (-305.275) -- 0:00:07
882000 -- [-304.371] (-304.280) (-303.841) (-307.261) * [-303.377] (-306.414) (-305.713) (-304.931) -- 0:00:07
882500 -- (-305.023) (-303.732) (-302.646) [-307.435] * [-302.147] (-306.539) (-304.273) (-305.901) -- 0:00:07
883000 -- (-302.796) (-302.722) [-302.283] (-302.639) * (-305.045) (-306.700) (-303.851) [-303.034] -- 0:00:07
883500 -- [-304.953] (-306.580) (-304.246) (-303.851) * (-302.377) (-309.265) (-303.987) [-303.238] -- 0:00:07
884000 -- (-306.617) (-305.236) [-303.954] (-304.991) * (-305.041) (-303.938) (-305.029) [-303.022] -- 0:00:07
884500 -- (-306.305) [-305.642] (-303.287) (-308.149) * (-311.037) [-306.108] (-304.395) (-302.865) -- 0:00:07
885000 -- [-303.916] (-302.449) (-305.616) (-303.633) * (-310.415) (-304.706) [-302.268] (-304.950) -- 0:00:07
Average standard deviation of split frequencies: 0.009211
885500 -- (-304.136) (-302.794) [-303.314] (-305.005) * (-306.152) [-303.902] (-303.739) (-306.964) -- 0:00:06
886000 -- (-302.959) [-305.437] (-305.129) (-302.869) * (-303.204) (-304.203) (-308.840) [-303.739] -- 0:00:06
886500 -- (-303.047) (-309.000) (-304.138) [-302.764] * (-304.086) [-303.076] (-304.423) (-303.377) -- 0:00:06
887000 -- (-305.273) (-304.135) [-303.310] (-310.671) * (-303.701) (-304.874) (-314.012) [-301.994] -- 0:00:07
887500 -- (-304.277) (-305.508) (-303.207) [-302.227] * (-303.452) [-302.744] (-307.318) (-301.792) -- 0:00:06
888000 -- (-302.684) (-303.266) [-304.904] (-303.856) * (-313.768) (-304.383) (-305.892) [-304.626] -- 0:00:06
888500 -- (-303.899) [-303.441] (-307.094) (-303.585) * (-311.938) [-304.457] (-304.833) (-303.036) -- 0:00:06
889000 -- (-310.680) (-303.858) [-304.568] (-306.373) * (-311.760) (-302.879) (-308.152) [-303.754] -- 0:00:06
889500 -- (-304.501) (-303.256) (-305.213) [-306.281] * (-307.442) (-303.290) (-303.179) [-302.711] -- 0:00:06
890000 -- [-305.185] (-305.742) (-302.648) (-302.255) * (-304.907) (-303.435) (-302.646) [-302.866] -- 0:00:06
Average standard deviation of split frequencies: 0.009725
890500 -- (-304.663) (-303.155) (-304.905) [-302.278] * (-308.340) (-302.591) (-304.362) [-303.746] -- 0:00:06
891000 -- (-308.751) (-304.130) (-306.479) [-303.247] * (-304.804) (-303.730) [-303.854] (-302.435) -- 0:00:06
891500 -- (-303.492) (-305.076) (-304.407) [-304.673] * (-303.849) (-302.864) (-304.318) [-304.026] -- 0:00:06
892000 -- (-304.070) (-310.111) [-303.695] (-305.944) * [-304.861] (-304.704) (-304.974) (-304.807) -- 0:00:06
892500 -- (-309.522) [-306.024] (-303.948) (-303.729) * (-302.544) (-302.343) [-302.428] (-305.468) -- 0:00:06
893000 -- (-307.540) (-307.294) (-308.313) [-303.161] * (-303.343) (-302.402) (-305.047) [-303.688] -- 0:00:06
893500 -- (-306.456) (-304.161) (-308.983) [-303.959] * [-303.859] (-303.362) (-304.193) (-303.389) -- 0:00:06
894000 -- (-307.109) (-307.169) (-304.896) [-303.127] * (-302.196) (-304.792) (-304.227) [-303.494] -- 0:00:06
894500 -- (-305.805) [-303.647] (-303.742) (-302.830) * [-307.340] (-304.092) (-304.180) (-303.471) -- 0:00:06
895000 -- (-303.989) [-305.069] (-305.234) (-303.006) * (-303.984) (-303.247) [-304.495] (-303.445) -- 0:00:06
Average standard deviation of split frequencies: 0.009014
895500 -- (-304.307) [-306.650] (-304.087) (-303.355) * (-304.126) [-303.538] (-304.192) (-303.820) -- 0:00:06
896000 -- (-304.989) [-306.176] (-303.381) (-303.356) * (-308.710) (-306.864) (-303.366) [-304.266] -- 0:00:06
896500 -- (-302.944) (-303.531) [-303.824] (-302.369) * (-309.450) (-303.698) [-303.274] (-303.240) -- 0:00:06
897000 -- (-305.365) (-304.245) (-304.582) [-302.870] * (-303.288) [-303.072] (-305.605) (-306.954) -- 0:00:06
897500 -- [-305.496] (-309.308) (-304.264) (-310.194) * (-302.665) [-302.474] (-305.017) (-304.021) -- 0:00:06
898000 -- [-304.337] (-303.657) (-305.091) (-306.433) * (-304.666) (-305.193) (-302.389) [-309.711] -- 0:00:06
898500 -- (-304.162) (-304.752) (-305.450) [-304.590] * (-304.553) (-303.754) [-302.608] (-303.539) -- 0:00:06
899000 -- [-302.931] (-303.717) (-304.153) (-302.956) * [-303.864] (-304.683) (-305.741) (-303.854) -- 0:00:06
899500 -- [-304.573] (-305.322) (-305.802) (-304.338) * [-302.542] (-304.546) (-304.529) (-305.044) -- 0:00:06
900000 -- (-305.285) (-304.923) (-303.776) [-303.594] * (-305.064) (-303.544) (-303.782) [-308.459] -- 0:00:06
Average standard deviation of split frequencies: 0.009072
900500 -- (-305.965) (-304.717) (-304.742) [-304.862] * (-306.700) [-303.429] (-304.962) (-306.765) -- 0:00:06
901000 -- (-305.709) (-304.325) [-302.671] (-305.895) * (-309.946) (-307.784) [-303.864] (-305.299) -- 0:00:06
901500 -- (-303.407) (-304.179) (-305.845) [-302.869] * (-303.555) [-306.455] (-304.924) (-303.343) -- 0:00:06
902000 -- [-302.636] (-304.305) (-305.740) (-306.008) * [-302.614] (-302.348) (-302.512) (-303.811) -- 0:00:05
902500 -- (-303.718) (-302.315) (-303.867) [-306.517] * [-303.236] (-306.712) (-303.751) (-305.216) -- 0:00:05
903000 -- [-304.603] (-306.131) (-304.066) (-307.493) * (-303.066) (-303.742) (-303.515) [-305.610] -- 0:00:05
903500 -- (-305.103) (-306.690) [-303.853] (-304.466) * (-303.004) (-302.386) (-303.908) [-305.495] -- 0:00:05
904000 -- [-302.773] (-304.576) (-303.367) (-302.814) * (-306.682) (-305.129) [-306.560] (-303.015) -- 0:00:05
904500 -- (-302.965) (-304.963) (-304.608) [-302.408] * (-304.084) (-303.876) [-303.579] (-303.198) -- 0:00:05
905000 -- (-303.601) (-303.495) (-304.182) [-303.622] * (-305.829) [-305.788] (-306.378) (-304.352) -- 0:00:05
Average standard deviation of split frequencies: 0.009088
905500 -- (-306.007) (-303.567) [-304.218] (-302.365) * [-304.048] (-302.658) (-305.699) (-309.127) -- 0:00:05
906000 -- [-304.797] (-305.329) (-303.042) (-306.714) * (-307.181) (-303.238) [-305.555] (-308.084) -- 0:00:05
906500 -- [-304.376] (-306.836) (-304.754) (-305.599) * [-302.032] (-303.691) (-303.015) (-303.241) -- 0:00:05
907000 -- (-304.864) (-302.726) [-302.435] (-302.275) * (-301.996) [-302.534] (-306.937) (-307.552) -- 0:00:05
907500 -- (-303.853) (-304.166) (-302.575) [-303.887] * (-302.306) [-304.026] (-302.816) (-304.414) -- 0:00:05
908000 -- [-303.549] (-303.983) (-303.027) (-308.127) * (-303.591) [-302.602] (-305.902) (-305.953) -- 0:00:05
908500 -- [-303.607] (-302.772) (-303.776) (-305.972) * (-304.812) [-302.528] (-303.602) (-303.310) -- 0:00:05
909000 -- (-303.076) (-304.656) (-302.797) [-303.747] * (-303.105) (-302.928) [-303.133] (-305.213) -- 0:00:05
909500 -- [-303.547] (-304.125) (-305.061) (-303.204) * (-303.123) (-303.146) [-303.406] (-304.120) -- 0:00:05
910000 -- (-303.762) [-304.300] (-302.299) (-305.079) * (-302.754) (-306.890) [-302.709] (-308.011) -- 0:00:05
Average standard deviation of split frequencies: 0.009283
910500 -- [-304.011] (-302.514) (-302.481) (-304.429) * (-302.195) (-307.292) (-305.698) [-303.130] -- 0:00:05
911000 -- (-305.318) (-304.483) (-306.661) [-302.059] * (-303.990) (-305.820) [-304.698] (-302.490) -- 0:00:05
911500 -- (-307.413) [-304.887] (-308.999) (-310.282) * [-302.536] (-303.757) (-305.055) (-302.738) -- 0:00:05
912000 -- (-304.820) [-303.592] (-304.417) (-306.169) * (-305.411) (-302.872) (-306.551) [-303.269] -- 0:00:05
912500 -- (-303.717) (-310.401) (-302.342) [-308.018] * [-306.853] (-307.937) (-305.143) (-303.109) -- 0:00:05
913000 -- [-304.506] (-304.659) (-304.833) (-303.707) * (-305.527) (-304.129) (-303.800) [-303.814] -- 0:00:05
913500 -- (-305.173) [-306.271] (-303.807) (-303.092) * [-305.294] (-304.854) (-301.907) (-303.396) -- 0:00:05
914000 -- (-303.460) (-307.428) (-303.660) [-302.561] * (-302.642) (-302.978) (-305.251) [-307.709] -- 0:00:05
914500 -- (-302.646) (-304.898) (-307.754) [-304.398] * (-303.089) (-303.794) (-303.695) [-305.141] -- 0:00:05
915000 -- (-305.611) (-312.464) (-303.924) [-304.213] * (-304.384) [-304.272] (-303.464) (-304.061) -- 0:00:05
Average standard deviation of split frequencies: 0.010068
915500 -- (-305.275) (-306.334) (-305.749) [-305.393] * (-304.796) (-303.521) [-302.822] (-303.651) -- 0:00:05
916000 -- (-305.494) [-308.930] (-304.412) (-304.291) * (-302.651) (-304.468) [-304.176] (-305.528) -- 0:00:05
916500 -- (-302.479) (-304.899) [-302.902] (-307.223) * (-304.001) (-308.263) (-302.824) [-303.284] -- 0:00:05
917000 -- (-303.034) (-307.960) [-302.811] (-304.064) * (-302.894) [-303.570] (-302.812) (-302.841) -- 0:00:05
917500 -- [-304.676] (-305.263) (-303.907) (-301.911) * (-304.348) [-306.344] (-310.857) (-306.308) -- 0:00:05
918000 -- (-307.346) (-304.190) (-308.446) [-303.935] * (-303.199) (-306.649) (-306.370) [-303.213] -- 0:00:05
918500 -- (-303.076) (-304.377) [-306.613] (-306.246) * [-303.452] (-306.050) (-304.629) (-303.819) -- 0:00:04
919000 -- (-304.385) [-303.218] (-307.160) (-307.594) * (-302.545) (-306.879) [-302.473] (-302.861) -- 0:00:04
919500 -- (-303.186) (-306.013) [-302.501] (-304.099) * (-304.805) [-307.377] (-303.706) (-302.826) -- 0:00:04
920000 -- (-303.134) (-304.235) (-308.357) [-303.377] * (-304.047) [-304.018] (-307.287) (-301.957) -- 0:00:04
Average standard deviation of split frequencies: 0.009856
920500 -- (-305.270) (-305.459) [-302.976] (-312.873) * (-305.080) [-302.406] (-309.379) (-304.644) -- 0:00:04
921000 -- (-303.498) [-303.286] (-303.464) (-308.927) * (-303.100) (-307.396) (-305.284) [-304.432] -- 0:00:04
921500 -- [-303.541] (-303.484) (-307.167) (-304.417) * (-306.220) (-302.596) (-309.715) [-304.324] -- 0:00:04
922000 -- (-302.986) [-303.525] (-308.054) (-306.103) * (-303.230) (-303.566) [-303.364] (-302.983) -- 0:00:04
922500 -- (-302.954) (-303.020) (-305.913) [-302.775] * [-305.348] (-306.514) (-303.522) (-307.762) -- 0:00:04
923000 -- [-302.080] (-302.994) (-305.649) (-304.794) * (-304.504) [-303.115] (-304.795) (-303.083) -- 0:00:04
923500 -- (-303.453) (-306.064) (-304.711) [-307.634] * (-304.470) [-305.355] (-304.207) (-303.655) -- 0:00:04
924000 -- (-304.219) (-310.826) (-305.760) [-303.895] * (-304.261) (-302.195) (-302.945) [-302.959] -- 0:00:04
924500 -- (-303.421) (-305.288) [-302.586] (-309.142) * [-301.870] (-303.395) (-302.515) (-303.188) -- 0:00:04
925000 -- (-305.399) (-303.626) [-305.183] (-303.680) * [-301.859] (-304.903) (-302.808) (-305.862) -- 0:00:04
Average standard deviation of split frequencies: 0.009641
925500 -- (-305.396) [-303.837] (-309.326) (-313.030) * (-304.075) [-303.373] (-303.593) (-303.318) -- 0:00:04
926000 -- [-303.871] (-308.432) (-307.043) (-310.499) * (-307.031) [-302.061] (-302.825) (-303.232) -- 0:00:04
926500 -- (-303.321) (-304.104) [-304.685] (-307.250) * (-302.911) [-303.035] (-302.305) (-303.042) -- 0:00:04
927000 -- (-307.359) [-304.463] (-302.282) (-304.962) * (-304.609) (-304.072) (-304.100) [-303.387] -- 0:00:04
927500 -- (-310.114) (-305.967) [-303.764] (-306.026) * (-302.733) (-305.457) [-303.538] (-302.398) -- 0:00:04
928000 -- [-303.963] (-305.354) (-304.765) (-305.267) * (-304.121) (-308.491) [-304.829] (-304.227) -- 0:00:04
928500 -- [-303.479] (-305.208) (-306.392) (-302.549) * (-305.955) (-305.461) (-303.699) [-304.104] -- 0:00:04
929000 -- (-302.565) [-302.816] (-311.302) (-304.642) * (-303.109) [-304.719] (-306.690) (-304.041) -- 0:00:04
929500 -- [-304.307] (-303.835) (-302.865) (-303.370) * (-304.296) [-303.739] (-314.282) (-302.587) -- 0:00:04
930000 -- [-303.865] (-302.986) (-302.392) (-307.101) * (-305.993) (-304.099) (-303.268) [-304.697] -- 0:00:04
Average standard deviation of split frequencies: 0.008003
930500 -- [-305.233] (-303.092) (-304.352) (-303.895) * (-303.523) [-303.054] (-304.388) (-305.786) -- 0:00:04
931000 -- (-304.863) [-302.980] (-304.019) (-305.027) * (-302.265) (-302.934) (-304.570) [-303.587] -- 0:00:04
931500 -- (-311.923) [-304.137] (-303.794) (-306.547) * (-303.176) (-302.989) (-304.511) [-304.270] -- 0:00:04
932000 -- (-304.373) (-302.431) [-304.291] (-302.399) * (-303.509) (-305.530) (-303.638) [-302.231] -- 0:00:04
932500 -- (-304.350) [-302.206] (-301.920) (-305.077) * (-304.710) (-303.603) (-302.537) [-303.348] -- 0:00:04
933000 -- (-305.213) (-305.275) (-302.681) [-304.284] * (-304.993) [-302.665] (-309.741) (-306.707) -- 0:00:04
933500 -- (-305.073) (-305.993) (-307.707) [-308.557] * (-302.552) [-309.469] (-307.555) (-302.429) -- 0:00:04
934000 -- (-303.933) (-306.535) (-306.246) [-302.489] * (-307.882) (-305.296) (-303.350) [-304.393] -- 0:00:04
934500 -- [-304.312] (-302.943) (-303.153) (-305.948) * (-312.296) (-305.493) (-305.315) [-303.684] -- 0:00:03
935000 -- (-305.325) (-304.480) [-308.187] (-306.510) * [-306.140] (-307.729) (-304.323) (-302.623) -- 0:00:03
Average standard deviation of split frequencies: 0.007924
935500 -- [-306.044] (-307.340) (-303.545) (-304.487) * (-304.999) (-306.403) [-304.111] (-307.996) -- 0:00:03
936000 -- (-304.164) (-305.468) [-304.917] (-303.278) * (-302.950) [-305.167] (-306.247) (-307.432) -- 0:00:03
936500 -- (-303.261) (-303.291) [-304.592] (-311.473) * (-302.445) (-305.517) [-302.704] (-305.337) -- 0:00:03
937000 -- (-302.611) [-303.201] (-303.717) (-304.071) * [-303.918] (-303.674) (-304.659) (-302.813) -- 0:00:03
937500 -- (-306.650) (-303.712) (-305.259) [-306.062] * (-303.360) (-304.485) (-305.963) [-304.381] -- 0:00:03
938000 -- (-302.750) [-303.327] (-303.998) (-303.420) * (-302.786) [-302.741] (-303.922) (-304.326) -- 0:00:03
938500 -- (-303.013) (-307.794) [-304.964] (-305.971) * (-303.286) (-305.149) (-305.193) [-303.589] -- 0:00:03
939000 -- (-303.851) [-302.280] (-303.473) (-302.855) * (-304.621) (-303.276) (-302.839) [-304.085] -- 0:00:03
939500 -- [-306.908] (-303.193) (-303.203) (-303.318) * (-304.717) (-303.033) [-303.223] (-303.459) -- 0:00:03
940000 -- (-306.286) (-305.253) [-306.581] (-303.013) * [-303.766] (-306.267) (-303.206) (-303.134) -- 0:00:03
Average standard deviation of split frequencies: 0.008252
940500 -- [-306.323] (-305.698) (-304.159) (-303.527) * (-303.497) (-308.537) (-303.498) [-305.309] -- 0:00:03
941000 -- (-304.187) (-303.931) (-304.043) [-307.188] * (-306.466) [-306.033] (-303.393) (-306.175) -- 0:00:03
941500 -- [-304.187] (-306.140) (-308.350) (-303.352) * (-305.891) (-305.314) (-302.645) [-304.306] -- 0:00:03
942000 -- [-302.341] (-308.147) (-308.138) (-303.405) * (-302.605) (-304.437) (-306.426) [-304.549] -- 0:00:03
942500 -- (-303.248) (-304.835) [-304.103] (-307.067) * (-303.161) [-305.472] (-305.420) (-308.741) -- 0:00:03
943000 -- (-302.918) [-307.084] (-303.244) (-304.789) * (-305.749) [-305.732] (-303.895) (-303.094) -- 0:00:03
943500 -- (-304.382) [-303.921] (-306.154) (-306.435) * [-303.140] (-306.510) (-303.602) (-302.387) -- 0:00:03
944000 -- (-304.793) [-305.518] (-305.830) (-303.469) * (-304.891) (-304.932) [-304.279] (-305.952) -- 0:00:03
944500 -- (-304.082) [-302.274] (-302.431) (-303.165) * (-303.761) [-305.438] (-305.531) (-303.719) -- 0:00:03
945000 -- [-304.338] (-303.463) (-303.012) (-302.906) * (-304.077) (-304.110) [-305.211] (-305.024) -- 0:00:03
Average standard deviation of split frequencies: 0.008239
945500 -- (-304.018) (-302.684) (-303.859) [-302.573] * (-303.492) (-305.217) [-304.269] (-305.238) -- 0:00:03
946000 -- (-310.114) [-303.512] (-306.639) (-305.681) * (-304.002) (-303.461) [-303.627] (-308.376) -- 0:00:03
946500 -- (-306.080) [-302.705] (-304.298) (-309.655) * (-304.811) (-305.143) (-304.835) [-302.487] -- 0:00:03
947000 -- (-304.262) (-303.082) (-306.669) [-305.680] * (-305.279) (-305.499) [-303.962] (-302.773) -- 0:00:03
947500 -- [-302.069] (-306.807) (-303.365) (-305.269) * (-304.635) (-308.463) (-302.168) [-303.382] -- 0:00:03
948000 -- (-303.490) (-304.675) [-303.507] (-305.577) * [-302.068] (-303.062) (-303.117) (-304.345) -- 0:00:03
948500 -- (-302.673) (-308.497) (-302.550) [-303.923] * (-303.715) (-304.211) [-304.490] (-304.567) -- 0:00:03
949000 -- (-305.704) [-306.689] (-303.518) (-303.537) * (-303.668) (-307.082) [-302.518] (-307.005) -- 0:00:03
949500 -- (-303.142) [-303.986] (-307.825) (-304.176) * (-303.938) (-306.700) (-307.149) [-302.482] -- 0:00:03
950000 -- (-303.401) [-304.826] (-304.705) (-302.532) * (-305.687) [-303.736] (-307.128) (-304.790) -- 0:00:03
Average standard deviation of split frequencies: 0.008231
950500 -- (-306.028) (-302.928) (-305.434) [-302.502] * [-302.955] (-305.062) (-311.998) (-302.883) -- 0:00:03
951000 -- (-303.743) [-306.227] (-302.871) (-303.228) * (-312.732) (-301.941) (-306.540) [-302.733] -- 0:00:02
951500 -- (-305.804) (-305.699) (-304.924) [-305.236] * (-308.666) (-303.028) (-303.958) [-302.404] -- 0:00:02
952000 -- (-304.676) (-308.489) [-305.046] (-303.363) * [-304.098] (-302.915) (-302.573) (-305.497) -- 0:00:02
952500 -- (-304.752) [-303.177] (-302.044) (-303.003) * [-302.586] (-302.954) (-305.035) (-304.879) -- 0:00:02
953000 -- (-302.897) (-303.139) (-305.143) [-302.547] * (-309.244) [-303.849] (-307.685) (-304.680) -- 0:00:02
953500 -- (-302.060) (-302.520) (-306.623) [-306.102] * (-302.172) [-303.746] (-308.065) (-307.612) -- 0:00:02
954000 -- (-302.291) (-304.800) [-302.698] (-305.455) * (-303.923) (-303.271) (-305.929) [-304.650] -- 0:00:02
954500 -- (-304.133) (-306.829) (-303.170) [-303.958] * (-307.831) [-305.158] (-303.278) (-309.094) -- 0:00:02
955000 -- (-307.628) (-303.268) (-304.772) [-301.938] * [-305.381] (-303.927) (-306.903) (-304.476) -- 0:00:02
Average standard deviation of split frequencies: 0.008218
955500 -- (-303.877) (-303.533) (-305.556) [-306.658] * [-306.815] (-304.634) (-305.243) (-304.647) -- 0:00:02
956000 -- [-304.626] (-306.565) (-306.095) (-307.811) * (-305.714) [-303.315] (-305.091) (-305.333) -- 0:00:02
956500 -- (-303.193) (-304.573) [-303.868] (-305.467) * (-306.954) (-303.776) (-305.631) [-306.289] -- 0:00:02
957000 -- [-304.991] (-303.713) (-303.638) (-304.613) * [-303.334] (-307.128) (-307.462) (-306.853) -- 0:00:02
957500 -- (-304.392) (-307.037) [-302.310] (-302.395) * [-302.449] (-304.552) (-307.171) (-306.683) -- 0:00:02
958000 -- (-303.297) (-303.631) (-303.570) [-302.570] * [-304.071] (-303.011) (-304.879) (-302.810) -- 0:00:02
958500 -- (-304.976) (-303.785) [-302.772] (-305.681) * (-308.854) (-305.087) [-302.996] (-303.439) -- 0:00:02
959000 -- (-303.593) (-303.342) (-302.381) [-303.353] * (-304.099) (-302.677) (-302.320) [-304.677] -- 0:00:02
959500 -- (-306.454) (-303.441) [-303.174] (-305.049) * (-307.862) [-303.566] (-303.647) (-304.691) -- 0:00:02
960000 -- (-303.316) (-302.869) (-307.752) [-302.863] * (-303.071) [-308.132] (-304.136) (-302.126) -- 0:00:02
Average standard deviation of split frequencies: 0.008113
960500 -- [-304.047] (-303.587) (-306.332) (-308.265) * [-303.884] (-302.885) (-304.481) (-302.126) -- 0:00:02
961000 -- [-302.373] (-305.233) (-305.846) (-304.768) * (-304.554) [-303.122] (-303.926) (-303.306) -- 0:00:02
961500 -- [-303.341] (-305.620) (-307.007) (-302.745) * (-304.958) [-304.282] (-305.393) (-303.115) -- 0:00:02
962000 -- (-305.753) (-302.886) [-302.956] (-302.835) * [-302.841] (-307.343) (-302.568) (-302.652) -- 0:00:02
962500 -- (-306.877) (-303.178) (-304.870) [-302.403] * (-302.849) [-302.625] (-303.967) (-303.818) -- 0:00:02
963000 -- (-304.070) (-305.294) [-303.254] (-302.775) * (-303.627) (-304.596) (-303.926) [-302.908] -- 0:00:02
963500 -- (-302.431) (-308.360) (-303.706) [-303.815] * (-303.512) (-304.807) [-303.672] (-309.315) -- 0:00:02
964000 -- (-302.235) [-304.294] (-304.573) (-303.128) * (-305.027) [-303.667] (-304.214) (-306.601) -- 0:00:02
964500 -- (-306.050) (-302.720) (-306.329) [-303.692] * (-304.669) [-303.727] (-306.673) (-304.904) -- 0:00:02
965000 -- [-304.358] (-302.303) (-306.002) (-305.500) * [-302.885] (-308.156) (-305.089) (-305.783) -- 0:00:02
Average standard deviation of split frequencies: 0.008198
965500 -- (-304.046) [-303.262] (-305.821) (-304.504) * (-302.717) (-304.798) (-302.895) [-303.727] -- 0:00:02
966000 -- (-303.169) [-306.531] (-304.658) (-307.410) * [-303.358] (-304.197) (-308.647) (-307.305) -- 0:00:02
966500 -- (-305.200) [-305.176] (-306.898) (-306.775) * (-307.473) (-305.920) (-305.638) [-303.907] -- 0:00:02
967000 -- (-304.923) [-303.263] (-303.433) (-303.248) * (-303.241) (-303.878) (-304.635) [-302.366] -- 0:00:02
967500 -- (-304.097) (-304.962) (-304.061) [-302.598] * [-303.901] (-305.504) (-304.414) (-304.184) -- 0:00:01
968000 -- [-305.917] (-303.442) (-304.257) (-302.071) * (-305.212) (-302.491) (-302.214) [-305.377] -- 0:00:01
968500 -- (-307.048) [-302.683] (-307.696) (-302.691) * (-302.005) (-303.161) [-303.999] (-306.075) -- 0:00:01
969000 -- [-302.432] (-305.760) (-311.656) (-302.727) * (-306.341) (-302.456) [-304.296] (-304.220) -- 0:00:01
969500 -- [-307.926] (-308.869) (-307.703) (-304.224) * [-302.805] (-302.439) (-302.488) (-303.546) -- 0:00:01
970000 -- (-303.988) [-303.126] (-306.741) (-302.127) * (-306.901) [-304.960] (-303.420) (-303.127) -- 0:00:01
Average standard deviation of split frequencies: 0.008580
970500 -- [-305.012] (-308.720) (-302.806) (-302.336) * [-304.704] (-303.529) (-307.212) (-315.239) -- 0:00:01
971000 -- (-303.784) [-302.931] (-305.527) (-303.304) * (-307.741) (-305.517) [-305.169] (-305.110) -- 0:00:01
971500 -- (-303.548) [-302.690] (-305.019) (-304.356) * (-307.625) [-304.541] (-302.977) (-306.875) -- 0:00:01
972000 -- (-302.709) (-304.938) (-303.594) [-302.759] * (-303.475) [-302.952] (-303.967) (-306.418) -- 0:00:01
972500 -- (-303.090) [-303.111] (-305.722) (-302.767) * (-304.932) (-302.589) [-304.144] (-303.204) -- 0:00:01
973000 -- (-305.028) [-304.944] (-304.859) (-303.489) * [-305.257] (-304.600) (-302.396) (-302.805) -- 0:00:01
973500 -- (-305.004) [-303.777] (-304.377) (-304.567) * (-304.327) (-302.422) [-305.863] (-302.853) -- 0:00:01
974000 -- (-304.250) (-307.493) [-307.362] (-303.664) * (-302.846) (-302.535) (-303.942) [-302.223] -- 0:00:01
974500 -- (-306.368) (-303.729) (-307.209) [-303.881] * [-302.854] (-302.934) (-303.043) (-302.118) -- 0:00:01
975000 -- (-305.040) (-303.290) (-303.147) [-307.389] * [-304.899] (-302.499) (-304.337) (-301.804) -- 0:00:01
Average standard deviation of split frequencies: 0.008694
975500 -- (-304.875) [-304.943] (-304.307) (-304.083) * (-303.847) [-302.879] (-305.694) (-303.566) -- 0:00:01
976000 -- (-303.894) (-305.221) (-304.128) [-305.036] * [-305.743] (-303.016) (-305.734) (-303.743) -- 0:00:01
976500 -- [-305.551] (-303.357) (-304.469) (-303.865) * (-303.537) (-302.675) (-306.396) [-304.895] -- 0:00:01
977000 -- (-304.050) [-303.740] (-304.990) (-304.716) * (-305.111) (-304.663) (-303.057) [-302.819] -- 0:00:01
977500 -- [-303.054] (-302.894) (-302.914) (-304.899) * (-304.738) [-303.432] (-303.973) (-304.985) -- 0:00:01
978000 -- (-304.221) [-303.225] (-310.121) (-303.564) * (-303.300) [-304.449] (-305.006) (-303.271) -- 0:00:01
978500 -- (-302.396) (-304.726) [-303.207] (-303.906) * (-303.598) (-305.098) (-302.897) [-302.799] -- 0:00:01
979000 -- (-305.187) (-304.827) (-305.173) [-302.296] * (-312.372) (-303.703) (-303.463) [-305.233] -- 0:00:01
979500 -- (-306.734) [-302.120] (-303.414) (-302.797) * (-312.296) [-302.678] (-305.425) (-304.310) -- 0:00:01
980000 -- (-305.531) (-304.279) [-302.722] (-305.650) * (-313.074) (-304.335) [-304.752] (-303.931) -- 0:00:01
Average standard deviation of split frequencies: 0.008685
980500 -- (-302.798) [-305.570] (-302.594) (-306.047) * (-309.354) (-303.950) [-305.030] (-303.250) -- 0:00:01
981000 -- (-302.787) [-303.946] (-302.729) (-304.526) * (-306.628) (-303.264) [-306.395] (-303.218) -- 0:00:01
981500 -- (-304.632) (-309.479) (-307.568) [-304.811] * (-304.565) [-302.109] (-304.848) (-303.139) -- 0:00:01
982000 -- (-305.143) (-304.115) [-303.713] (-307.222) * [-303.849] (-303.211) (-305.625) (-303.398) -- 0:00:01
982500 -- (-305.296) [-302.877] (-303.694) (-305.598) * (-304.454) (-302.689) [-306.867] (-302.541) -- 0:00:01
983000 -- [-303.418] (-303.049) (-302.304) (-303.487) * (-303.396) [-302.446] (-303.318) (-305.146) -- 0:00:01
983500 -- (-303.728) [-303.073] (-307.760) (-305.267) * (-302.862) [-305.011] (-305.247) (-304.668) -- 0:00:01
984000 -- [-304.076] (-303.979) (-303.825) (-307.054) * (-304.790) [-305.602] (-304.179) (-303.170) -- 0:00:00
984500 -- (-305.454) [-302.287] (-306.700) (-306.112) * (-307.257) (-303.124) (-302.291) [-303.335] -- 0:00:00
985000 -- (-305.655) (-307.030) [-303.014] (-304.250) * [-305.018] (-302.179) (-304.124) (-303.649) -- 0:00:00
Average standard deviation of split frequencies: 0.008510
985500 -- (-303.035) (-305.424) (-303.081) [-304.404] * (-305.759) (-306.188) (-305.788) [-303.098] -- 0:00:00
986000 -- [-303.779] (-303.969) (-305.474) (-303.715) * (-305.529) [-305.459] (-304.341) (-302.693) -- 0:00:00
986500 -- (-302.321) (-306.039) (-307.046) [-303.699] * (-305.092) [-303.802] (-303.142) (-305.076) -- 0:00:00
987000 -- (-303.411) [-303.568] (-302.369) (-302.765) * (-305.783) (-303.266) (-303.717) [-307.227] -- 0:00:00
987500 -- (-302.700) (-304.941) [-303.699] (-306.066) * [-306.506] (-305.083) (-304.342) (-307.683) -- 0:00:00
988000 -- (-303.938) (-302.669) [-304.489] (-302.391) * (-302.448) (-307.463) (-303.567) [-305.346] -- 0:00:00
988500 -- (-308.161) [-306.953] (-305.547) (-303.425) * (-302.124) [-303.744] (-303.536) (-304.197) -- 0:00:00
989000 -- [-304.530] (-306.235) (-304.254) (-302.388) * (-303.685) [-303.665] (-307.505) (-306.460) -- 0:00:00
989500 -- (-303.801) (-302.537) [-307.586] (-302.158) * (-307.069) [-305.156] (-302.842) (-304.518) -- 0:00:00
990000 -- (-303.750) (-303.852) (-304.454) [-304.858] * [-305.198] (-302.989) (-303.531) (-306.417) -- 0:00:00
Average standard deviation of split frequencies: 0.008787
990500 -- (-302.781) (-304.192) [-304.462] (-304.122) * [-305.796] (-302.404) (-305.054) (-302.303) -- 0:00:00
991000 -- (-305.297) (-303.138) (-305.537) [-306.956] * [-304.857] (-304.243) (-308.323) (-303.704) -- 0:00:00
991500 -- (-303.822) [-303.657] (-306.747) (-309.379) * (-302.417) (-304.584) (-302.543) [-303.935] -- 0:00:00
992000 -- [-304.374] (-308.178) (-306.704) (-304.738) * [-304.639] (-302.797) (-302.474) (-310.604) -- 0:00:00
992500 -- (-303.532) [-303.161] (-302.534) (-302.916) * (-309.369) [-303.885] (-308.113) (-307.353) -- 0:00:00
993000 -- (-304.538) [-302.711] (-303.624) (-303.493) * (-309.337) [-303.250] (-304.780) (-310.823) -- 0:00:00
993500 -- (-305.170) (-301.893) [-303.153] (-304.797) * (-304.773) (-304.006) [-302.937] (-307.551) -- 0:00:00
994000 -- (-304.653) [-305.411] (-307.202) (-306.248) * (-303.344) (-305.789) [-303.780] (-302.476) -- 0:00:00
994500 -- (-307.804) (-302.500) [-303.745] (-303.703) * (-304.111) [-309.208] (-302.086) (-304.508) -- 0:00:00
995000 -- (-306.379) [-302.706] (-308.471) (-302.589) * (-303.098) [-310.046] (-302.812) (-302.753) -- 0:00:00
Average standard deviation of split frequencies: 0.008330
995500 -- (-305.409) (-304.708) (-304.934) [-302.354] * [-307.382] (-308.528) (-307.524) (-303.205) -- 0:00:00
996000 -- (-306.409) (-303.495) (-304.815) [-304.223] * (-302.968) (-304.146) [-302.521] (-303.895) -- 0:00:00
996500 -- (-305.222) (-302.980) (-302.886) [-303.368] * (-304.071) (-302.662) [-303.482] (-302.656) -- 0:00:00
997000 -- (-305.019) [-309.336] (-305.675) (-303.320) * (-306.836) [-303.301] (-304.401) (-304.164) -- 0:00:00
997500 -- [-303.515] (-303.971) (-302.177) (-302.812) * (-304.348) (-304.264) [-304.405] (-303.585) -- 0:00:00
998000 -- [-304.552] (-306.808) (-302.299) (-304.121) * [-306.932] (-304.026) (-305.083) (-305.671) -- 0:00:00
998500 -- (-305.765) [-306.122] (-303.049) (-311.370) * (-304.102) (-304.293) [-302.641] (-305.760) -- 0:00:00
999000 -- [-304.132] (-304.336) (-303.373) (-305.437) * (-302.126) (-307.391) [-305.233] (-307.295) -- 0:00:00
999500 -- (-302.608) [-304.084] (-305.554) (-302.644) * [-302.167] (-307.400) (-303.206) (-306.053) -- 0:00:00
1000000 -- (-304.508) (-303.509) [-307.136] (-303.106) * [-302.889] (-309.690) (-304.593) (-303.112) -- 0:00:00
Average standard deviation of split frequencies: 0.008166
Analysis completed in 1 mins 1 seconds
Analysis used 59.71 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -301.78
Likelihood of best state for "cold" chain of run 2 was -301.78
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
45.2 % ( 28 %) Dirichlet(Pi{all})
43.2 % ( 26 %) Slider(Pi{all})
78.8 % ( 45 %) Multiplier(Alpha{1,2})
78.0 % ( 57 %) Multiplier(Alpha{3})
26.9 % ( 22 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 95 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.4 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
45.5 % ( 36 %) Dirichlet(Pi{all})
43.2 % ( 23 %) Slider(Pi{all})
78.8 % ( 55 %) Multiplier(Alpha{1,2})
77.5 % ( 58 %) Multiplier(Alpha{3})
27.6 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 19 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.3 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166879 0.82 0.67
3 | 166435 166802 0.84
4 | 166712 166429 166743
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 166618 0.82 0.67
3 | 167116 166035 0.84
4 | 166843 166838 166550
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -303.39
| 1 |
| 2 1 |
| 1 2 1 |
| 2 21 1 1 12 12 121 |
| 1 2 2 1121 1 2 2 |
|2 1 21 1 1 22 2 2 2 2 221 |
| 22 1 1 11 121 1 2 * |
| * 2 2* 2 2 22 1 1 * |
| * 12 2 21211 1 1 2 |
| 1 1 2 2 1 2 2 1 1 |
| 1 2 2 *2 1 2 1|
|1 1 1 2 2 1 1 2 1 2|
| 2 2 1 22 1 1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -305.20
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -303.52 -306.08
2 -303.50 -307.06
--------------------------------------
TOTAL -303.51 -306.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890491 0.089379 0.357834 1.450558 0.861597 1501.00 1501.00 1.000
r(A<->C){all} 0.175594 0.021595 0.000028 0.468498 0.136179 256.06 278.35 1.004
r(A<->G){all} 0.167800 0.020565 0.000022 0.466997 0.128678 260.89 333.21 1.000
r(A<->T){all} 0.177869 0.021833 0.000016 0.464189 0.141986 108.65 162.27 1.000
r(C<->G){all} 0.155976 0.017933 0.000047 0.419823 0.119620 98.19 190.19 1.001
r(C<->T){all} 0.156044 0.018969 0.000049 0.444687 0.119999 302.67 355.49 1.001
r(G<->T){all} 0.166718 0.020690 0.000021 0.457738 0.125185 219.04 253.73 1.005
pi(A){all} 0.228060 0.000752 0.173844 0.281068 0.226669 1288.55 1317.50 1.001
pi(C){all} 0.242829 0.000795 0.190293 0.298981 0.242005 1308.65 1328.65 1.000
pi(G){all} 0.305093 0.000935 0.244333 0.362181 0.304650 1272.00 1334.79 1.001
pi(T){all} 0.224018 0.000789 0.164568 0.276338 0.223365 1273.73 1292.29 1.000
alpha{1,2} 0.412990 0.234887 0.000172 1.402079 0.242913 989.60 1245.30 1.000
alpha{3} 0.442468 0.237230 0.000166 1.417934 0.278182 1277.69 1316.37 1.000
pinvar{all} 0.992151 0.000092 0.973930 0.999999 0.995274 1191.55 1203.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ..*.*.
9 -- .**.**
10 -- ..*..*
11 -- ..****
12 -- ...*.*
13 -- ..**..
14 -- ....**
15 -- .*...*
16 -- .***.*
17 -- ...**.
18 -- .****.
19 -- .*..*.
20 -- .*.*..
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 479 0.159560 0.015546 0.148568 0.170553 2
8 470 0.156562 0.009422 0.149900 0.163225 2
9 470 0.156562 0.016959 0.144570 0.168554 2
10 447 0.148901 0.006124 0.144570 0.153231 2
11 438 0.145903 0.002827 0.143904 0.147901 2
12 436 0.145237 0.008480 0.139241 0.151233 2
13 431 0.143571 0.005182 0.139907 0.147235 2
14 426 0.141905 0.004711 0.138574 0.145237 2
15 421 0.140240 0.001413 0.139241 0.141239 2
16 413 0.137575 0.006124 0.133245 0.141905 2
17 405 0.134910 0.008009 0.129247 0.140573 2
18 403 0.134244 0.001413 0.133245 0.135243 2
19 402 0.133911 0.023555 0.117255 0.150566 2
20 394 0.131246 0.006595 0.126582 0.135909 2
21 387 0.128914 0.006124 0.124584 0.133245 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096494 0.009165 0.000002 0.287698 0.067382 1.000 2
length{all}[2] 0.099409 0.009907 0.000025 0.298912 0.068075 1.000 2
length{all}[3] 0.096309 0.009738 0.000012 0.298616 0.065894 1.000 2
length{all}[4] 0.097356 0.009472 0.000048 0.295789 0.067004 1.000 2
length{all}[5] 0.099983 0.009586 0.000055 0.294621 0.073092 1.000 2
length{all}[6] 0.102247 0.010037 0.000019 0.297270 0.072528 1.002 2
length{all}[7] 0.096464 0.010607 0.000006 0.299141 0.060321 1.000 2
length{all}[8] 0.101333 0.009517 0.000204 0.292884 0.074543 0.998 2
length{all}[9] 0.098592 0.009957 0.000240 0.303142 0.066139 0.998 2
length{all}[10] 0.103355 0.011538 0.000099 0.304756 0.068526 0.998 2
length{all}[11] 0.099770 0.008797 0.000029 0.286760 0.073893 0.998 2
length{all}[12] 0.094220 0.008375 0.000094 0.292233 0.068319 1.005 2
length{all}[13] 0.102122 0.009425 0.000115 0.283935 0.075958 0.999 2
length{all}[14] 0.096342 0.008855 0.000264 0.278685 0.068038 0.998 2
length{all}[15] 0.092036 0.007595 0.000742 0.264057 0.065503 0.999 2
length{all}[16] 0.109679 0.011634 0.000522 0.334055 0.078869 1.001 2
length{all}[17] 0.094581 0.008631 0.000163 0.289704 0.061301 0.998 2
length{all}[18] 0.106384 0.011548 0.000048 0.366811 0.073042 1.001 2
length{all}[19] 0.091327 0.007335 0.000149 0.257152 0.067582 0.998 2
length{all}[20] 0.092539 0.007860 0.000772 0.273771 0.067579 1.022 2
length{all}[21] 0.104231 0.008223 0.000002 0.278934 0.078223 1.008 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008166
Maximum standard deviation of split frequencies = 0.023555
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.022
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 219
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 37 patterns at 73 / 73 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 37 patterns at 73 / 73 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
36112 bytes for conP
3256 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.047956 0.018178 0.070423 0.081006 0.093713 0.081939 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -314.758727
Iterating by ming2
Initial: fx= 314.758727
x= 0.04796 0.01818 0.07042 0.08101 0.09371 0.08194 0.30000 1.30000
1 h-m-p 0.0000 0.0003 174.5881 +++ 307.042595 m 0.0003 14 | 1/8
2 h-m-p 0.0015 0.0118 27.1715 -----------.. | 1/8
3 h-m-p 0.0000 0.0004 159.6347 +++ 296.401542 m 0.0004 46 | 2/8
4 h-m-p 0.0028 0.0162 20.8866 ------------.. | 2/8
5 h-m-p 0.0000 0.0003 143.4023 +++ 289.899521 m 0.0003 79 | 3/8
6 h-m-p 0.0026 0.0252 15.0486 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 124.6296 ++ 287.584175 m 0.0001 111 | 4/8
8 h-m-p 0.0014 0.0403 10.8050 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 101.9198 ++ 287.447746 m 0.0000 142 | 5/8
10 h-m-p 0.0001 0.0641 7.2627 ----------.. | 5/8
11 h-m-p 0.0000 0.0002 72.0004 +++ 286.585743 m 0.0002 173 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 286.585743 m 8.0000 184 | 6/8
13 h-m-p 0.3334 8.0000 0.0000 --Y 286.585743 0 0.0098 199 | 6/8
14 h-m-p 0.0160 8.0000 0.0003 +++++ 286.585743 m 8.0000 215 | 6/8
15 h-m-p 0.0365 8.0000 0.0650 ------Y 286.585743 0 0.0000 234 | 6/8
16 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585743 m 8.0000 274 | 6/8
18 h-m-p 0.0012 0.5901 0.6012 +++++ 286.585739 m 0.5901 290 | 7/8
19 h-m-p 0.0232 8.0000 8.0986 -------------.. | 7/8
20 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585739 m 8.0000 328 | 7/8
21 h-m-p 0.0217 8.0000 0.0022 +++++ 286.585739 m 8.0000 343 | 7/8
22 h-m-p 0.0274 8.0000 0.6571 ----------Y 286.585739 0 0.0000 365 | 7/8
23 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585739 m 8.0000 380 | 7/8
24 h-m-p 0.0160 8.0000 5.8086 -----------C 286.585739 0 0.0000 403 | 7/8
25 h-m-p 0.0489 8.0000 0.0000 -----C 286.585739 0 0.0000 419 | 7/8
26 h-m-p 0.0508 8.0000 0.0000 ------N 286.585739 0 0.0000 437
Out..
lnL = -286.585739
438 lfun, 438 eigenQcodon, 2628 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039324 0.018049 0.018218 0.035235 0.088996 0.060439 0.000100 0.859824 0.443380
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.953040
np = 9
lnL0 = -304.926326
Iterating by ming2
Initial: fx= 304.926326
x= 0.03932 0.01805 0.01822 0.03524 0.08900 0.06044 0.00011 0.85982 0.44338
1 h-m-p 0.0000 0.0000 170.3929 ++ 304.361197 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0008 111.3974 +++ 297.234470 m 0.0008 27 | 2/9
3 h-m-p 0.0000 0.0000 77.0074 ++ 297.184209 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0009 121.4095 ++++ 291.607418 m 0.0009 53 | 4/9
5 h-m-p 0.0000 0.0000 990.9254 ++ 290.704796 m 0.0000 65 | 5/9
6 h-m-p 0.0000 0.0003 399.3701 ++ 287.886933 m 0.0003 77 | 6/9
7 h-m-p 0.0000 0.0000 3392.9393 ++ 286.585723 m 0.0000 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 286.585723 m 8.0000 101 | 7/9
9 h-m-p 0.0160 8.0000 0.0438 --------Y 286.585723 0 0.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0003 +++++ 286.585722 m 8.0000 140 | 7/9
11 h-m-p 0.0156 6.8495 0.1570 ----------Y 286.585722 0 0.0000 164 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585722 m 8.0000 181 | 7/9
13 h-m-p 0.0084 4.1909 0.2046 ---------C 286.585722 0 0.0000 204 | 7/9
14 h-m-p 0.0160 8.0000 0.0002 +++++ 286.585722 m 8.0000 221 | 7/9
15 h-m-p 0.0088 3.7843 0.2259 -----------N 286.585722 0 0.0000 246 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585722 m 8.0000 263 | 7/9
17 h-m-p 0.0134 6.6970 0.1520 ----------Y 286.585722 0 0.0000 287 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585722 m 8.0000 304 | 7/9
19 h-m-p 0.0147 7.3312 0.1492 -----------Y 286.585722 0 0.0000 329 | 7/9
20 h-m-p 0.0160 8.0000 0.0001 -------Y 286.585722 0 0.0000 350 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
22 h-m-p 0.0160 8.0000 0.0001 +++++ 286.585722 m 8.0000 392 | 7/9
23 h-m-p 0.0158 7.8819 0.1486 ----------N 286.585722 0 0.0000 416 | 7/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585722 m 8.0000 433 | 7/9
25 h-m-p 0.0112 5.6175 0.1635 ---------C 286.585722 0 0.0000 456 | 7/9
26 h-m-p 0.0160 8.0000 0.0002 +++++ 286.585722 m 8.0000 473 | 7/9
27 h-m-p 0.0067 2.0937 0.2907 --------Y 286.585722 0 0.0000 495 | 7/9
28 h-m-p 0.0160 8.0000 0.0007 ---------N 286.585722 0 0.0000 518 | 7/9
29 h-m-p 0.0160 8.0000 0.0003 -------C 286.585722 0 0.0000 539
Out..
lnL = -286.585722
540 lfun, 1620 eigenQcodon, 6480 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089728 0.051707 0.090214 0.103972 0.056342 0.032550 0.000100 1.783656 0.175911 0.191498 1.151302
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 16.023476
np = 11
lnL0 = -314.152851
Iterating by ming2
Initial: fx= 314.152851
x= 0.08973 0.05171 0.09021 0.10397 0.05634 0.03255 0.00011 1.78366 0.17591 0.19150 1.15130
1 h-m-p 0.0000 0.0000 146.0448 ++ 314.069112 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 218.0105 +++ 301.670841 m 0.0005 31 | 2/11
3 h-m-p 0.0001 0.0004 110.8468 ++ 296.243200 m 0.0004 45 | 3/11
4 h-m-p 0.0002 0.0009 29.4315 ++ 294.891109 m 0.0009 59 | 4/11
5 h-m-p 0.0000 0.0002 369.6267 ++ 290.389546 m 0.0002 73 | 5/11
6 h-m-p 0.0038 0.0192 4.7660 ------------.. | 5/11
7 h-m-p 0.0000 0.0002 115.3265 +++ 287.779207 m 0.0002 112 | 6/11
8 h-m-p 0.0160 8.0000 1.6573 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 98.6779 ++ 287.701399 m 0.0000 151 | 7/11
10 h-m-p 0.0160 8.0000 0.9284 -------------.. | 7/11
11 h-m-p 0.0000 0.0002 69.5538 +++ 286.585725 m 0.0002 195 | 8/11
12 h-m-p 0.4990 8.0000 0.0000 +++ 286.585725 m 8.0000 210 | 8/11
13 h-m-p 0.0024 1.2175 0.1223 +++++ 286.585725 m 1.2175 230 | 9/11
14 h-m-p 0.0160 8.0000 2.2694 +++++ 286.585696 m 8.0000 250 | 9/11
15 h-m-p 1.6000 8.0000 0.0155 -----N 286.585696 0 0.0004 269 | 9/11
16 h-m-p 1.6000 8.0000 0.0000 N 286.585696 0 1.6000 285 | 8/11
17 h-m-p 0.0055 2.7564 30.8940 +++++ 286.585696 m 2.7564 304 | 8/11
18 h-m-p 0.0000 0.0000 0.8527
h-m-p: 0.00000000e+00 0.00000000e+00 8.52657916e-01 286.585696
.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585696 m 8.0000 335 | 8/11
20 h-m-p 0.0160 8.0000 0.1430 +++++ 286.585689 m 8.0000 355 | 8/11
21 h-m-p 1.6000 8.0000 0.3632 ++ 286.585686 m 8.0000 372 | 8/11
22 h-m-p 1.6000 8.0000 0.6827 ++ 286.585684 m 8.0000 389 | 8/11
23 h-m-p 1.6000 8.0000 1.6857 ++ 286.585684 m 8.0000 406 | 8/11
24 h-m-p 1.6000 8.0000 3.4843 ++ 286.585683 m 8.0000 420 | 8/11
25 h-m-p 0.5440 8.0000 51.2406 ++ 286.585683 m 8.0000 434 | 8/11
26 h-m-p 1.6000 8.0000 36.0006 ----------------.. | 8/11
27 h-m-p 0.0160 8.0000 0.0000 ----Y 286.585683 0 0.0000 480 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 --N 286.585683 0 0.0003 499
Out..
lnL = -286.585683
500 lfun, 2000 eigenQcodon, 9000 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -286.594690 S = -286.585864 -0.003376
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 37 patterns 0:05
did 20 / 37 patterns 0:05
did 30 / 37 patterns 0:05
did 37 / 37 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017133 0.080954 0.106462 0.052174 0.045017 0.081194 460.795656 1.151155 1.329480
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.061222
np = 9
lnL0 = -313.103662
Iterating by ming2
Initial: fx= 313.103662
x= 0.01713 0.08095 0.10646 0.05217 0.04502 0.08119 460.79566 1.15116 1.32948
1 h-m-p 0.0000 0.0002 164.3822 +++ 306.320126 m 0.0002 15 | 1/9
2 h-m-p 0.0027 0.0866 13.9260 ------------.. | 1/9
3 h-m-p 0.0000 0.0004 152.0237 +++ 296.768579 m 0.0004 50 | 2/9
4 h-m-p 0.0056 0.1259 9.8623 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 139.2777 ++ 294.750154 m 0.0001 84 | 3/9
6 h-m-p 0.0018 0.1880 6.9104 ------------.. | 3/9
7 h-m-p 0.0000 0.0004 120.7697 +++ 288.508307 m 0.0004 119 | 4/9
8 h-m-p 0.0088 0.2944 4.7332 -------------.. | 4/9
9 h-m-p 0.0000 0.0000 100.8055 ++ 288.472722 m 0.0000 154 | 5/9
10 h-m-p 0.0011 0.5322 2.9114 -----------.. | 5/9
11 h-m-p 0.0000 0.0004 70.7690 +++ 286.585739 m 0.0004 188 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 286.585739 m 8.0000 200 | 6/9
13 h-m-p 0.1783 8.0000 0.0001 +++ 286.585739 m 8.0000 216 | 6/9
14 h-m-p 0.0160 8.0000 0.3607 +++++ 286.585738 m 8.0000 234 | 6/9
15 h-m-p 1.6000 8.0000 0.4995 ++ 286.585737 m 8.0000 249 | 6/9
16 h-m-p 1.6000 8.0000 1.6096 ++ 286.585737 m 8.0000 264 | 6/9
17 h-m-p 1.1589 5.7945 3.6958 ----------------.. | 6/9
18 h-m-p 0.0160 8.0000 0.0000 C 286.585737 0 0.0160 302 | 6/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585737 m 8.0000 320 | 6/9
20 h-m-p 0.0160 8.0000 0.6252 +++++ 286.585729 m 8.0000 338 | 6/9
21 h-m-p 0.1714 0.9047 29.1876 ---------------.. | 6/9
22 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585729 m 8.0000 381 | 6/9
23 h-m-p 0.0160 8.0000 0.0017 ------C 286.585729 0 0.0000 402 | 6/9
24 h-m-p 0.0160 8.0000 0.0000 ------C 286.585729 0 0.0000 423 | 6/9
25 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585729 m 8.0000 441 | 6/9
26 h-m-p 0.0160 8.0000 2.0654 ----------Y 286.585729 0 0.0000 466 | 6/9
27 h-m-p 0.0160 8.0000 0.0000 Y 286.585729 0 0.0040 478 | 6/9
28 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585729 m 8.0000 496 | 6/9
29 h-m-p 0.0160 8.0000 0.0708 --------C 286.585729 0 0.0000 519 | 6/9
30 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585729 m 8.0000 537 | 6/9
31 h-m-p 0.0160 8.0000 2.8513 -----------Y 286.585729 0 0.0000 563 | 6/9
32 h-m-p 0.0160 8.0000 0.0000 ---Y 286.585729 0 0.0001 578 | 6/9
33 h-m-p 0.0160 8.0000 0.0000 --------Y 286.585729 0 0.0000 601
Out..
lnL = -286.585729
602 lfun, 6622 eigenQcodon, 36120 P(t)
Time used: 0:14
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098082 0.046617 0.109065 0.043479 0.078288 0.064596 460.835110 0.900000 0.903695 1.505334 1.091371
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.062389
np = 11
lnL0 = -316.563075
Iterating by ming2
Initial: fx= 316.563075
x= 0.09808 0.04662 0.10907 0.04348 0.07829 0.06460 460.83511 0.90000 0.90369 1.50533 1.09137
1 h-m-p 0.0000 0.0007 158.8272 ++++ 299.440873 m 0.0007 18 | 1/11
2 h-m-p 0.0019 0.0097 22.6959 ++ 296.938048 m 0.0097 32 | 2/11
3 h-m-p 0.0003 0.0015 180.5747 ++ 287.231427 m 0.0015 46 | 3/11
4 h-m-p 0.0000 0.0002 16.9702 ++ 287.215328 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0001 55.8016 ++ 286.999530 m 0.0001 74 | 5/11
6 h-m-p 0.0001 0.0011 25.2145 ++ 286.585746 m 0.0011 88 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 286.585746 m 8.0000 102 | 6/11
8 h-m-p 0.0076 3.8012 0.2274 ----------C 286.585746 0 0.0000 131 | 6/11
9 h-m-p 0.0160 8.0000 0.0027 +++++ 286.585745 m 8.0000 153 | 6/11
10 h-m-p 0.0388 1.4357 0.5622 -----------Y 286.585745 0 0.0000 183 | 6/11
11 h-m-p 0.0160 8.0000 0.0008 +++++ 286.585744 m 8.0000 205 | 6/11
12 h-m-p 0.0125 1.4418 0.5184 -----------C 286.585744 0 0.0000 235 | 6/11
13 h-m-p 0.0160 8.0000 0.0000 -------Y 286.585744 0 0.0000 261 | 6/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585744 m 8.0000 283 | 6/11
15 h-m-p 0.0026 1.3208 0.8657 ------------.. | 6/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 286.585744 m 8.0000 334 | 6/11
17 h-m-p 0.0028 1.4065 0.5383 ----------Y 286.585744 0 0.0000 363 | 6/11
18 h-m-p 0.0160 8.0000 0.0011 +++++ 286.585744 m 8.0000 385 | 6/11
19 h-m-p 0.0165 1.5735 0.5367 -----------C 286.585744 0 0.0000 415 | 6/11
20 h-m-p 0.0160 8.0000 0.0002 +++++ 286.585744 m 8.0000 437 | 6/11
21 h-m-p 0.0016 0.8207 1.5091 -----------.. | 6/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 286.585744 m 8.0000 482 | 6/11
23 h-m-p 0.0004 0.2181 3.5136 -----------.. | 6/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 286.585744 m 8.0000 527 | 6/11
25 h-m-p 0.0098 4.8862 0.1568 ---------Y 286.585744 0 0.0000 555 | 6/11
26 h-m-p 0.0160 8.0000 0.0008 +++++ 286.585743 m 8.0000 577 | 6/11
27 h-m-p 0.0115 1.5662 0.5761 ------------N 286.585743 0 0.0000 608 | 6/11
28 h-m-p 0.0160 8.0000 0.0007 +++++ 286.585743 m 8.0000 630 | 6/11
29 h-m-p 0.0107 1.7485 0.5300 ---------Y 286.585743 0 0.0000 658 | 6/11
30 h-m-p 0.0160 8.0000 0.0006 -------------.. | 6/11
31 h-m-p 0.0160 8.0000 0.0001 +++++ 286.585743 m 8.0000 710 | 6/11
32 h-m-p 0.0030 1.5060 0.5154 -----------Y 286.585743 0 0.0000 740 | 6/11
33 h-m-p 0.0160 8.0000 0.0011 +++++ 286.585743 m 8.0000 762 | 6/11
34 h-m-p 0.0186 1.6208 0.4715 -------------.. | 6/11
35 h-m-p 0.0160 8.0000 0.0001 +++++ 286.585743 m 8.0000 814 | 6/11
36 h-m-p 0.0031 1.5522 0.5057 -----------Y 286.585743 0 0.0000 844 | 6/11
37 h-m-p 0.0160 8.0000 0.0002 +++++ 286.585742 m 8.0000 866 | 6/11
38 h-m-p 0.0031 1.2160 0.6281 ------------.. | 6/11
39 h-m-p 0.0160 8.0000 0.0001 +++++ 286.585742 m 8.0000 917 | 6/11
40 h-m-p 0.0031 1.5458 0.5092 ----------C 286.585742 0 0.0000 946 | 6/11
41 h-m-p 0.0160 8.0000 0.0028 +++++ 286.585741 m 8.0000 968 | 6/11
42 h-m-p 0.0382 1.4493 0.5833 -----------C 286.585741 0 0.0000 998 | 6/11
43 h-m-p 0.0160 8.0000 0.0036 +++++ 286.585739 m 8.0000 1020 | 6/11
44 h-m-p 0.0464 1.3861 0.6138 -----------C 286.585739 0 0.0000 1050 | 6/11
45 h-m-p 0.0160 8.0000 0.0002 +++++ 286.585739 m 8.0000 1072 | 6/11
46 h-m-p 0.0030 1.5064 0.5805 ----------N 286.585739 0 0.0000 1101 | 6/11
47 h-m-p 0.0160 8.0000 0.0122 +++++ 286.585732 m 8.0000 1123 | 6/11
48 h-m-p 0.1570 1.5791 0.6213 -------------N 286.585732 0 0.0000 1155 | 6/11
49 h-m-p 0.0160 8.0000 0.0012 +++++ 286.585731 m 8.0000 1177 | 6/11
50 h-m-p 0.0149 1.5758 0.6632 ----------Y 286.585731 0 0.0000 1206 | 6/11
51 h-m-p 0.0160 8.0000 0.0003 +++++ 286.585731 m 8.0000 1228 | 6/11
52 h-m-p 0.0037 1.5710 0.6616 ----------Y 286.585731 0 0.0000 1257 | 6/11
53 h-m-p 0.0160 8.0000 0.0000 ---N 286.585731 0 0.0001 1279 | 6/11
54 h-m-p 0.0160 8.0000 0.0003 +++++ 286.585731 m 8.0000 1301 | 6/11
55 h-m-p 0.0045 2.2673 1.2247 ---------N 286.585731 0 0.0000 1329 | 6/11
56 h-m-p 0.0160 8.0000 0.0000 +++++ 286.585731 m 8.0000 1346 | 6/11
57 h-m-p 0.0018 0.8911 0.1528 +++++ 286.585722 m 0.8911 1368 | 7/11
58 h-m-p 0.2748 5.4550 0.2749 ++
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
+ 286.585683 m 5.4550 1388
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60790) = 9.677605e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60763) = 9.678795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
| 8/11
59 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.60782) = 9.677945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60778) = 9.678136e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60777) = 9.678184e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678196e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
C 286.585683 0 0.0063 1409
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 1.001606e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60790) = 9.677604e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60763) = 9.678794e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
| 8/11
60 h-m-p 0.1774 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
N 286.585683 0 0.0000 1433
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
Out..
lnL = -286.585683
1434 lfun, 17208 eigenQcodon, 94644 P(t)
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -286.597383 S = -286.585864 -0.005055
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 37 patterns 0:38
did 20 / 37 patterns 0:38
did 30 / 37 patterns 0:39
did 37 / 37 patterns 0:39
QuantileBeta(0.15, 0.00500, 2.60776) = 9.678199e-161 2000 rounds
Time used: 0:39
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=73
NC_011896_1_WP_003418601_1_2094_MLBR_RS09945 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
NC_002677_1_NP_302327_1_1199_infA MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
**************************************************
NC_011896_1_WP_003418601_1_2094_MLBR_RS09945 EDRVVVELSPYDLSRGRIVYRYK
NC_002677_1_NP_302327_1_1199_infA EDRVVVELSPYDLSRGRIVYRYK
NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455 EDRVVVELSPYDLSRGRIVYRYK
NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765 EDRVVVELSPYDLSRGRIVYRYK
NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775 EDRVVVELSPYDLSRGRIVYRYK
NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070 EDRVVVELSPYDLSRGRIVYRYK
***********************
>NC_011896_1_WP_003418601_1_2094_MLBR_RS09945 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG CATTGTGTACCGATACAAG >NC_002677_1_NP_302327_1_1199_infA ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG CATTGTGTACCGATACAAG >NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG CATTGTGTACCGATACAAG >NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG CATTGTGTACCGATACAAG >NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG CATTGTGTACCGATACAAG >NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG CATTGTGTACCGATACAAG
>NC_011896_1_WP_003418601_1_2094_MLBR_RS09945 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP EDRVVVELSPYDLSRGRIVYRYK >NC_002677_1_NP_302327_1_1199_infA MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP EDRVVVELSPYDLSRGRIVYRYK >NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP EDRVVVELSPYDLSRGRIVYRYK >NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP EDRVVVELSPYDLSRGRIVYRYK >NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP EDRVVVELSPYDLSRGRIVYRYK >NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP EDRVVVELSPYDLSRGRIVYRYK
#NEXUS
[ID: 0787225561]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_003418601_1_2094_MLBR_RS09945
NC_002677_1_NP_302327_1_1199_infA
NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455
NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765
NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775
NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070
;
end;
begin trees;
translate
1 NC_011896_1_WP_003418601_1_2094_MLBR_RS09945,
2 NC_002677_1_NP_302327_1_1199_infA,
3 NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455,
4 NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765,
5 NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775,
6 NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0673817,2:0.06807514,3:0.06589397,4:0.06700399,5:0.0730916,6:0.07252847);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0673817,2:0.06807514,3:0.06589397,4:0.06700399,5:0.0730916,6:0.07252847);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -303.52 -306.08
2 -303.50 -307.06
--------------------------------------
TOTAL -303.51 -306.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890491 0.089379 0.357834 1.450558 0.861597 1501.00 1501.00 1.000
r(A<->C){all} 0.175594 0.021595 0.000028 0.468498 0.136179 256.06 278.35 1.004
r(A<->G){all} 0.167800 0.020565 0.000022 0.466997 0.128678 260.89 333.21 1.000
r(A<->T){all} 0.177869 0.021833 0.000016 0.464189 0.141986 108.65 162.27 1.000
r(C<->G){all} 0.155976 0.017933 0.000047 0.419823 0.119620 98.19 190.19 1.001
r(C<->T){all} 0.156044 0.018969 0.000049 0.444687 0.119999 302.67 355.49 1.001
r(G<->T){all} 0.166718 0.020690 0.000021 0.457738 0.125185 219.04 253.73 1.005
pi(A){all} 0.228060 0.000752 0.173844 0.281068 0.226669 1288.55 1317.50 1.001
pi(C){all} 0.242829 0.000795 0.190293 0.298981 0.242005 1308.65 1328.65 1.000
pi(G){all} 0.305093 0.000935 0.244333 0.362181 0.304650 1272.00 1334.79 1.001
pi(T){all} 0.224018 0.000789 0.164568 0.276338 0.223365 1273.73 1292.29 1.000
alpha{1,2} 0.412990 0.234887 0.000172 1.402079 0.242913 989.60 1245.30 1.000
alpha{3} 0.442468 0.237230 0.000166 1.417934 0.278182 1277.69 1316.37 1.000
pinvar{all} 0.992151 0.000092 0.973930 0.999999 0.995274 1191.55 1203.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/infA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 73
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 0 0 0 0 0 0 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 1 1 1 | Asp GAT 2 2 2 2 2 2 | Gly GGT 4 4 4 4 4 4
GTC 3 3 3 3 3 3 | GCC 2 2 2 2 2 2 | GAC 1 1 1 1 1 1 | GGC 0 0 0 0 0 0
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 5 5 5 5 5 5 | GCG 1 1 1 1 1 1 | GAG 5 5 5 5 5 5 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_003418601_1_2094_MLBR_RS09945
position 1: T:0.12329 C:0.27397 A:0.23288 G:0.36986
position 2: T:0.32877 C:0.13699 A:0.34247 G:0.19178
position 3: T:0.21918 C:0.31507 A:0.10959 G:0.35616
Average T:0.22374 C:0.24201 A:0.22831 G:0.30594
#2: NC_002677_1_NP_302327_1_1199_infA
position 1: T:0.12329 C:0.27397 A:0.23288 G:0.36986
position 2: T:0.32877 C:0.13699 A:0.34247 G:0.19178
position 3: T:0.21918 C:0.31507 A:0.10959 G:0.35616
Average T:0.22374 C:0.24201 A:0.22831 G:0.30594
#3: NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455
position 1: T:0.12329 C:0.27397 A:0.23288 G:0.36986
position 2: T:0.32877 C:0.13699 A:0.34247 G:0.19178
position 3: T:0.21918 C:0.31507 A:0.10959 G:0.35616
Average T:0.22374 C:0.24201 A:0.22831 G:0.30594
#4: NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765
position 1: T:0.12329 C:0.27397 A:0.23288 G:0.36986
position 2: T:0.32877 C:0.13699 A:0.34247 G:0.19178
position 3: T:0.21918 C:0.31507 A:0.10959 G:0.35616
Average T:0.22374 C:0.24201 A:0.22831 G:0.30594
#5: NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775
position 1: T:0.12329 C:0.27397 A:0.23288 G:0.36986
position 2: T:0.32877 C:0.13699 A:0.34247 G:0.19178
position 3: T:0.21918 C:0.31507 A:0.10959 G:0.35616
Average T:0.22374 C:0.24201 A:0.22831 G:0.30594
#6: NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070
position 1: T:0.12329 C:0.27397 A:0.23288 G:0.36986
position 2: T:0.32877 C:0.13699 A:0.34247 G:0.19178
position 3: T:0.21918 C:0.31507 A:0.10959 G:0.35616
Average T:0.22374 C:0.24201 A:0.22831 G:0.30594
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 0 | TCC 6 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 6
CTC 6 | CCC 12 | CAC 12 | CGC 18
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 6
CTG 18 | CCG 0 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 18 | ACC 0 | AAC 6 | AGC 6
ATA 6 | ACA 0 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 18 | ACG 0 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 6 | Asp D GAT 12 | Gly G GGT 24
GTC 18 | GCC 12 | GAC 6 | GGC 0
GTA 0 | GCA 0 | Glu E GAA 12 | GGA 6
GTG 30 | GCG 6 | GAG 30 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12329 C:0.27397 A:0.23288 G:0.36986
position 2: T:0.32877 C:0.13699 A:0.34247 G:0.19178
position 3: T:0.21918 C:0.31507 A:0.10959 G:0.35616
Average T:0.22374 C:0.24201 A:0.22831 G:0.30594
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -286.585739 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.091371
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003418601_1_2094_MLBR_RS09945: 0.000004, NC_002677_1_NP_302327_1_1199_infA: 0.000004, NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455: 0.000004, NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765: 0.000004, NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775: 0.000004, NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.09137
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 182.0 37.0 1.0914 0.0000 0.0000 0.0 0.0
7..2 0.000 182.0 37.0 1.0914 0.0000 0.0000 0.0 0.0
7..3 0.000 182.0 37.0 1.0914 0.0000 0.0000 0.0 0.0
7..4 0.000 182.0 37.0 1.0914 0.0000 0.0000 0.0 0.0
7..5 0.000 182.0 37.0 1.0914 0.0000 0.0000 0.0 0.0
7..6 0.000 182.0 37.0 1.0914 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -286.585722 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.858015 0.082980
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003418601_1_2094_MLBR_RS09945: 0.000004, NC_002677_1_NP_302327_1_1199_infA: 0.000004, NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455: 0.000004, NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765: 0.000004, NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775: 0.000004, NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.85802 0.14198
w: 0.08298 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 182.0 37.0 0.2132 0.0000 0.0000 0.0 0.0
7..2 0.000 182.0 37.0 0.2132 0.0000 0.0000 0.0 0.0
7..3 0.000 182.0 37.0 0.2132 0.0000 0.0000 0.0 0.0
7..4 0.000 182.0 37.0 0.2132 0.0000 0.0000 0.0 0.0
7..5 0.000 182.0 37.0 0.2132 0.0000 0.0000 0.0 0.0
7..6 0.000 182.0 37.0 0.2132 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -286.585683 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 460.795656 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003418601_1_2094_MLBR_RS09945: 0.000004, NC_002677_1_NP_302327_1_1199_infA: 0.000004, NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455: 0.000004, NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765: 0.000004, NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775: 0.000004, NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 460.79566
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_003418601_1_2094_MLBR_RS09945)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -286.585729 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 460.835110 10.006044 21.143422
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003418601_1_2094_MLBR_RS09945: 0.000004, NC_002677_1_NP_302327_1_1199_infA: 0.000004, NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455: 0.000004, NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765: 0.000004, NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775: 0.000004, NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 460.83511
Parameters in M7 (beta):
p = 10.00604 q = 21.14342
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.19244 0.23522 0.26269 0.28561 0.30686 0.32798 0.35029 0.37564 0.40797 0.46327
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 146.5 72.5 0.3208 0.0000 0.0000 0.0 0.0
7..2 0.000 146.5 72.5 0.3208 0.0000 0.0000 0.0 0.0
7..3 0.000 146.5 72.5 0.3208 0.0000 0.0000 0.0 0.0
7..4 0.000 146.5 72.5 0.3208 0.0000 0.0000 0.0 0.0
7..5 0.000 146.5 72.5 0.3208 0.0000 0.0000 0.0 0.0
7..6 0.000 146.5 72.5 0.3208 0.0000 0.0000 0.0 0.0
Time used: 0:14
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -286.585683 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 461.740659 0.999990 0.005000 2.607764 1.084869
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_003418601_1_2094_MLBR_RS09945: 0.000004, NC_002677_1_NP_302327_1_1199_infA: 0.000004, NZ_LVXE01000050_1_WP_003418601_1_2119_A3216_RS11455: 0.000004, NZ_LYPH01000079_1_WP_003418601_1_2652_A8144_RS12765: 0.000004, NZ_CP029543_1_WP_003418601_1_2116_DIJ64_RS10775: 0.000004, NZ_AP014567_1_WP_003418601_1_2175_JK2ML_RS11070: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 461.74066
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.60776
(p1 = 0.00001) w = 1.08487
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.08487
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 146.5 72.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_003418601_1_2094_MLBR_RS09945)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:39
Model 1: NearlyNeutral -286.585722 Model 2: PositiveSelection -286.585683 Model 0: one-ratio -286.585739 Model 7: beta -286.585729 Model 8: beta&w>1 -286.585683 Model 0 vs 1 3.400000002784509E-5 Model 2 vs 1 7.799999991675577E-5 Model 8 vs 7 9.1999999995096E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
