--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:19:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/infA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -303.52 -306.08
2 -303.50 -307.06
--------------------------------------
TOTAL -303.51 -306.69
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890491 0.089379 0.357834 1.450558 0.861597 1501.00 1501.00 1.000
r(A<->C){all} 0.175594 0.021595 0.000028 0.468498 0.136179 256.06 278.35 1.004
r(A<->G){all} 0.167800 0.020565 0.000022 0.466997 0.128678 260.89 333.21 1.000
r(A<->T){all} 0.177869 0.021833 0.000016 0.464189 0.141986 108.65 162.27 1.000
r(C<->G){all} 0.155976 0.017933 0.000047 0.419823 0.119620 98.19 190.19 1.001
r(C<->T){all} 0.156044 0.018969 0.000049 0.444687 0.119999 302.67 355.49 1.001
r(G<->T){all} 0.166718 0.020690 0.000021 0.457738 0.125185 219.04 253.73 1.005
pi(A){all} 0.228060 0.000752 0.173844 0.281068 0.226669 1288.55 1317.50 1.001
pi(C){all} 0.242829 0.000795 0.190293 0.298981 0.242005 1308.65 1328.65 1.000
pi(G){all} 0.305093 0.000935 0.244333 0.362181 0.304650 1272.00 1334.79 1.001
pi(T){all} 0.224018 0.000789 0.164568 0.276338 0.223365 1273.73 1292.29 1.000
alpha{1,2} 0.412990 0.234887 0.000172 1.402079 0.242913 989.60 1245.30 1.000
alpha{3} 0.442468 0.237230 0.000166 1.417934 0.278182 1277.69 1316.37 1.000
pinvar{all} 0.992151 0.000092 0.973930 0.999999 0.995274 1191.55 1203.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -286.585722
Model 2: PositiveSelection -286.585683
Model 0: one-ratio -286.585739
Model 7: beta -286.585729
Model 8: beta&w>1 -286.585683
Model 0 vs 1 3.400000002784509E-5
Model 2 vs 1 7.799999991675577E-5
Model 8 vs 7 9.1999999995096E-5
>C1
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C2
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C3
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C4
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C5
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C6
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=73
C1 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C2 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C3 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C4 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C5 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C6 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
**************************************************
C1 EDRVVVELSPYDLSRGRIVYRYK
C2 EDRVVVELSPYDLSRGRIVYRYK
C3 EDRVVVELSPYDLSRGRIVYRYK
C4 EDRVVVELSPYDLSRGRIVYRYK
C5 EDRVVVELSPYDLSRGRIVYRYK
C6 EDRVVVELSPYDLSRGRIVYRYK
***********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 73 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 73 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2190]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2190]--->[2190]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.446 Mb, Max= 30.592 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C2 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C3 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C4 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C5 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
C6 MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
**************************************************
C1 EDRVVVELSPYDLSRGRIVYRYK
C2 EDRVVVELSPYDLSRGRIVYRYK
C3 EDRVVVELSPYDLSRGRIVYRYK
C4 EDRVVVELSPYDLSRGRIVYRYK
C5 EDRVVVELSPYDLSRGRIVYRYK
C6 EDRVVVELSPYDLSRGRIVYRYK
***********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C2 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C3 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C4 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C5 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
C6 ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
**************************************************
C1 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C2 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C3 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C4 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C5 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
C6 TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
**************************************************
C1 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C2 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C3 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C4 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C5 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
C6 TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
**************************************************
C1 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C2 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C3 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C4 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C5 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
C6 GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
**************************************************
C1 CATTGTGTACCGATACAAG
C2 CATTGTGTACCGATACAAG
C3 CATTGTGTACCGATACAAG
C4 CATTGTGTACCGATACAAG
C5 CATTGTGTACCGATACAAG
C6 CATTGTGTACCGATACAAG
*******************
>C1
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C2
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C3
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C4
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C5
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C6
ATGGCCAAAAAGGATGGTGCTATCGAGGTCGAAGGTCGTGTGGTCGAACC
TCTGCCCAATGCGATGTTTCGCATTGAGCTGGAGAACGGTCACAAGGTCC
TCGCCCACATCAGCGGTAAAATGCGGCAGCATTACATCCGCATACTGCCT
GAGGACCGGGTGGTGGTGGAGTTGTCACCCTATGATTTGTCCCGGGGACG
CATTGTGTACCGATACAAG
>C1
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C2
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C3
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C4
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C5
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
>C6
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 219 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792664
Setting output file names to "/data/2res/infA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1479376292
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0787225561
Seed = 1162261910
Swapseed = 1579792664
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -490.132470 -- -24.965149
Chain 2 -- -490.132498 -- -24.965149
Chain 3 -- -490.132498 -- -24.965149
Chain 4 -- -490.132470 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -490.132470 -- -24.965149
Chain 2 -- -490.132498 -- -24.965149
Chain 3 -- -490.132498 -- -24.965149
Chain 4 -- -490.132498 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-490.132] (-490.132) (-490.132) (-490.132) * [-490.132] (-490.132) (-490.132) (-490.132)
500 -- (-316.602) [-312.519] (-309.508) (-311.948) * [-309.763] (-311.354) (-319.247) (-310.692) -- 0:00:00
1000 -- (-313.267) (-314.624) [-310.829] (-315.566) * (-313.426) [-307.856] (-308.238) (-307.870) -- 0:00:00
1500 -- (-313.548) (-310.610) [-313.388] (-314.162) * (-315.723) [-317.301] (-315.710) (-311.994) -- 0:00:00
2000 -- [-310.653] (-313.025) (-311.606) (-325.476) * (-310.494) [-312.309] (-314.953) (-311.591) -- 0:00:00
2500 -- (-318.491) (-311.813) (-318.571) [-309.601] * (-310.477) (-315.008) [-318.017] (-325.077) -- 0:00:00
3000 -- (-318.592) [-314.325] (-322.228) (-308.779) * (-312.267) (-313.040) (-314.535) [-310.263] -- 0:00:00
3500 -- (-312.945) [-314.159] (-310.345) (-319.843) * (-315.762) (-314.242) [-312.387] (-310.094) -- 0:00:00
4000 -- (-314.000) [-315.327] (-317.580) (-310.416) * (-311.434) (-312.248) [-319.935] (-320.862) -- 0:00:00
4500 -- (-307.370) [-311.682] (-313.292) (-308.476) * [-309.638] (-319.718) (-312.295) (-314.274) -- 0:00:00
5000 -- (-317.195) [-315.869] (-315.694) (-313.298) * (-317.854) [-312.958] (-315.391) (-315.507) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- [-316.233] (-313.135) (-314.722) (-318.986) * (-310.926) [-317.504] (-308.857) (-323.128) -- 0:00:00
6000 -- (-315.412) [-310.646] (-312.936) (-315.530) * [-318.090] (-307.507) (-309.232) (-321.987) -- 0:00:00
6500 -- (-324.620) [-311.333] (-308.432) (-321.525) * (-310.636) (-309.010) (-313.265) [-311.444] -- 0:00:00
7000 -- (-315.687) (-312.307) (-321.984) [-311.289] * [-313.149] (-317.383) (-313.532) (-317.675) -- 0:02:21
7500 -- [-312.195] (-307.583) (-317.839) (-315.857) * [-312.933] (-318.603) (-312.710) (-315.168) -- 0:02:12
8000 -- [-317.615] (-313.013) (-330.280) (-314.854) * (-322.819) (-320.944) (-313.070) [-309.678] -- 0:02:04
8500 -- (-318.383) [-312.453] (-315.418) (-314.325) * [-309.350] (-313.403) (-316.314) (-318.052) -- 0:01:56
9000 -- (-315.906) [-322.027] (-320.881) (-316.396) * (-309.585) (-312.294) [-309.664] (-320.431) -- 0:01:50
9500 -- (-318.064) (-315.466) (-337.483) [-309.006] * (-311.015) [-315.397] (-310.323) (-326.113) -- 0:01:44
10000 -- [-314.348] (-316.702) (-329.561) (-310.887) * [-315.157] (-319.688) (-313.079) (-327.767) -- 0:01:39
Average standard deviation of split frequencies: 0.061872
10500 -- [-311.945] (-312.435) (-326.535) (-310.565) * (-321.214) (-314.310) [-317.754] (-305.512) -- 0:01:34
11000 -- [-302.928] (-329.509) (-312.999) (-312.481) * (-312.500) (-311.513) (-313.573) [-303.320] -- 0:01:29
11500 -- (-305.359) (-315.360) (-310.373) [-312.670] * (-309.086) [-306.917] (-315.641) (-306.203) -- 0:01:25
12000 -- (-304.786) (-322.364) (-304.168) [-310.560] * (-312.434) [-306.637] (-309.653) (-305.706) -- 0:01:22
12500 -- [-303.339] (-313.806) (-302.748) (-316.650) * (-312.742) (-303.305) (-314.640) [-306.551] -- 0:01:19
13000 -- [-305.050] (-331.685) (-307.480) (-314.661) * (-315.680) (-304.219) (-313.469) [-303.955] -- 0:01:15
13500 -- [-302.611] (-317.656) (-301.891) (-330.685) * [-304.828] (-306.329) (-317.622) (-305.530) -- 0:01:13
14000 -- (-302.995) (-314.944) [-306.342] (-313.427) * [-311.268] (-304.854) (-318.961) (-307.198) -- 0:01:10
14500 -- (-305.180) (-317.422) (-308.758) [-323.529] * (-318.377) (-302.138) (-318.070) [-303.375] -- 0:01:07
15000 -- [-305.148] (-325.293) (-304.795) (-318.195) * (-319.150) (-301.996) (-313.403) [-302.767] -- 0:01:05
Average standard deviation of split frequencies: 0.041868
15500 -- [-305.617] (-318.601) (-305.639) (-314.119) * [-313.567] (-303.097) (-319.055) (-304.398) -- 0:01:03
16000 -- [-303.606] (-304.588) (-305.288) (-322.712) * (-313.299) (-302.949) (-310.809) [-303.265] -- 0:01:01
16500 -- (-303.772) [-305.084] (-306.639) (-319.071) * [-309.494] (-303.208) (-317.148) (-303.779) -- 0:00:59
17000 -- [-306.217] (-310.572) (-303.556) (-322.808) * (-319.047) [-302.781] (-312.749) (-308.878) -- 0:00:57
17500 -- (-305.818) [-302.592] (-307.546) (-326.234) * (-318.290) [-302.903] (-312.137) (-307.866) -- 0:00:56
18000 -- [-305.958] (-303.068) (-304.759) (-327.877) * [-315.597] (-304.788) (-311.376) (-303.086) -- 0:00:54
18500 -- [-302.318] (-304.592) (-302.867) (-327.102) * (-313.089) (-303.977) (-311.763) [-302.381] -- 0:00:53
19000 -- (-303.771) (-306.909) (-303.597) [-321.360] * (-321.843) [-302.464] (-320.312) (-304.719) -- 0:00:51
19500 -- [-302.533] (-304.670) (-309.016) (-323.613) * (-322.072) (-304.685) (-310.833) [-306.533] -- 0:00:50
20000 -- [-304.765] (-303.860) (-304.830) (-319.756) * (-317.063) (-303.067) [-312.651] (-303.234) -- 0:00:49
Average standard deviation of split frequencies: 0.051956
20500 -- (-310.522) [-304.462] (-302.190) (-312.885) * [-309.205] (-303.415) (-310.848) (-302.783) -- 0:00:47
21000 -- (-304.487) (-304.272) (-302.011) [-302.263] * (-319.628) (-304.707) (-316.444) [-303.177] -- 0:00:46
21500 -- (-306.372) (-304.169) [-302.234] (-303.980) * (-317.662) [-302.849] (-318.502) (-306.663) -- 0:00:45
22000 -- (-303.528) (-304.344) (-305.286) [-302.925] * [-310.315] (-303.924) (-314.036) (-305.467) -- 0:01:28
22500 -- (-306.687) (-303.534) (-306.535) [-302.827] * (-313.337) [-306.188] (-319.072) (-304.707) -- 0:01:26
23000 -- (-308.809) (-303.971) [-305.920] (-304.175) * (-307.544) [-302.338] (-312.240) (-304.749) -- 0:01:24
23500 -- (-306.918) [-305.097] (-303.775) (-304.207) * [-312.546] (-304.877) (-324.198) (-303.141) -- 0:01:23
24000 -- [-303.853] (-303.814) (-304.117) (-303.063) * (-308.704) [-304.030] (-313.308) (-303.701) -- 0:01:21
24500 -- (-304.716) [-302.052] (-303.372) (-303.685) * (-313.370) (-303.923) (-310.181) [-303.730] -- 0:01:19
25000 -- (-304.851) [-303.370] (-303.073) (-302.993) * [-309.464] (-305.350) (-316.100) (-304.846) -- 0:01:18
Average standard deviation of split frequencies: 0.044145
25500 -- [-303.188] (-304.027) (-302.504) (-305.554) * (-317.057) [-305.363] (-316.533) (-303.331) -- 0:01:16
26000 -- (-308.527) (-304.906) (-303.135) [-306.110] * (-312.241) (-302.663) [-309.555] (-304.784) -- 0:01:14
26500 -- (-304.433) [-304.932] (-306.197) (-303.428) * (-318.524) (-304.581) (-310.663) [-308.255] -- 0:01:13
27000 -- [-304.819] (-304.460) (-302.244) (-302.243) * (-315.759) (-304.756) (-314.109) [-308.142] -- 0:01:12
27500 -- (-305.508) [-302.357] (-303.662) (-304.586) * [-311.042] (-305.678) (-315.979) (-303.705) -- 0:01:10
28000 -- (-303.034) (-302.093) [-304.502] (-306.961) * [-310.039] (-304.700) (-319.297) (-306.986) -- 0:01:09
28500 -- (-305.180) [-303.662] (-305.009) (-302.617) * (-311.633) (-304.602) (-317.792) [-305.332] -- 0:01:08
29000 -- (-306.481) [-305.904] (-304.879) (-313.061) * (-310.323) (-305.999) (-315.874) [-302.496] -- 0:01:06
29500 -- (-307.351) (-305.763) [-304.524] (-304.402) * [-313.892] (-303.174) (-326.205) (-305.422) -- 0:01:05
30000 -- (-303.573) (-308.268) [-307.452] (-303.865) * [-316.972] (-302.450) (-309.692) (-304.732) -- 0:01:04
Average standard deviation of split frequencies: 0.036124
30500 -- (-302.751) [-308.789] (-306.320) (-302.095) * [-312.686] (-305.373) (-310.908) (-304.407) -- 0:01:03
31000 -- [-303.673] (-307.372) (-302.842) (-303.450) * (-314.525) (-309.185) [-312.549] (-302.884) -- 0:01:02
31500 -- [-303.642] (-308.056) (-303.066) (-302.199) * (-316.545) (-304.615) (-317.739) [-306.725] -- 0:01:01
32000 -- (-306.065) (-305.429) (-306.347) [-304.185] * (-332.045) [-305.738] (-319.496) (-305.937) -- 0:01:00
32500 -- (-305.035) (-304.752) [-302.930] (-308.847) * (-316.612) (-305.111) (-313.342) [-306.233] -- 0:00:59
33000 -- [-304.077] (-304.087) (-308.133) (-304.539) * [-305.172] (-307.368) (-315.733) (-306.667) -- 0:00:58
33500 -- [-302.692] (-308.495) (-305.699) (-305.720) * (-305.728) (-305.556) (-318.927) [-304.390] -- 0:00:57
34000 -- (-302.596) (-307.946) (-307.489) [-305.318] * [-306.410] (-305.313) (-302.671) (-302.032) -- 0:00:56
34500 -- (-305.793) [-302.665] (-305.628) (-304.441) * (-305.225) (-307.524) [-303.109] (-307.422) -- 0:00:55
35000 -- [-305.858] (-303.475) (-302.150) (-305.786) * (-303.473) (-303.882) [-302.414] (-307.607) -- 0:00:55
Average standard deviation of split frequencies: 0.042730
35500 -- (-306.286) [-302.274] (-303.406) (-310.289) * [-302.757] (-302.970) (-304.336) (-303.613) -- 0:00:54
36000 -- (-306.479) (-303.132) (-303.000) [-303.928] * (-306.264) (-304.532) [-304.217] (-304.090) -- 0:00:53
36500 -- (-303.364) [-302.183] (-302.859) (-302.654) * (-302.925) [-304.363] (-302.519) (-303.822) -- 0:01:19
37000 -- (-304.668) (-302.611) (-308.959) [-303.452] * (-306.558) [-305.320] (-306.103) (-302.179) -- 0:01:18
37500 -- (-304.566) [-303.058] (-307.140) (-303.092) * [-303.869] (-303.452) (-305.783) (-305.156) -- 0:01:17
38000 -- (-304.530) [-305.116] (-304.035) (-306.476) * [-306.076] (-311.107) (-302.784) (-302.850) -- 0:01:15
38500 -- [-305.589] (-303.465) (-303.952) (-308.106) * (-304.228) (-308.859) [-303.482] (-304.853) -- 0:01:14
39000 -- [-304.884] (-303.990) (-303.733) (-305.677) * [-302.103] (-305.572) (-303.408) (-310.403) -- 0:01:13
39500 -- (-306.757) (-303.283) [-303.494] (-304.085) * [-303.146] (-303.167) (-303.935) (-307.516) -- 0:01:12
40000 -- (-302.921) (-305.335) (-305.124) [-305.676] * (-306.209) (-303.816) [-306.331] (-304.472) -- 0:01:12
Average standard deviation of split frequencies: 0.038253
40500 -- (-306.128) (-306.024) [-303.069] (-303.004) * [-307.515] (-304.450) (-304.810) (-304.468) -- 0:01:11
41000 -- (-302.834) (-303.253) (-304.055) [-305.253] * [-303.275] (-303.038) (-305.468) (-302.783) -- 0:01:10
41500 -- (-304.350) (-303.878) (-303.433) [-305.434] * [-303.852] (-308.012) (-303.054) (-304.153) -- 0:01:09
42000 -- (-310.631) (-303.562) (-304.507) [-306.361] * (-304.840) (-304.987) [-305.454] (-303.804) -- 0:01:08
42500 -- (-304.166) (-302.540) [-307.385] (-303.934) * (-303.028) (-303.446) (-308.218) [-304.336] -- 0:01:07
43000 -- (-305.686) (-304.603) (-309.231) [-303.619] * [-305.502] (-308.004) (-306.247) (-305.278) -- 0:01:06
43500 -- (-303.693) [-304.462] (-305.045) (-304.142) * (-307.458) (-304.889) (-316.002) [-304.009] -- 0:01:05
44000 -- (-302.283) (-303.693) [-306.307] (-302.127) * (-302.932) (-304.250) (-310.860) [-302.232] -- 0:01:05
44500 -- [-303.592] (-304.742) (-306.645) (-303.216) * (-303.630) [-303.602] (-303.472) (-303.531) -- 0:01:04
45000 -- (-304.944) (-305.430) (-305.381) [-305.219] * (-303.146) [-302.998] (-303.627) (-304.393) -- 0:01:03
Average standard deviation of split frequencies: 0.034936
45500 -- [-303.354] (-306.215) (-303.250) (-302.570) * [-303.890] (-305.907) (-304.214) (-302.225) -- 0:01:02
46000 -- [-305.555] (-303.032) (-303.702) (-303.996) * (-304.116) (-303.695) (-309.902) [-305.040] -- 0:01:02
46500 -- (-309.340) (-302.395) [-303.522] (-304.126) * [-303.055] (-308.459) (-302.590) (-303.197) -- 0:01:01
47000 -- (-302.951) (-303.851) [-303.149] (-303.148) * (-305.417) (-305.740) (-302.473) [-303.762] -- 0:01:00
47500 -- [-302.150] (-305.789) (-304.446) (-308.289) * (-308.091) (-304.090) (-302.276) [-305.424] -- 0:01:00
48000 -- (-304.511) (-302.606) (-305.524) [-303.662] * (-307.731) [-303.980] (-302.928) (-304.767) -- 0:00:59
48500 -- (-305.669) [-303.717] (-307.417) (-307.675) * (-309.086) [-303.441] (-304.160) (-304.994) -- 0:00:58
49000 -- (-311.406) (-304.566) [-302.627] (-305.816) * (-302.562) (-303.871) (-310.483) [-303.407] -- 0:00:58
49500 -- (-308.283) (-302.363) [-304.155] (-302.786) * (-304.532) (-303.436) (-304.767) [-302.293] -- 0:00:57
50000 -- [-306.757] (-304.601) (-302.956) (-303.426) * (-304.830) (-305.346) [-305.283] (-305.161) -- 0:00:57
Average standard deviation of split frequencies: 0.032564
50500 -- (-304.219) [-305.805] (-303.884) (-302.229) * (-303.010) (-303.203) (-302.106) [-303.463] -- 0:00:56
51000 -- (-304.422) [-302.428] (-308.356) (-303.504) * (-306.314) [-304.570] (-303.002) (-305.190) -- 0:00:55
51500 -- (-305.574) (-302.177) [-305.928] (-304.009) * (-302.065) [-305.519] (-303.399) (-303.928) -- 0:01:13
52000 -- (-305.226) [-304.705] (-304.267) (-305.323) * [-305.586] (-306.544) (-302.989) (-307.318) -- 0:01:12
52500 -- (-303.985) (-303.457) [-306.336] (-302.763) * (-304.942) (-302.470) (-304.268) [-306.133] -- 0:01:12
53000 -- (-307.007) (-305.679) [-309.392] (-302.303) * (-305.267) (-304.225) [-304.208] (-303.455) -- 0:01:11
53500 -- (-302.289) (-304.557) [-304.246] (-302.657) * (-303.858) (-306.970) (-303.061) [-303.400] -- 0:01:10
54000 -- (-302.360) (-305.346) [-302.643] (-302.357) * (-303.300) [-302.279] (-305.496) (-303.448) -- 0:01:10
54500 -- [-303.498] (-303.723) (-303.726) (-309.785) * (-304.686) [-303.691] (-308.861) (-302.892) -- 0:01:09
55000 -- [-304.631] (-303.574) (-302.968) (-306.350) * (-302.620) [-309.004] (-303.845) (-302.725) -- 0:01:08
Average standard deviation of split frequencies: 0.029845
55500 -- (-305.679) [-303.073] (-303.598) (-308.830) * [-302.797] (-304.154) (-304.245) (-304.581) -- 0:01:08
56000 -- (-303.985) (-303.535) [-304.930] (-307.485) * (-302.688) (-304.108) (-303.758) [-304.089] -- 0:01:07
56500 -- (-308.053) (-304.448) [-303.093] (-305.932) * [-303.336] (-307.474) (-304.113) (-301.889) -- 0:01:06
57000 -- (-308.893) [-303.085] (-302.499) (-307.808) * (-305.744) (-306.592) (-304.446) [-306.610] -- 0:01:06
57500 -- (-302.832) [-307.656] (-309.631) (-302.992) * (-303.528) (-304.628) [-303.349] (-309.298) -- 0:01:05
58000 -- (-304.438) [-304.177] (-306.879) (-306.052) * (-305.354) (-302.716) [-305.326] (-303.858) -- 0:01:04
58500 -- (-304.719) (-302.778) [-304.415] (-303.636) * [-304.446] (-303.255) (-303.927) (-302.887) -- 0:01:04
59000 -- (-305.538) (-304.918) (-303.393) [-304.410] * [-302.225] (-305.531) (-303.327) (-304.410) -- 0:01:03
59500 -- (-302.897) (-303.062) [-303.329] (-307.292) * [-304.562] (-302.843) (-304.055) (-303.595) -- 0:01:03
60000 -- [-303.542] (-306.466) (-304.182) (-308.755) * (-303.080) (-302.823) (-302.615) [-304.182] -- 0:01:02
Average standard deviation of split frequencies: 0.026419
60500 -- (-307.829) (-306.055) [-305.074] (-303.768) * (-306.346) [-303.237] (-304.160) (-304.957) -- 0:01:02
61000 -- (-304.780) (-304.726) (-304.028) [-303.516] * (-309.247) (-303.120) [-305.494] (-302.641) -- 0:01:01
61500 -- (-303.388) [-302.131] (-305.202) (-303.540) * (-303.392) (-303.698) (-302.932) [-302.616] -- 0:01:01
62000 -- (-302.757) [-303.046] (-302.540) (-305.731) * [-303.287] (-303.550) (-305.737) (-305.987) -- 0:01:00
62500 -- (-305.968) (-304.412) [-303.238] (-305.058) * [-305.361] (-306.645) (-304.135) (-302.355) -- 0:01:00
63000 -- (-306.003) (-304.046) [-306.551] (-303.611) * (-303.008) (-305.261) [-304.089] (-303.632) -- 0:00:59
63500 -- (-308.082) (-303.453) (-308.607) [-304.059] * [-302.295] (-305.340) (-304.576) (-303.442) -- 0:00:58
64000 -- (-308.884) (-305.069) (-306.139) [-304.344] * [-302.312] (-302.910) (-303.603) (-302.813) -- 0:00:58
64500 -- [-309.439] (-304.118) (-306.039) (-305.514) * (-305.403) (-302.054) (-304.867) [-304.238] -- 0:00:58
65000 -- (-305.687) (-306.345) (-308.012) [-302.964] * [-303.401] (-304.437) (-304.378) (-304.812) -- 0:00:57
Average standard deviation of split frequencies: 0.025713
65500 -- (-307.398) [-303.765] (-307.307) (-304.709) * (-303.104) [-304.917] (-303.202) (-306.879) -- 0:00:57
66000 -- (-305.112) (-305.080) [-304.843] (-303.591) * (-302.761) (-303.203) [-304.976] (-307.089) -- 0:00:56
66500 -- (-305.707) (-303.866) (-306.381) [-306.278] * (-304.964) [-303.005] (-316.393) (-304.504) -- 0:00:56
67000 -- (-305.323) (-304.918) [-302.057] (-307.287) * [-305.636] (-305.034) (-304.235) (-302.586) -- 0:01:09
67500 -- (-304.951) [-304.227] (-302.998) (-304.755) * (-304.491) (-309.172) (-302.200) [-305.600] -- 0:01:09
68000 -- [-305.685] (-304.341) (-306.288) (-303.969) * (-304.051) (-303.917) [-302.363] (-304.993) -- 0:01:08
68500 -- (-303.062) (-306.421) (-308.946) [-303.535] * (-304.393) (-305.268) (-302.791) [-302.735] -- 0:01:07
69000 -- (-304.161) (-308.410) [-302.507] (-306.723) * (-308.406) [-305.120] (-304.019) (-307.003) -- 0:01:07
69500 -- (-303.861) (-303.693) [-304.800] (-304.358) * (-305.922) (-306.613) (-304.374) [-306.185] -- 0:01:06
70000 -- [-305.282] (-305.590) (-308.266) (-304.149) * [-305.664] (-304.220) (-303.989) (-302.544) -- 0:01:06
Average standard deviation of split frequencies: 0.025730
70500 -- (-305.224) [-305.474] (-303.329) (-305.280) * (-307.984) (-304.347) (-302.916) [-303.672] -- 0:01:05
71000 -- (-305.175) (-306.291) [-301.968] (-303.019) * (-303.523) (-304.111) [-303.920] (-302.730) -- 0:01:05
71500 -- [-303.136] (-301.952) (-302.587) (-302.848) * (-303.017) [-308.237] (-302.713) (-303.241) -- 0:01:04
72000 -- (-304.789) (-304.929) (-303.211) [-308.049] * (-303.724) (-305.328) (-304.691) [-302.149] -- 0:01:04
72500 -- (-302.752) [-302.897] (-304.989) (-305.366) * [-302.817] (-306.204) (-302.854) (-304.212) -- 0:01:03
73000 -- (-303.751) (-302.122) (-302.466) [-304.530] * [-307.786] (-303.168) (-304.476) (-303.405) -- 0:01:03
73500 -- [-305.774] (-303.874) (-304.077) (-303.092) * (-302.691) [-304.060] (-303.177) (-303.858) -- 0:01:03
74000 -- [-303.044] (-305.598) (-305.820) (-303.574) * (-304.602) (-304.437) [-303.147] (-305.944) -- 0:01:02
74500 -- (-305.253) (-303.483) [-305.071] (-306.588) * [-307.388] (-305.625) (-304.813) (-307.240) -- 0:01:02
75000 -- (-303.654) (-303.069) (-304.796) [-303.506] * (-303.240) (-303.902) (-302.499) [-303.598] -- 0:01:01
Average standard deviation of split frequencies: 0.031340
75500 -- (-304.249) [-302.288] (-305.845) (-304.478) * (-307.701) (-304.054) (-307.051) [-302.031] -- 0:01:01
76000 -- (-305.603) [-303.941] (-303.801) (-305.789) * (-303.188) (-303.428) [-306.118] (-307.326) -- 0:01:00
76500 -- (-303.839) [-307.154] (-303.525) (-303.124) * [-306.756] (-304.016) (-305.148) (-306.170) -- 0:01:00
77000 -- (-304.966) (-305.417) (-302.653) [-305.695] * (-309.169) (-307.160) (-308.179) [-303.195] -- 0:00:59
77500 -- [-302.838] (-306.626) (-305.374) (-305.688) * [-303.154] (-304.759) (-305.651) (-303.924) -- 0:00:59
78000 -- (-305.008) (-303.699) [-302.181] (-305.918) * (-304.882) (-305.313) [-305.191] (-302.421) -- 0:00:59
78500 -- (-303.528) [-304.273] (-303.705) (-303.227) * [-304.602] (-308.001) (-304.306) (-303.985) -- 0:00:58
79000 -- (-304.758) [-303.824] (-306.372) (-306.410) * (-304.269) [-306.106] (-305.746) (-308.703) -- 0:00:58
79500 -- (-304.356) [-304.002] (-304.288) (-302.283) * (-309.146) (-303.499) [-305.485] (-308.387) -- 0:00:57
80000 -- [-304.736] (-304.194) (-304.292) (-302.547) * [-305.268] (-304.439) (-303.599) (-310.812) -- 0:01:09
Average standard deviation of split frequencies: 0.029219
80500 -- (-303.492) [-306.660] (-304.039) (-305.518) * (-306.748) [-304.816] (-305.578) (-302.921) -- 0:01:08
81000 -- (-305.139) [-303.552] (-308.257) (-302.199) * [-303.056] (-303.355) (-310.042) (-304.588) -- 0:01:08
81500 -- (-308.855) [-305.392] (-303.060) (-302.728) * [-302.653] (-304.162) (-303.993) (-303.521) -- 0:01:07
82000 -- (-306.270) (-306.713) (-302.427) [-302.575] * (-304.837) (-303.289) (-302.935) [-305.817] -- 0:01:07
82500 -- (-305.193) [-305.534] (-303.677) (-304.276) * (-302.651) (-304.310) [-306.545] (-303.186) -- 0:01:06
83000 -- (-304.441) [-303.443] (-302.960) (-303.026) * [-303.413] (-303.476) (-304.826) (-304.284) -- 0:01:06
83500 -- [-308.115] (-305.594) (-302.062) (-307.021) * (-304.734) (-303.072) (-302.369) [-303.509] -- 0:01:05
84000 -- (-308.725) (-306.002) [-305.823] (-311.478) * [-304.517] (-305.990) (-306.641) (-306.918) -- 0:01:05
84500 -- (-313.001) (-306.379) (-302.884) [-307.642] * (-303.126) (-303.078) (-305.793) [-308.894] -- 0:01:05
85000 -- (-306.453) [-303.396] (-305.995) (-306.257) * (-304.069) (-305.011) [-306.622] (-302.527) -- 0:01:04
Average standard deviation of split frequencies: 0.025912
85500 -- [-304.310] (-304.584) (-305.288) (-308.561) * [-302.820] (-306.254) (-303.878) (-302.107) -- 0:01:04
86000 -- (-309.428) (-305.242) [-303.053] (-303.255) * (-304.313) (-305.935) [-307.281] (-303.686) -- 0:01:03
86500 -- (-309.336) [-304.376] (-305.635) (-304.078) * [-304.903] (-303.120) (-304.994) (-302.224) -- 0:01:03
87000 -- (-306.721) [-305.511] (-310.638) (-306.431) * (-305.131) [-303.872] (-306.364) (-306.380) -- 0:01:02
87500 -- [-304.137] (-304.014) (-306.832) (-303.727) * [-302.899] (-303.517) (-304.497) (-304.584) -- 0:01:02
88000 -- [-304.812] (-304.859) (-303.170) (-303.399) * (-306.225) (-302.293) [-303.865] (-303.505) -- 0:01:02
88500 -- (-303.042) (-303.655) [-304.257] (-303.756) * (-305.792) (-305.163) [-302.510] (-306.131) -- 0:01:01
89000 -- (-302.668) [-303.961] (-307.144) (-307.742) * [-306.323] (-303.650) (-305.564) (-305.643) -- 0:01:01
89500 -- (-304.184) (-304.381) (-304.775) [-304.689] * (-302.095) (-303.464) (-303.124) [-304.444] -- 0:01:01
90000 -- (-304.956) (-308.355) (-304.266) [-305.106] * (-304.677) [-303.959] (-305.806) (-302.847) -- 0:01:00
Average standard deviation of split frequencies: 0.025997
90500 -- (-304.160) (-303.120) [-301.883] (-304.385) * (-305.859) [-304.968] (-302.991) (-304.023) -- 0:01:00
91000 -- (-303.967) (-304.952) [-302.252] (-305.782) * (-305.846) (-304.692) (-303.421) [-302.807] -- 0:00:59
91500 -- (-302.960) (-303.504) (-305.456) [-303.907] * [-302.604] (-303.180) (-304.262) (-306.291) -- 0:00:59
92000 -- [-303.153] (-304.869) (-303.411) (-304.835) * (-304.168) (-305.131) [-302.542] (-303.433) -- 0:00:59
92500 -- [-302.845] (-303.026) (-305.074) (-301.997) * (-303.515) [-303.380] (-303.280) (-302.942) -- 0:00:58
93000 -- (-305.265) (-302.641) [-303.189] (-302.828) * (-304.601) [-304.033] (-307.877) (-304.951) -- 0:01:08
93500 -- (-306.206) [-304.436] (-303.345) (-303.188) * (-303.418) [-303.679] (-311.688) (-305.157) -- 0:01:07
94000 -- [-302.521] (-303.279) (-302.595) (-306.024) * (-303.240) (-308.103) (-309.101) [-305.659] -- 0:01:07
94500 -- (-303.090) (-302.366) (-305.030) [-303.675] * [-303.381] (-303.283) (-303.106) (-302.498) -- 0:01:07
95000 -- (-305.089) [-304.390] (-306.020) (-304.491) * (-302.458) (-302.798) [-303.253] (-304.534) -- 0:01:06
Average standard deviation of split frequencies: 0.024307
95500 -- (-307.779) (-302.014) (-304.204) [-302.882] * [-308.859] (-303.682) (-302.545) (-306.074) -- 0:01:06
96000 -- (-302.786) (-304.557) [-303.988] (-305.260) * (-302.997) (-303.823) [-304.568] (-302.507) -- 0:01:05
96500 -- (-303.564) [-302.331] (-304.643) (-306.476) * (-307.037) (-304.937) (-303.110) [-302.511] -- 0:01:05
97000 -- (-303.599) (-303.920) (-304.442) [-302.889] * (-302.883) (-307.875) (-303.229) [-303.975] -- 0:01:05
97500 -- [-303.725] (-304.099) (-305.117) (-307.127) * (-302.799) (-302.381) [-302.768] (-303.060) -- 0:01:04
98000 -- (-304.587) [-305.277] (-305.221) (-305.718) * (-302.244) (-304.274) (-307.339) [-302.599] -- 0:01:04
98500 -- [-303.585] (-301.997) (-303.310) (-305.622) * [-304.688] (-305.377) (-307.950) (-304.951) -- 0:01:04
99000 -- [-303.434] (-302.678) (-304.111) (-305.452) * (-303.773) [-303.791] (-307.258) (-306.834) -- 0:01:03
99500 -- (-302.140) (-305.208) (-306.710) [-303.941] * [-303.346] (-304.357) (-304.397) (-306.378) -- 0:01:03
100000 -- (-303.495) (-302.358) (-302.492) [-308.065] * (-309.346) (-303.813) (-303.858) [-303.136] -- 0:01:02
Average standard deviation of split frequencies: 0.023168
100500 -- (-304.750) [-305.609] (-303.920) (-305.411) * (-304.110) (-304.712) [-305.281] (-304.123) -- 0:01:02
101000 -- (-303.509) (-305.682) [-305.379] (-308.874) * (-306.573) [-303.009] (-304.047) (-304.053) -- 0:01:02
101500 -- (-304.349) [-303.500] (-305.407) (-303.848) * (-303.758) (-303.352) (-306.930) [-308.164] -- 0:01:01
102000 -- (-305.110) (-303.940) (-304.569) [-303.273] * (-302.586) (-303.844) (-303.805) [-303.750] -- 0:01:01
102500 -- [-305.494] (-303.376) (-306.938) (-303.507) * [-304.308] (-303.674) (-308.402) (-304.406) -- 0:01:01
103000 -- (-307.317) (-303.334) [-305.550] (-304.565) * [-304.088] (-304.833) (-308.743) (-305.410) -- 0:01:00
103500 -- (-304.608) [-307.338] (-304.312) (-303.145) * (-305.610) (-302.855) (-306.348) [-305.125] -- 0:01:00
104000 -- (-303.442) [-304.030] (-304.358) (-301.922) * (-302.489) (-302.932) [-305.072] (-304.053) -- 0:01:00
104500 -- (-303.682) (-304.714) (-302.690) [-302.736] * (-302.545) (-308.559) (-304.112) [-302.808] -- 0:00:59
105000 -- [-304.889] (-304.724) (-303.076) (-303.986) * (-303.797) (-305.146) [-303.834] (-303.016) -- 0:00:59
Average standard deviation of split frequencies: 0.021813
105500 -- [-303.108] (-307.870) (-302.482) (-304.120) * (-304.882) [-310.789] (-304.695) (-303.482) -- 0:00:59
106000 -- [-303.706] (-304.076) (-302.819) (-302.726) * (-302.873) [-302.747] (-306.129) (-303.395) -- 0:00:59
106500 -- (-308.953) (-306.183) (-304.425) [-302.726] * [-303.036] (-304.475) (-302.854) (-303.606) -- 0:01:07
107000 -- (-308.818) (-302.680) (-305.850) [-303.759] * [-305.754] (-306.310) (-303.120) (-301.967) -- 0:01:06
107500 -- (-305.279) (-303.015) (-305.347) [-302.565] * (-307.135) (-307.146) (-306.718) [-302.490] -- 0:01:06
108000 -- (-310.205) (-304.198) [-302.567] (-306.127) * [-302.412] (-304.336) (-305.162) (-304.978) -- 0:01:06
108500 -- (-304.962) [-304.494] (-303.227) (-302.918) * [-302.974] (-302.328) (-305.066) (-302.499) -- 0:01:05
109000 -- (-303.369) [-305.152] (-305.257) (-301.999) * [-302.146] (-303.943) (-304.208) (-308.528) -- 0:01:05
109500 -- (-304.519) (-308.419) [-303.349] (-305.996) * (-311.135) (-303.768) (-306.119) [-304.674] -- 0:01:05
110000 -- (-305.938) (-307.472) [-303.049] (-302.128) * (-303.917) [-309.547] (-305.980) (-304.949) -- 0:01:04
Average standard deviation of split frequencies: 0.020872
110500 -- (-310.807) (-302.727) [-302.380] (-302.798) * (-302.264) (-305.053) [-302.948] (-306.464) -- 0:01:04
111000 -- [-303.114] (-303.370) (-308.664) (-304.452) * (-303.449) (-306.163) [-304.079] (-305.444) -- 0:01:04
111500 -- (-304.843) (-309.160) [-304.920] (-305.251) * [-303.948] (-307.241) (-305.964) (-305.942) -- 0:01:03
112000 -- [-302.292] (-305.844) (-305.151) (-304.052) * (-303.221) [-304.356] (-305.875) (-302.713) -- 0:01:03
112500 -- (-303.533) (-303.403) [-305.354] (-304.368) * [-304.254] (-304.426) (-306.174) (-304.823) -- 0:01:03
113000 -- (-302.595) [-303.908] (-302.875) (-308.005) * (-302.871) (-303.572) (-303.822) [-305.438] -- 0:01:02
113500 -- (-305.840) [-302.586] (-306.333) (-304.078) * (-303.291) (-309.583) [-304.131] (-306.939) -- 0:01:02
114000 -- (-307.149) [-304.419] (-304.817) (-309.503) * (-302.618) (-303.364) (-303.773) [-302.713] -- 0:01:02
114500 -- [-303.670] (-303.078) (-305.222) (-305.754) * (-303.122) (-304.070) [-303.613] (-304.347) -- 0:01:01
115000 -- (-303.317) (-306.331) (-302.723) [-302.629] * [-305.490] (-303.692) (-304.271) (-303.817) -- 0:01:01
Average standard deviation of split frequencies: 0.021945
115500 -- (-303.752) (-304.607) [-305.200] (-301.971) * (-303.465) [-303.555] (-304.512) (-305.013) -- 0:01:01
116000 -- [-307.786] (-302.528) (-303.386) (-304.064) * (-302.020) (-305.060) [-307.368] (-303.187) -- 0:01:00
116500 -- (-305.857) (-303.829) [-303.076] (-305.413) * (-302.890) (-303.117) (-305.282) [-304.223] -- 0:01:00
117000 -- (-303.748) (-306.008) (-302.591) [-306.291] * (-305.220) (-310.039) (-304.842) [-305.111] -- 0:01:00
117500 -- (-303.929) [-304.404] (-305.948) (-307.907) * [-310.696] (-308.748) (-303.028) (-303.871) -- 0:01:00
118000 -- [-302.720] (-302.429) (-304.117) (-304.833) * [-301.924] (-303.206) (-305.849) (-305.161) -- 0:00:59
118500 -- [-305.835] (-307.212) (-302.390) (-305.923) * (-304.028) (-307.295) [-304.716] (-304.347) -- 0:00:59
119000 -- (-304.507) (-308.059) [-304.396] (-303.460) * (-305.671) (-310.038) (-304.121) [-306.292] -- 0:00:59
119500 -- (-303.206) [-303.358] (-304.292) (-304.397) * (-308.988) (-303.504) [-305.950] (-312.771) -- 0:00:58
120000 -- [-302.068] (-307.534) (-304.529) (-303.860) * (-306.082) [-303.018] (-303.032) (-306.875) -- 0:00:58
Average standard deviation of split frequencies: 0.021580
120500 -- (-301.967) (-306.354) (-303.468) [-305.380] * (-304.918) (-303.805) (-302.724) [-302.604] -- 0:00:58
121000 -- (-307.536) (-302.387) (-304.237) [-303.947] * (-304.571) [-302.750] (-303.172) (-304.727) -- 0:00:58
121500 -- (-307.305) [-305.983] (-302.149) (-302.899) * (-302.846) (-306.524) [-304.441] (-303.162) -- 0:00:57
122000 -- (-303.172) [-309.974] (-302.962) (-303.721) * [-302.537] (-303.770) (-302.516) (-304.121) -- 0:00:57
122500 -- [-304.699] (-302.494) (-302.892) (-306.212) * (-304.400) (-302.650) (-304.732) [-303.544] -- 0:00:57
123000 -- (-303.542) (-303.624) (-303.425) [-306.711] * (-303.066) (-305.177) [-302.495] (-303.899) -- 0:01:04
123500 -- (-303.963) (-302.411) [-302.573] (-305.264) * [-306.469] (-306.238) (-301.964) (-304.080) -- 0:01:03
124000 -- (-303.792) (-304.091) [-302.708] (-307.027) * [-302.969] (-306.398) (-303.509) (-304.447) -- 0:01:03
124500 -- [-302.975] (-304.627) (-304.153) (-306.080) * [-305.080] (-302.941) (-302.054) (-304.034) -- 0:01:03
125000 -- (-303.963) (-305.262) (-303.217) [-302.714] * (-304.230) [-302.555] (-303.622) (-304.728) -- 0:01:03
Average standard deviation of split frequencies: 0.018885
125500 -- (-304.853) [-303.682] (-304.953) (-305.249) * (-303.122) [-303.459] (-304.692) (-303.941) -- 0:01:02
126000 -- (-308.454) (-303.790) [-302.019] (-307.985) * [-305.126] (-302.751) (-304.292) (-304.725) -- 0:01:02
126500 -- [-303.167] (-305.075) (-307.566) (-302.979) * (-303.306) (-305.891) [-311.748] (-305.749) -- 0:01:02
127000 -- [-303.762] (-303.279) (-304.882) (-302.564) * (-309.510) (-305.887) (-305.507) [-302.943] -- 0:01:01
127500 -- [-303.661] (-303.445) (-306.722) (-302.080) * (-302.813) (-305.192) (-307.570) [-304.392] -- 0:01:01
128000 -- (-305.306) [-304.029] (-302.414) (-302.414) * (-303.140) [-303.525] (-302.532) (-303.532) -- 0:01:01
128500 -- (-302.628) (-305.787) (-304.329) [-303.180] * (-309.486) (-306.352) (-302.489) [-304.808] -- 0:01:01
129000 -- [-305.491] (-303.545) (-303.469) (-303.722) * [-306.153] (-304.380) (-302.056) (-302.935) -- 0:01:00
129500 -- (-304.107) (-302.160) (-305.736) [-303.251] * (-304.202) (-302.431) (-303.592) [-304.182] -- 0:01:00
130000 -- (-307.598) [-302.032] (-304.420) (-302.519) * [-303.259] (-302.713) (-307.275) (-303.526) -- 0:01:00
Average standard deviation of split frequencies: 0.015118
130500 -- (-306.105) (-304.362) (-306.926) [-303.808] * [-303.490] (-302.426) (-303.394) (-305.356) -- 0:00:59
131000 -- (-305.086) (-304.963) [-304.010] (-309.021) * (-304.167) (-302.593) [-302.259] (-305.357) -- 0:00:59
131500 -- (-304.729) [-302.760] (-303.403) (-304.641) * (-304.803) (-303.617) (-303.176) [-303.671] -- 0:00:59
132000 -- (-303.697) [-302.718] (-304.305) (-307.684) * (-302.630) [-303.421] (-304.041) (-303.886) -- 0:00:59
132500 -- [-302.019] (-303.301) (-302.572) (-302.745) * (-302.593) [-303.997] (-302.151) (-305.251) -- 0:00:58
133000 -- [-302.770] (-306.818) (-307.202) (-307.144) * [-303.860] (-303.920) (-302.334) (-302.225) -- 0:00:58
133500 -- [-303.085] (-307.733) (-306.245) (-302.996) * (-305.236) (-303.788) [-303.491] (-303.146) -- 0:00:58
134000 -- (-307.520) [-302.292] (-303.894) (-305.720) * (-305.861) (-305.598) [-302.189] (-303.214) -- 0:00:58
134500 -- (-304.223) [-302.678] (-311.210) (-305.008) * (-303.611) [-304.165] (-305.609) (-304.035) -- 0:00:57
135000 -- (-304.973) [-302.569] (-304.158) (-306.365) * (-303.981) [-306.053] (-303.624) (-305.636) -- 0:00:57
Average standard deviation of split frequencies: 0.015142
135500 -- (-304.067) [-303.307] (-304.556) (-312.291) * (-304.606) (-302.386) (-304.277) [-304.639] -- 0:00:57
136000 -- (-303.422) (-302.664) (-303.945) [-303.705] * (-305.057) (-305.531) (-302.528) [-303.830] -- 0:00:57
136500 -- (-304.933) (-304.373) (-302.822) [-303.655] * (-303.502) [-303.926] (-302.727) (-304.771) -- 0:00:56
137000 -- (-305.391) (-310.841) (-305.089) [-302.593] * [-302.922] (-305.841) (-303.716) (-303.289) -- 0:00:56
137500 -- (-302.931) [-305.531] (-303.945) (-304.550) * (-304.772) (-303.176) (-306.184) [-303.291] -- 0:00:56
138000 -- (-303.131) [-305.117] (-304.557) (-304.464) * (-302.960) (-304.061) (-303.369) [-303.703] -- 0:00:56
138500 -- (-307.084) [-303.818] (-303.433) (-303.441) * (-304.263) [-302.812] (-307.292) (-303.911) -- 0:00:55
139000 -- (-310.234) (-306.027) (-303.935) [-303.683] * [-306.754] (-306.807) (-303.582) (-304.005) -- 0:00:55
139500 -- (-303.780) (-307.609) [-303.246] (-302.290) * [-303.920] (-305.090) (-306.885) (-305.205) -- 0:00:55
140000 -- [-302.673] (-303.139) (-305.310) (-305.495) * (-302.108) (-302.393) (-304.434) [-304.199] -- 0:00:55
Average standard deviation of split frequencies: 0.014992
140500 -- [-305.075] (-308.437) (-306.687) (-305.340) * (-305.753) [-304.551] (-304.751) (-304.804) -- 0:01:01
141000 -- (-302.553) (-304.184) [-303.012] (-303.157) * (-305.581) (-306.091) [-302.680] (-305.607) -- 0:01:00
141500 -- (-302.752) (-303.948) (-303.968) [-304.755] * (-308.242) (-304.390) (-303.419) [-304.648] -- 0:01:00
142000 -- [-304.120] (-306.803) (-307.929) (-305.173) * (-303.805) (-306.890) (-303.602) [-303.953] -- 0:01:00
142500 -- [-302.625] (-307.346) (-305.045) (-309.643) * (-305.453) [-303.412] (-306.095) (-304.916) -- 0:01:00
143000 -- (-302.493) (-305.484) (-306.415) [-304.082] * [-302.005] (-306.035) (-305.646) (-302.518) -- 0:00:59
143500 -- [-303.161] (-303.521) (-306.034) (-304.180) * (-303.152) [-307.026] (-304.323) (-307.426) -- 0:00:59
144000 -- (-303.238) (-306.923) (-302.254) [-304.000] * (-304.460) [-303.275] (-304.480) (-304.341) -- 0:00:59
144500 -- (-303.054) [-305.565] (-303.549) (-302.767) * [-303.267] (-304.382) (-304.553) (-302.351) -- 0:00:59
145000 -- (-304.977) (-303.747) [-302.935] (-302.290) * (-304.862) [-303.769] (-302.928) (-304.648) -- 0:00:58
Average standard deviation of split frequencies: 0.015124
145500 -- (-306.061) (-303.584) [-303.264] (-302.535) * (-305.274) (-304.469) (-306.657) [-302.699] -- 0:00:58
146000 -- (-306.589) (-303.998) (-303.339) [-302.398] * (-306.254) [-306.253] (-307.070) (-304.415) -- 0:00:58
146500 -- (-303.648) (-302.093) (-302.568) [-304.269] * (-305.802) (-302.412) [-304.792] (-306.186) -- 0:00:58
147000 -- (-302.718) (-303.401) [-303.607] (-303.280) * (-302.506) [-303.912] (-302.967) (-303.415) -- 0:00:58
147500 -- (-303.614) (-304.909) (-305.557) [-303.853] * [-303.062] (-302.967) (-304.949) (-304.969) -- 0:00:57
148000 -- (-306.438) (-306.403) (-304.875) [-306.597] * [-302.254] (-302.590) (-305.096) (-309.220) -- 0:00:57
148500 -- (-306.305) [-303.712] (-303.066) (-304.161) * (-306.168) (-301.860) [-303.421] (-305.471) -- 0:00:57
149000 -- (-303.518) (-305.893) [-307.817] (-306.858) * [-305.696] (-302.574) (-302.362) (-305.855) -- 0:00:57
149500 -- (-305.025) [-303.680] (-306.239) (-301.876) * [-303.644] (-303.974) (-302.942) (-304.522) -- 0:00:56
150000 -- [-307.468] (-306.943) (-308.496) (-302.351) * (-302.285) (-302.623) [-302.850] (-303.991) -- 0:00:56
Average standard deviation of split frequencies: 0.014253
150500 -- (-302.991) (-305.765) [-303.810] (-302.803) * (-303.742) [-302.396] (-302.139) (-303.575) -- 0:00:56
151000 -- (-307.015) [-305.071] (-310.787) (-306.484) * (-303.261) (-304.322) [-302.447] (-305.029) -- 0:00:56
151500 -- [-303.212] (-306.007) (-303.050) (-307.577) * (-303.911) [-306.430] (-303.544) (-302.458) -- 0:00:56
152000 -- (-306.149) [-302.854] (-302.691) (-302.741) * (-309.665) [-305.400] (-303.479) (-305.593) -- 0:00:55
152500 -- (-304.085) (-303.341) [-302.221] (-305.188) * (-304.546) (-304.263) [-302.873] (-303.393) -- 0:00:55
153000 -- (-302.964) (-302.684) [-305.386] (-305.037) * (-304.898) (-305.410) [-302.724] (-304.740) -- 0:00:55
153500 -- (-304.853) (-302.660) (-308.186) [-304.844] * (-308.759) [-304.769] (-305.072) (-304.318) -- 0:00:55
154000 -- (-303.100) (-303.093) [-307.631] (-303.830) * [-305.813] (-304.873) (-303.077) (-302.121) -- 0:00:54
154500 -- [-304.086] (-302.429) (-306.750) (-304.590) * (-303.472) [-303.802] (-304.090) (-302.178) -- 0:00:54
155000 -- (-302.966) (-303.859) (-304.822) [-302.517] * [-305.618] (-306.392) (-302.056) (-303.661) -- 0:00:54
Average standard deviation of split frequencies: 0.015109
155500 -- (-302.511) (-302.290) (-303.944) [-302.113] * (-303.556) (-305.426) [-303.086] (-306.932) -- 0:00:54
156000 -- (-304.611) [-304.525] (-311.080) (-302.383) * (-304.196) [-306.017] (-306.638) (-305.683) -- 0:00:54
156500 -- (-302.810) (-303.538) [-304.094] (-306.167) * (-302.892) (-305.489) [-303.453] (-303.447) -- 0:00:53
157000 -- (-302.042) (-304.842) (-302.889) [-303.286] * (-304.123) [-304.163] (-306.482) (-305.791) -- 0:00:59
157500 -- (-302.098) [-304.779] (-305.274) (-305.789) * [-304.218] (-305.677) (-307.289) (-305.749) -- 0:00:58
158000 -- [-306.505] (-305.773) (-306.111) (-304.242) * (-303.111) (-303.237) (-305.340) [-302.609] -- 0:00:58
158500 -- (-303.037) (-304.601) (-304.122) [-303.725] * (-304.074) (-304.789) [-303.733] (-306.477) -- 0:00:58
159000 -- [-303.189] (-304.734) (-302.830) (-305.443) * (-303.687) (-303.818) (-304.356) [-304.152] -- 0:00:58
159500 -- (-302.310) (-304.404) [-303.927] (-305.395) * (-303.750) [-302.129] (-308.716) (-302.079) -- 0:00:57
160000 -- [-303.113] (-305.060) (-304.470) (-305.371) * (-304.368) (-302.702) (-303.953) [-302.053] -- 0:00:57
Average standard deviation of split frequencies: 0.014825
160500 -- [-303.158] (-304.546) (-303.784) (-305.017) * [-303.035] (-305.778) (-304.559) (-302.991) -- 0:00:57
161000 -- (-304.673) (-302.080) (-302.412) [-304.582] * (-304.139) (-304.976) (-304.598) [-303.187] -- 0:00:57
161500 -- (-308.521) (-302.366) (-302.404) [-302.967] * (-302.849) [-303.672] (-305.606) (-303.073) -- 0:00:57
162000 -- (-304.022) [-304.608] (-303.048) (-304.197) * (-302.740) [-303.855] (-303.326) (-303.158) -- 0:00:56
162500 -- [-303.368] (-303.968) (-304.863) (-302.931) * (-303.022) (-304.624) [-302.823] (-305.674) -- 0:00:56
163000 -- [-305.284] (-304.990) (-302.566) (-303.059) * (-302.986) (-303.822) (-305.405) [-303.018] -- 0:00:56
163500 -- (-309.488) (-302.431) (-304.197) [-303.226] * [-302.645] (-304.118) (-305.092) (-304.183) -- 0:00:56
164000 -- (-303.352) (-302.378) [-303.847] (-302.703) * (-303.692) [-305.219] (-305.899) (-303.617) -- 0:00:56
164500 -- (-303.097) (-302.146) (-306.944) [-302.174] * (-301.991) (-304.600) [-302.858] (-307.552) -- 0:00:55
165000 -- (-305.152) (-304.512) (-305.314) [-305.527] * (-302.575) (-303.508) [-303.812] (-305.464) -- 0:00:55
Average standard deviation of split frequencies: 0.015544
165500 -- (-305.385) (-304.844) [-303.853] (-304.774) * [-303.259] (-304.069) (-304.110) (-304.247) -- 0:00:55
166000 -- (-303.311) [-302.321] (-302.549) (-302.742) * (-302.616) (-302.133) [-303.824] (-307.150) -- 0:00:55
166500 -- (-303.752) (-305.712) (-302.716) [-302.264] * (-303.217) [-303.532] (-303.772) (-308.594) -- 0:00:55
167000 -- (-303.555) [-305.124] (-303.320) (-305.258) * [-302.468] (-305.867) (-304.212) (-303.035) -- 0:00:54
167500 -- [-304.968] (-302.301) (-303.513) (-303.593) * (-302.972) [-305.736] (-309.735) (-305.865) -- 0:00:54
168000 -- (-307.059) (-307.200) [-306.658] (-305.011) * (-303.255) (-302.366) (-305.396) [-304.521] -- 0:00:54
168500 -- [-303.558] (-303.680) (-304.373) (-307.287) * (-302.420) (-303.015) (-303.551) [-304.588] -- 0:00:54
169000 -- (-304.029) (-306.155) (-303.574) [-302.731] * (-304.938) (-304.177) (-301.961) [-304.659] -- 0:00:54
169500 -- (-302.346) [-307.212] (-305.517) (-303.215) * (-309.433) (-303.505) (-304.883) [-305.134] -- 0:00:53
170000 -- [-305.511] (-302.660) (-305.726) (-304.424) * (-308.209) (-306.614) (-308.072) [-305.712] -- 0:00:53
Average standard deviation of split frequencies: 0.016158
170500 -- [-304.333] (-302.496) (-308.266) (-303.500) * (-306.379) (-305.630) [-303.671] (-305.954) -- 0:00:53
171000 -- (-303.541) (-302.057) [-306.671] (-303.317) * (-305.687) (-304.012) [-301.989] (-306.286) -- 0:00:53
171500 -- (-306.840) (-305.038) [-303.121] (-303.293) * [-302.753] (-304.408) (-302.947) (-309.408) -- 0:00:57
172000 -- (-302.956) (-306.264) [-303.093] (-305.882) * [-304.104] (-307.480) (-306.999) (-310.528) -- 0:00:57
172500 -- (-303.014) (-304.716) (-304.627) [-310.649] * (-305.169) (-303.627) (-303.226) [-303.186] -- 0:00:57
173000 -- (-304.582) (-303.609) [-307.994] (-305.068) * [-304.429] (-303.514) (-305.620) (-306.243) -- 0:00:57
173500 -- (-302.195) (-307.990) (-312.375) [-303.838] * [-304.578] (-302.857) (-306.142) (-304.624) -- 0:00:57
174000 -- (-302.572) (-307.647) (-309.868) [-304.069] * (-303.531) (-302.818) (-303.470) [-304.644] -- 0:00:56
174500 -- (-302.489) (-302.123) (-304.762) [-306.142] * (-304.547) (-303.604) [-305.056] (-304.853) -- 0:00:56
175000 -- (-302.149) [-306.576] (-307.133) (-307.563) * [-302.856] (-303.475) (-305.142) (-302.255) -- 0:00:56
Average standard deviation of split frequencies: 0.014880
175500 -- (-304.814) (-302.726) [-302.892] (-306.937) * (-304.853) (-304.364) (-304.639) [-302.819] -- 0:00:56
176000 -- [-305.064] (-304.604) (-307.705) (-308.553) * [-303.655] (-303.640) (-307.877) (-303.071) -- 0:00:56
176500 -- (-304.444) [-303.043] (-305.093) (-307.175) * (-302.226) (-304.298) (-302.738) [-305.611] -- 0:00:55
177000 -- (-306.446) [-303.224] (-303.958) (-303.877) * (-306.319) (-304.707) [-302.472] (-304.446) -- 0:00:55
177500 -- (-303.016) (-302.164) [-304.973] (-304.036) * (-306.374) [-305.643] (-306.086) (-304.407) -- 0:00:55
178000 -- (-302.751) (-302.979) (-304.198) [-304.168] * (-306.092) (-305.935) [-304.965] (-303.463) -- 0:00:55
178500 -- (-303.324) (-305.776) [-303.288] (-303.903) * (-303.859) (-302.634) [-304.180] (-302.951) -- 0:00:55
179000 -- (-303.102) (-302.950) [-304.155] (-307.759) * (-306.249) (-304.676) [-306.226] (-305.000) -- 0:00:55
179500 -- (-304.142) [-304.002] (-306.394) (-303.179) * (-303.191) [-302.961] (-306.994) (-304.242) -- 0:00:54
180000 -- (-304.347) (-305.113) (-311.454) [-303.211] * (-305.766) (-304.039) (-305.265) [-305.170] -- 0:00:54
Average standard deviation of split frequencies: 0.016235
180500 -- (-305.067) [-303.787] (-309.993) (-302.496) * (-304.975) (-303.106) [-304.810] (-307.730) -- 0:00:54
181000 -- (-303.016) (-302.951) (-303.358) [-304.615] * (-303.643) (-306.203) (-302.921) [-303.954] -- 0:00:54
181500 -- (-307.632) (-302.500) (-302.909) [-305.112] * (-304.500) (-304.377) [-305.147] (-303.050) -- 0:00:54
182000 -- (-303.896) (-306.531) (-305.658) [-303.602] * [-305.397] (-303.056) (-303.184) (-304.039) -- 0:00:53
182500 -- (-303.743) (-311.727) (-303.407) [-305.600] * [-302.599] (-306.697) (-303.503) (-310.512) -- 0:00:53
183000 -- (-306.680) (-307.556) (-306.070) [-308.500] * [-303.143] (-304.590) (-302.575) (-306.030) -- 0:00:53
183500 -- (-302.544) (-307.851) [-303.801] (-302.921) * [-302.581] (-303.707) (-307.555) (-303.933) -- 0:00:53
184000 -- (-306.977) (-306.217) (-302.683) [-303.003] * [-302.287] (-304.020) (-303.203) (-307.603) -- 0:00:53
184500 -- (-305.139) (-302.346) (-302.959) [-303.746] * (-304.690) [-302.221] (-302.101) (-306.915) -- 0:00:53
185000 -- (-305.639) (-303.421) [-304.323] (-302.760) * (-302.530) (-303.873) [-302.268] (-306.838) -- 0:00:52
Average standard deviation of split frequencies: 0.014673
185500 -- (-302.593) (-305.632) [-306.554] (-305.865) * (-305.312) (-302.422) (-304.624) [-306.061] -- 0:00:52
186000 -- (-301.994) [-305.387] (-311.533) (-304.564) * (-303.974) (-303.513) [-304.514] (-303.463) -- 0:00:52
186500 -- (-303.742) (-303.027) [-302.776] (-302.981) * [-304.059] (-302.862) (-302.518) (-305.152) -- 0:00:52
187000 -- (-305.333) [-307.339] (-305.476) (-306.458) * (-305.707) (-306.699) (-305.049) [-306.211] -- 0:00:52
187500 -- (-303.921) [-303.202] (-306.925) (-306.851) * (-303.701) (-305.647) [-305.532] (-305.445) -- 0:00:52
188000 -- (-305.689) (-304.205) [-303.105] (-306.106) * (-303.988) (-303.009) (-311.455) [-303.182] -- 0:00:51
188500 -- (-304.791) [-302.721] (-304.966) (-309.098) * (-306.384) (-303.830) [-303.506] (-302.630) -- 0:00:55
189000 -- [-302.843] (-303.083) (-303.459) (-302.972) * (-307.936) [-302.741] (-303.794) (-304.585) -- 0:00:55
189500 -- (-305.632) [-305.899] (-303.888) (-305.855) * (-305.221) (-310.908) [-302.534] (-305.301) -- 0:00:55
190000 -- [-303.915] (-307.373) (-304.293) (-305.249) * (-307.851) [-307.698] (-303.861) (-306.117) -- 0:00:55
Average standard deviation of split frequencies: 0.013403
190500 -- [-302.768] (-306.204) (-304.616) (-304.115) * (-304.750) (-303.804) [-303.128] (-303.589) -- 0:00:55
191000 -- (-303.460) [-305.050] (-302.883) (-304.192) * (-304.567) (-304.803) (-305.045) [-302.997] -- 0:00:55
191500 -- [-303.005] (-302.533) (-303.219) (-306.250) * (-307.369) [-303.535] (-302.759) (-303.064) -- 0:00:54
192000 -- (-304.013) (-302.703) (-305.805) [-302.706] * (-308.562) [-303.663] (-304.139) (-304.601) -- 0:00:54
192500 -- [-305.103] (-302.055) (-307.068) (-302.621) * [-308.658] (-304.264) (-304.760) (-303.713) -- 0:00:54
193000 -- (-306.666) (-304.997) [-303.333] (-304.252) * (-302.554) (-304.720) [-304.960] (-303.288) -- 0:00:54
193500 -- (-304.874) [-303.988] (-304.850) (-305.184) * (-303.371) [-304.465] (-305.184) (-303.693) -- 0:00:54
194000 -- (-301.975) [-308.454] (-305.967) (-305.231) * (-305.213) (-305.163) (-302.662) [-304.532] -- 0:00:54
194500 -- (-304.703) (-304.132) [-304.728] (-302.947) * (-307.176) [-305.904] (-302.523) (-303.926) -- 0:00:53
195000 -- [-304.095] (-303.010) (-303.854) (-305.738) * (-303.988) (-302.149) (-305.162) [-304.199] -- 0:00:53
Average standard deviation of split frequencies: 0.013763
195500 -- (-310.300) [-306.646] (-305.492) (-304.383) * [-304.522] (-310.227) (-304.844) (-303.603) -- 0:00:53
196000 -- (-303.580) [-303.708] (-304.141) (-307.298) * (-304.287) (-303.858) [-302.928] (-301.966) -- 0:00:53
196500 -- (-304.360) (-305.110) [-303.300] (-305.769) * (-305.356) (-303.839) [-304.691] (-305.462) -- 0:00:53
197000 -- (-304.411) (-307.975) [-303.810] (-303.628) * (-304.344) (-303.770) [-303.415] (-306.792) -- 0:00:52
197500 -- (-306.782) (-306.591) (-307.440) [-302.483] * (-304.486) [-304.211] (-305.109) (-302.546) -- 0:00:52
198000 -- (-302.579) [-303.932] (-305.346) (-304.405) * [-305.795] (-302.337) (-303.675) (-302.757) -- 0:00:52
198500 -- [-302.668] (-303.050) (-305.396) (-304.830) * (-304.079) (-304.096) [-303.294] (-302.745) -- 0:00:52
199000 -- [-306.600] (-303.780) (-304.969) (-305.164) * (-304.363) (-306.925) (-304.153) [-305.783] -- 0:00:52
199500 -- [-309.422] (-307.910) (-311.639) (-305.801) * (-304.935) (-306.511) (-307.239) [-306.855] -- 0:00:52
200000 -- [-306.009] (-304.491) (-304.538) (-303.838) * (-302.754) [-305.293] (-302.681) (-302.722) -- 0:00:51
Average standard deviation of split frequencies: 0.014748
200500 -- (-303.529) [-303.722] (-302.547) (-304.399) * (-303.689) (-304.199) [-302.201] (-301.821) -- 0:00:51
201000 -- (-307.877) [-305.504] (-303.530) (-303.735) * (-305.060) [-303.260] (-305.703) (-305.926) -- 0:00:51
201500 -- (-309.271) [-304.338] (-303.006) (-303.401) * [-304.830] (-303.316) (-304.819) (-304.512) -- 0:00:51
202000 -- (-308.074) (-305.895) (-307.511) [-303.289] * (-307.127) (-304.772) (-305.549) [-306.479] -- 0:00:51
202500 -- (-302.560) [-303.205] (-305.349) (-302.599) * (-303.521) [-303.859] (-303.893) (-303.316) -- 0:00:51
203000 -- (-302.057) (-304.262) [-305.033] (-303.212) * [-303.499] (-305.110) (-303.865) (-304.215) -- 0:00:51
203500 -- (-306.884) (-305.699) (-304.748) [-302.176] * (-307.941) (-305.329) (-305.833) [-304.338] -- 0:00:50
204000 -- (-302.018) (-310.924) [-302.366] (-309.505) * [-307.413] (-305.583) (-305.474) (-307.503) -- 0:00:50
204500 -- (-303.750) (-309.495) (-302.929) [-305.268] * (-305.673) [-303.590] (-306.816) (-304.479) -- 0:00:50
205000 -- (-305.052) (-308.832) (-305.749) [-304.381] * (-303.850) [-302.940] (-305.134) (-309.497) -- 0:00:50
Average standard deviation of split frequencies: 0.014747
205500 -- (-304.503) (-309.337) (-302.370) [-303.379] * [-303.291] (-305.847) (-303.933) (-304.673) -- 0:00:54
206000 -- (-305.771) (-303.412) [-306.929] (-302.641) * (-303.757) (-302.405) [-302.552] (-305.577) -- 0:00:53
206500 -- (-305.541) [-304.941] (-303.684) (-305.215) * [-304.728] (-302.648) (-302.906) (-307.243) -- 0:00:53
207000 -- (-305.667) [-302.922] (-303.227) (-303.534) * (-304.263) (-302.450) [-304.578] (-304.831) -- 0:00:53
207500 -- (-303.655) [-306.534] (-305.407) (-303.370) * (-304.705) (-302.125) (-302.664) [-304.927] -- 0:00:53
208000 -- (-303.439) (-304.804) [-305.406] (-303.359) * (-304.865) (-303.241) [-304.020] (-302.464) -- 0:00:53
208500 -- (-302.498) (-302.561) [-303.781] (-305.428) * (-304.501) (-304.463) (-303.214) [-302.876] -- 0:00:53
209000 -- [-307.106] (-303.118) (-307.040) (-304.812) * [-303.324] (-303.405) (-305.056) (-304.224) -- 0:00:52
209500 -- (-305.516) (-303.663) [-304.793] (-304.404) * (-305.266) (-302.271) [-303.190] (-303.436) -- 0:00:52
210000 -- (-301.948) [-303.774] (-304.739) (-304.393) * [-303.226] (-302.032) (-304.551) (-304.990) -- 0:00:52
Average standard deviation of split frequencies: 0.014172
210500 -- (-303.444) (-305.228) [-304.988] (-302.477) * (-306.189) [-304.925] (-302.933) (-302.334) -- 0:00:52
211000 -- (-302.246) (-305.356) [-303.636] (-305.120) * (-305.019) [-303.018] (-304.632) (-303.992) -- 0:00:52
211500 -- (-304.722) (-302.896) [-303.721] (-303.381) * [-304.410] (-303.695) (-304.120) (-306.292) -- 0:00:52
212000 -- (-303.969) [-304.057] (-302.896) (-302.761) * [-302.316] (-303.056) (-306.379) (-304.193) -- 0:00:52
212500 -- [-302.172] (-304.974) (-305.639) (-304.488) * [-304.533] (-304.144) (-306.722) (-303.910) -- 0:00:51
213000 -- (-304.335) (-305.380) (-309.176) [-303.753] * (-303.495) (-304.906) [-304.465] (-302.025) -- 0:00:51
213500 -- (-307.083) (-309.248) (-304.874) [-303.800] * [-306.367] (-308.809) (-310.230) (-304.245) -- 0:00:51
214000 -- (-304.427) (-304.840) [-304.619] (-306.510) * (-305.038) (-303.806) [-303.624] (-309.533) -- 0:00:51
214500 -- (-303.909) [-304.070] (-306.449) (-306.892) * (-305.689) [-303.328] (-304.004) (-304.787) -- 0:00:51
215000 -- [-305.999] (-303.458) (-304.952) (-304.909) * (-303.460) [-307.949] (-306.342) (-303.551) -- 0:00:51
Average standard deviation of split frequencies: 0.016946
215500 -- (-304.845) (-304.619) (-307.457) [-306.359] * [-305.651] (-303.974) (-302.063) (-306.111) -- 0:00:50
216000 -- (-302.692) (-303.427) (-304.236) [-303.905] * (-303.468) [-302.590] (-307.837) (-303.238) -- 0:00:50
216500 -- [-305.023] (-303.380) (-304.252) (-303.528) * (-305.779) (-303.142) (-307.049) [-304.120] -- 0:00:50
217000 -- [-303.375] (-305.769) (-305.867) (-306.651) * (-306.105) [-302.425] (-303.748) (-303.702) -- 0:00:50
217500 -- [-305.046] (-303.057) (-304.874) (-307.592) * (-307.745) [-304.083] (-308.658) (-303.387) -- 0:00:50
218000 -- [-303.539] (-303.063) (-303.355) (-303.651) * (-302.816) (-304.677) (-302.457) [-303.952] -- 0:00:50
218500 -- (-304.004) (-305.975) [-303.557] (-303.096) * (-307.436) (-303.947) (-303.264) [-303.661] -- 0:00:50
219000 -- (-306.812) (-307.046) [-302.349] (-302.901) * (-303.154) (-306.517) (-306.012) [-304.124] -- 0:00:49
219500 -- (-302.591) (-306.979) (-305.852) [-303.905] * (-304.335) [-303.763] (-306.511) (-304.996) -- 0:00:49
220000 -- (-305.216) (-305.709) (-304.188) [-306.231] * [-302.256] (-303.332) (-308.264) (-305.089) -- 0:00:49
Average standard deviation of split frequencies: 0.018221
220500 -- (-303.645) [-308.429] (-304.874) (-308.574) * (-304.041) [-306.801] (-304.985) (-305.685) -- 0:00:49
221000 -- [-303.188] (-307.697) (-303.169) (-304.213) * [-304.392] (-302.947) (-310.326) (-303.413) -- 0:00:49
221500 -- (-303.558) (-306.836) [-303.366] (-305.325) * (-302.227) (-304.945) [-307.896] (-304.038) -- 0:00:52
222000 -- (-303.960) [-302.584] (-302.902) (-305.852) * (-303.361) [-306.548] (-312.453) (-303.987) -- 0:00:52
222500 -- (-304.432) (-309.485) [-306.632] (-302.929) * [-302.993] (-302.196) (-302.040) (-303.404) -- 0:00:52
223000 -- [-305.500] (-304.224) (-308.795) (-305.451) * (-302.640) [-303.786] (-305.638) (-304.346) -- 0:00:52
223500 -- (-308.399) (-302.301) [-305.456] (-302.937) * [-304.581] (-305.560) (-303.170) (-303.448) -- 0:00:52
224000 -- [-307.698] (-306.527) (-302.634) (-305.729) * (-304.508) (-304.286) (-305.675) [-302.476] -- 0:00:51
224500 -- [-303.304] (-306.308) (-304.074) (-304.278) * (-306.084) (-304.115) [-304.022] (-304.360) -- 0:00:51
225000 -- (-307.226) (-303.534) [-305.068] (-305.969) * (-304.771) [-302.478] (-304.068) (-302.488) -- 0:00:51
Average standard deviation of split frequencies: 0.018773
225500 -- (-304.265) [-303.157] (-304.005) (-307.366) * (-305.405) (-302.483) [-302.784] (-302.582) -- 0:00:51
226000 -- (-303.843) (-306.054) (-303.784) [-302.934] * (-305.851) (-302.913) [-305.226] (-304.773) -- 0:00:51
226500 -- [-304.910] (-304.424) (-304.689) (-303.175) * (-304.316) (-305.665) (-304.776) [-303.101] -- 0:00:51
227000 -- (-304.918) (-306.955) (-303.554) [-302.750] * (-303.095) [-305.887] (-303.911) (-304.697) -- 0:00:51
227500 -- (-307.415) [-304.310] (-306.895) (-308.444) * (-302.922) (-303.351) (-304.799) [-306.234] -- 0:00:50
228000 -- (-305.045) [-304.125] (-307.085) (-302.779) * (-302.437) [-306.752] (-304.891) (-306.942) -- 0:00:50
228500 -- (-305.459) (-304.180) (-305.282) [-305.301] * (-304.645) (-308.330) (-305.845) [-305.736] -- 0:00:50
229000 -- (-306.793) (-302.951) (-305.501) [-305.996] * [-303.143] (-304.759) (-303.981) (-304.346) -- 0:00:50
229500 -- [-304.255] (-302.860) (-309.487) (-303.879) * [-302.331] (-303.020) (-303.340) (-302.075) -- 0:00:50
230000 -- (-306.287) (-304.025) [-306.194] (-303.977) * (-303.933) (-305.241) (-303.138) [-303.616] -- 0:00:50
Average standard deviation of split frequencies: 0.018273
230500 -- (-305.379) [-302.910] (-303.431) (-303.828) * (-303.182) (-307.251) (-304.521) [-303.715] -- 0:00:50
231000 -- (-304.979) [-303.517] (-304.507) (-305.901) * [-303.420] (-307.360) (-303.563) (-306.277) -- 0:00:49
231500 -- (-309.318) [-302.927] (-305.948) (-303.487) * (-302.296) [-306.618] (-303.245) (-305.263) -- 0:00:49
232000 -- [-305.427] (-304.575) (-303.240) (-304.649) * (-302.532) [-303.335] (-304.300) (-302.296) -- 0:00:49
232500 -- (-306.665) (-304.426) (-306.265) [-302.541] * (-302.604) (-304.995) (-304.869) [-302.546] -- 0:00:49
233000 -- [-304.436] (-304.751) (-305.755) (-305.231) * (-303.064) [-304.623] (-303.559) (-305.549) -- 0:00:49
233500 -- (-303.924) (-302.714) [-304.868] (-303.936) * [-306.884] (-303.641) (-305.720) (-307.437) -- 0:00:49
234000 -- [-304.573] (-302.623) (-304.538) (-304.132) * (-302.827) (-305.657) [-306.361] (-302.594) -- 0:00:49
234500 -- (-304.871) (-304.616) (-306.010) [-303.607] * (-303.197) (-303.255) (-304.335) [-304.894] -- 0:00:48
235000 -- (-302.140) [-305.962] (-308.545) (-304.268) * (-309.509) [-307.783] (-304.782) (-303.746) -- 0:00:52
Average standard deviation of split frequencies: 0.017977
235500 -- (-305.864) (-302.813) [-307.129] (-306.927) * (-305.849) (-305.829) (-307.309) [-303.816] -- 0:00:51
236000 -- [-303.059] (-304.014) (-303.500) (-303.640) * (-302.921) (-303.208) (-305.928) [-301.920] -- 0:00:51
236500 -- (-308.101) [-303.468] (-302.374) (-304.761) * (-303.091) [-305.276] (-302.949) (-302.582) -- 0:00:51
237000 -- (-306.448) (-303.837) [-303.725] (-303.052) * (-304.851) (-303.383) [-304.107] (-304.030) -- 0:00:51
237500 -- (-304.975) [-305.490] (-305.190) (-302.605) * (-310.164) (-306.347) [-305.338] (-304.107) -- 0:00:51
238000 -- (-304.542) (-302.946) (-306.367) [-301.992] * (-303.488) (-306.448) (-304.962) [-303.776] -- 0:00:51
238500 -- [-304.641] (-305.124) (-306.774) (-302.759) * (-305.361) (-305.294) [-303.210] (-303.169) -- 0:00:51
239000 -- (-306.249) (-303.186) (-303.147) [-303.902] * (-303.957) [-305.501] (-304.208) (-307.322) -- 0:00:50
239500 -- (-304.068) (-303.895) [-303.606] (-302.653) * (-306.448) (-304.026) [-301.982] (-303.392) -- 0:00:50
240000 -- (-302.661) (-302.824) [-304.754] (-306.237) * [-305.788] (-304.051) (-303.525) (-304.375) -- 0:00:50
Average standard deviation of split frequencies: 0.018064
240500 -- [-303.514] (-304.671) (-305.589) (-304.356) * (-305.038) (-304.003) [-305.908] (-303.490) -- 0:00:50
241000 -- (-305.421) (-307.513) (-307.018) [-303.490] * (-304.089) [-304.582] (-305.575) (-308.415) -- 0:00:50
241500 -- (-304.938) (-307.821) [-304.831] (-304.890) * [-303.270] (-305.916) (-302.698) (-303.658) -- 0:00:50
242000 -- (-306.569) (-304.402) (-306.176) [-303.755] * (-305.741) [-304.948] (-306.430) (-303.734) -- 0:00:50
242500 -- (-303.373) (-304.448) (-303.416) [-307.233] * (-304.974) (-305.677) (-310.294) [-306.227] -- 0:00:49
243000 -- (-306.577) [-303.699] (-302.719) (-303.999) * (-304.126) (-309.163) (-303.540) [-303.552] -- 0:00:49
243500 -- [-303.809] (-303.972) (-303.818) (-304.976) * (-305.343) (-303.247) (-306.166) [-303.362] -- 0:00:49
244000 -- (-305.355) (-306.445) (-303.691) [-305.120] * (-307.318) (-306.301) (-306.359) [-302.890] -- 0:00:49
244500 -- (-303.973) (-305.068) [-306.056] (-303.286) * (-305.237) [-304.704] (-310.638) (-306.216) -- 0:00:49
245000 -- [-305.985] (-305.294) (-302.635) (-301.842) * (-304.616) [-303.372] (-306.356) (-305.802) -- 0:00:49
Average standard deviation of split frequencies: 0.017852
245500 -- (-307.903) (-303.812) [-302.361] (-302.311) * (-307.450) (-304.557) [-305.393] (-302.798) -- 0:00:49
246000 -- [-305.448] (-304.522) (-302.838) (-302.360) * (-304.076) (-303.046) (-302.485) [-305.454] -- 0:00:49
246500 -- (-303.912) (-308.298) [-303.148] (-304.315) * (-304.455) (-303.006) (-304.014) [-305.698] -- 0:00:48
247000 -- (-304.472) [-306.347] (-303.197) (-305.462) * (-303.991) (-305.068) (-303.099) [-305.030] -- 0:00:48
247500 -- [-303.326] (-302.896) (-304.275) (-304.337) * (-303.911) (-305.480) (-304.707) [-304.467] -- 0:00:48
248000 -- (-304.378) [-305.421] (-304.597) (-303.766) * (-306.370) (-302.310) [-302.621] (-305.589) -- 0:00:48
248500 -- (-303.549) (-305.931) [-302.696] (-306.790) * (-308.219) [-304.932] (-302.655) (-304.219) -- 0:00:48
249000 -- (-303.063) [-306.953] (-306.107) (-305.411) * (-305.746) (-302.892) [-310.353] (-305.735) -- 0:00:48
249500 -- [-305.998] (-304.612) (-307.551) (-304.431) * (-307.454) (-302.056) [-304.273] (-305.155) -- 0:00:48
250000 -- (-305.880) [-304.903] (-307.289) (-304.271) * (-305.883) (-306.511) [-302.028] (-303.944) -- 0:00:51
Average standard deviation of split frequencies: 0.017618
250500 -- (-305.470) (-306.084) (-308.484) [-305.420] * [-302.827] (-303.210) (-304.157) (-302.747) -- 0:00:50
251000 -- (-305.566) (-303.242) (-309.466) [-306.493] * [-304.335] (-304.622) (-307.926) (-307.730) -- 0:00:50
251500 -- (-303.499) [-305.464] (-307.136) (-305.477) * (-303.608) [-302.811] (-305.021) (-303.317) -- 0:00:50
252000 -- (-305.179) [-305.557] (-314.047) (-307.800) * [-303.272] (-303.193) (-307.954) (-302.425) -- 0:00:50
252500 -- [-303.227] (-305.519) (-305.064) (-311.776) * (-306.321) [-304.302] (-302.250) (-308.758) -- 0:00:50
253000 -- (-306.366) (-304.856) [-304.176] (-309.513) * (-306.442) (-304.301) (-302.336) [-302.556] -- 0:00:50
253500 -- (-305.152) (-305.174) (-304.180) [-303.384] * (-303.471) (-305.685) (-306.577) [-304.550] -- 0:00:50
254000 -- (-302.618) [-304.447] (-306.742) (-305.082) * [-303.901] (-305.669) (-304.343) (-307.873) -- 0:00:49
254500 -- (-305.828) [-304.563] (-302.625) (-303.489) * [-306.865] (-303.205) (-304.328) (-309.198) -- 0:00:49
255000 -- (-305.097) (-306.960) (-302.056) [-305.264] * (-303.819) [-303.978] (-305.853) (-305.954) -- 0:00:49
Average standard deviation of split frequencies: 0.016368
255500 -- [-304.690] (-306.089) (-304.835) (-304.077) * (-302.701) (-304.587) (-304.612) [-304.863] -- 0:00:49
256000 -- (-303.071) [-307.349] (-305.720) (-303.702) * [-304.909] (-303.973) (-304.526) (-305.352) -- 0:00:49
256500 -- (-306.398) [-306.409] (-303.141) (-303.727) * (-307.224) (-304.359) [-304.040] (-306.097) -- 0:00:49
257000 -- (-303.797) (-304.819) (-304.146) [-305.195] * (-302.419) (-302.923) (-305.845) [-306.284] -- 0:00:49
257500 -- (-305.221) (-303.415) (-303.471) [-304.823] * (-304.343) (-306.061) [-306.020] (-306.438) -- 0:00:49
258000 -- (-304.980) (-307.040) [-305.193] (-302.611) * (-303.586) [-308.028] (-305.063) (-304.993) -- 0:00:48
258500 -- (-302.407) [-302.500] (-303.276) (-303.901) * (-306.394) [-303.560] (-303.892) (-304.716) -- 0:00:48
259000 -- (-303.570) [-305.220] (-302.854) (-303.755) * (-304.784) [-303.297] (-303.317) (-305.283) -- 0:00:48
259500 -- (-302.579) (-304.330) (-302.759) [-303.664] * (-302.048) (-304.636) [-302.230] (-303.500) -- 0:00:48
260000 -- (-301.879) (-303.229) (-306.080) [-304.212] * (-302.257) (-303.318) (-302.508) [-302.793] -- 0:00:48
Average standard deviation of split frequencies: 0.018185
260500 -- (-303.494) (-303.540) (-306.824) [-303.274] * (-302.732) (-307.213) (-303.532) [-302.357] -- 0:00:48
261000 -- (-303.577) (-303.305) (-304.027) [-307.771] * (-302.495) (-304.636) (-303.286) [-304.514] -- 0:00:48
261500 -- (-302.151) [-302.811] (-307.999) (-304.255) * (-303.308) [-302.233] (-305.198) (-303.663) -- 0:00:48
262000 -- [-304.437] (-304.078) (-307.192) (-307.815) * [-304.311] (-303.926) (-304.916) (-302.296) -- 0:00:47
262500 -- (-306.019) (-310.856) [-304.353] (-304.614) * [-303.643] (-304.560) (-304.240) (-302.894) -- 0:00:47
263000 -- (-307.842) (-307.600) (-306.709) [-305.783] * (-304.997) [-303.465] (-304.830) (-303.023) -- 0:00:47
263500 -- (-304.470) [-303.082] (-305.625) (-303.855) * [-306.062] (-303.303) (-304.949) (-306.991) -- 0:00:47
264000 -- (-304.901) (-309.703) (-302.701) [-302.603] * (-305.245) [-302.691] (-306.236) (-305.328) -- 0:00:47
264500 -- (-302.980) (-311.083) [-303.406] (-302.504) * (-304.924) (-303.680) (-303.865) [-304.820] -- 0:00:47
265000 -- [-303.737] (-304.326) (-306.462) (-303.601) * (-302.320) (-306.491) [-304.929] (-303.977) -- 0:00:49
Average standard deviation of split frequencies: 0.019494
265500 -- (-302.308) (-306.986) (-306.144) [-304.508] * (-306.474) (-304.114) (-306.066) [-304.671] -- 0:00:49
266000 -- (-303.672) (-305.886) (-304.525) [-303.305] * [-304.951] (-303.764) (-303.304) (-302.504) -- 0:00:49
266500 -- (-306.835) (-303.481) [-305.649] (-305.151) * (-306.505) [-303.497] (-304.560) (-303.862) -- 0:00:49
267000 -- (-306.919) (-305.854) [-303.811] (-308.645) * [-303.079] (-304.513) (-305.894) (-303.710) -- 0:00:49
267500 -- (-303.094) (-307.542) (-307.482) [-303.305] * (-308.966) (-306.065) (-303.210) [-303.202] -- 0:00:49
268000 -- [-305.504] (-304.966) (-304.117) (-304.044) * [-303.904] (-303.884) (-303.184) (-304.198) -- 0:00:49
268500 -- [-307.108] (-304.008) (-304.727) (-303.905) * [-303.408] (-305.209) (-303.524) (-303.272) -- 0:00:49
269000 -- (-303.848) (-303.877) [-304.251] (-303.196) * (-302.921) (-302.822) (-306.838) [-305.587] -- 0:00:48
269500 -- (-305.237) (-302.322) [-303.614] (-308.858) * (-303.992) [-303.184] (-308.043) (-308.265) -- 0:00:48
270000 -- (-307.435) [-303.256] (-309.115) (-307.506) * (-303.559) (-303.601) [-302.792] (-304.739) -- 0:00:48
Average standard deviation of split frequencies: 0.019255
270500 -- [-303.034] (-304.482) (-305.979) (-303.802) * (-303.394) (-305.302) (-304.928) [-302.710] -- 0:00:48
271000 -- (-304.326) (-304.275) (-304.629) [-302.767] * (-303.671) (-308.942) [-302.664] (-302.888) -- 0:00:48
271500 -- (-302.426) (-304.350) (-303.844) [-304.473] * [-302.882] (-303.141) (-304.975) (-303.423) -- 0:00:48
272000 -- (-305.197) [-303.136] (-302.767) (-307.869) * (-304.774) (-304.565) [-303.166] (-304.851) -- 0:00:48
272500 -- (-304.014) (-302.002) [-303.148] (-303.756) * [-307.060] (-302.809) (-303.756) (-305.440) -- 0:00:48
273000 -- [-303.864] (-303.705) (-303.424) (-304.617) * (-303.935) (-303.743) (-303.620) [-302.219] -- 0:00:47
273500 -- (-305.542) [-301.989] (-303.169) (-303.871) * (-306.968) (-305.525) [-302.873] (-304.003) -- 0:00:47
274000 -- (-309.146) (-303.515) [-303.980] (-303.735) * (-310.409) [-304.924] (-303.730) (-303.479) -- 0:00:47
274500 -- (-305.144) (-303.518) (-303.783) [-304.337] * (-305.815) (-304.738) (-304.826) [-303.132] -- 0:00:47
275000 -- (-305.229) [-303.691] (-303.784) (-303.689) * (-302.823) [-305.236] (-303.450) (-303.537) -- 0:00:47
Average standard deviation of split frequencies: 0.018313
275500 -- [-305.134] (-306.904) (-303.456) (-304.046) * (-308.789) (-308.706) [-305.369] (-306.393) -- 0:00:47
276000 -- [-303.042] (-302.776) (-305.350) (-304.821) * [-303.373] (-309.391) (-306.433) (-303.787) -- 0:00:47
276500 -- (-303.456) (-303.878) (-304.172) [-303.837] * [-304.563] (-302.709) (-306.512) (-305.081) -- 0:00:47
277000 -- (-305.087) [-302.908] (-304.908) (-303.535) * (-304.906) (-303.341) [-304.529] (-305.250) -- 0:00:46
277500 -- (-306.387) [-305.375] (-302.260) (-304.849) * [-303.626] (-311.777) (-304.274) (-305.160) -- 0:00:46
278000 -- (-305.584) (-305.647) (-306.553) [-303.421] * [-303.844] (-303.476) (-305.608) (-303.315) -- 0:00:46
278500 -- (-307.212) (-304.841) (-302.287) [-303.095] * (-302.902) (-302.728) (-306.055) [-306.517] -- 0:00:46
279000 -- [-304.131] (-305.006) (-302.168) (-303.664) * [-302.520] (-303.283) (-309.950) (-305.192) -- 0:00:46
279500 -- (-303.439) (-302.734) (-303.719) [-304.214] * (-303.601) [-302.430] (-303.381) (-307.019) -- 0:00:46
280000 -- (-306.020) (-302.704) [-303.541] (-303.260) * (-303.498) (-304.458) (-302.641) [-305.437] -- 0:00:46
Average standard deviation of split frequencies: 0.017822
280500 -- (-304.180) (-305.065) (-302.693) [-303.916] * (-304.952) [-302.719] (-307.452) (-308.326) -- 0:00:48
281000 -- (-305.760) (-303.963) [-302.946] (-304.009) * (-306.825) (-304.933) [-303.217] (-303.626) -- 0:00:48
281500 -- (-309.442) (-303.898) [-303.225] (-306.019) * (-305.523) (-302.428) (-303.203) [-303.977] -- 0:00:48
282000 -- [-305.717] (-303.549) (-304.201) (-303.356) * [-304.969] (-302.393) (-302.706) (-305.795) -- 0:00:48
282500 -- (-304.803) (-304.006) (-308.166) [-306.931] * (-304.137) [-303.072] (-302.445) (-304.682) -- 0:00:48
283000 -- [-306.258] (-303.557) (-302.512) (-302.424) * (-304.000) (-305.320) (-302.834) [-306.227] -- 0:00:48
283500 -- (-303.613) (-302.744) [-303.843] (-305.044) * (-304.697) (-306.860) (-306.054) [-308.962] -- 0:00:48
284000 -- (-302.387) (-305.231) (-307.341) [-303.336] * (-305.310) (-308.742) (-305.140) [-303.654] -- 0:00:47
284500 -- (-302.884) (-304.874) (-302.813) [-304.394] * [-302.971] (-304.825) (-303.263) (-304.481) -- 0:00:47
285000 -- (-304.960) (-305.581) [-304.403] (-306.451) * (-303.416) (-305.040) (-304.263) [-304.703] -- 0:00:47
Average standard deviation of split frequencies: 0.017307
285500 -- (-303.402) [-305.937] (-306.298) (-304.164) * (-305.177) (-302.964) [-302.993] (-305.758) -- 0:00:47
286000 -- (-302.242) (-305.772) (-305.497) [-303.402] * (-305.439) (-303.713) [-304.356] (-305.253) -- 0:00:47
286500 -- (-305.394) [-306.130] (-304.119) (-303.801) * [-305.830] (-304.781) (-302.963) (-304.398) -- 0:00:47
287000 -- (-302.915) [-307.532] (-302.450) (-305.232) * (-302.529) [-306.018] (-305.182) (-305.305) -- 0:00:47
287500 -- (-304.476) (-304.081) [-303.623] (-303.295) * [-304.318] (-305.663) (-306.566) (-303.029) -- 0:00:47
288000 -- [-304.123] (-305.103) (-304.216) (-306.316) * (-304.086) (-303.914) (-312.565) [-304.062] -- 0:00:46
288500 -- (-304.872) [-304.102] (-303.833) (-302.285) * [-303.690] (-306.625) (-304.793) (-302.442) -- 0:00:46
289000 -- (-303.617) [-302.487] (-303.512) (-306.788) * (-304.742) (-304.368) (-306.648) [-303.394] -- 0:00:46
289500 -- (-305.149) [-303.473] (-303.548) (-303.511) * (-305.553) (-305.625) [-305.885] (-303.377) -- 0:00:46
290000 -- [-303.617] (-304.057) (-302.061) (-305.020) * (-306.204) (-303.540) (-305.247) [-303.700] -- 0:00:46
Average standard deviation of split frequencies: 0.016038
290500 -- [-302.752] (-304.325) (-302.129) (-306.728) * (-305.764) (-302.840) (-302.565) [-302.568] -- 0:00:46
291000 -- [-302.905] (-304.619) (-301.983) (-302.432) * [-309.029] (-305.581) (-304.786) (-302.515) -- 0:00:46
291500 -- [-303.544] (-303.880) (-303.333) (-302.646) * (-304.051) (-308.375) (-305.085) [-307.331] -- 0:00:46
292000 -- (-302.321) [-304.743] (-303.364) (-304.146) * [-304.617] (-303.854) (-303.146) (-305.220) -- 0:00:46
292500 -- [-307.735] (-304.671) (-305.053) (-305.279) * (-304.044) (-305.581) (-303.919) [-305.285] -- 0:00:45
293000 -- (-302.068) [-304.035] (-304.110) (-305.382) * [-302.975] (-305.522) (-303.641) (-304.590) -- 0:00:45
293500 -- [-306.216] (-304.014) (-303.471) (-302.857) * (-305.620) (-306.228) (-303.487) [-302.055] -- 0:00:45
294000 -- (-305.440) (-305.630) (-305.903) [-304.940] * [-305.495] (-303.716) (-304.090) (-306.202) -- 0:00:45
294500 -- [-303.526] (-303.803) (-303.571) (-307.673) * (-303.552) (-305.070) [-303.520] (-304.439) -- 0:00:45
295000 -- (-302.480) (-307.236) (-305.619) [-306.190] * (-307.640) (-304.911) (-307.299) [-302.107] -- 0:00:45
Average standard deviation of split frequencies: 0.016191
295500 -- (-305.609) (-304.502) (-305.564) [-304.036] * (-303.598) (-303.628) (-303.400) [-304.321] -- 0:00:45
296000 -- (-302.304) (-304.620) (-302.266) [-304.789] * (-303.147) (-303.117) [-304.805] (-303.527) -- 0:00:45
296500 -- (-303.715) (-307.750) [-303.973] (-303.264) * (-306.393) [-304.981] (-303.483) (-302.704) -- 0:00:45
297000 -- [-305.565] (-303.678) (-306.273) (-302.878) * (-304.403) [-302.446] (-305.594) (-308.874) -- 0:00:44
297500 -- [-306.255] (-305.370) (-306.286) (-303.110) * (-304.820) [-302.803] (-304.816) (-304.236) -- 0:00:44
298000 -- (-304.487) (-304.262) (-306.153) [-305.619] * (-304.191) (-303.636) (-305.924) [-307.597] -- 0:00:47
298500 -- (-302.988) (-305.247) (-305.123) [-304.688] * (-303.255) (-302.738) [-304.321] (-303.194) -- 0:00:47
299000 -- [-302.038] (-303.376) (-305.945) (-310.686) * (-302.751) [-303.871] (-310.641) (-306.181) -- 0:00:46
299500 -- (-303.159) (-305.845) [-303.816] (-309.213) * (-305.332) [-302.524] (-306.020) (-306.156) -- 0:00:46
300000 -- (-303.864) [-302.897] (-302.561) (-303.760) * (-304.823) (-302.225) [-303.880] (-303.447) -- 0:00:46
Average standard deviation of split frequencies: 0.016724
300500 -- (-303.857) (-304.008) (-303.081) [-302.952] * (-303.876) (-304.902) [-307.406] (-305.830) -- 0:00:46
301000 -- (-304.511) [-302.166] (-305.126) (-305.388) * (-304.359) (-304.453) [-304.104] (-302.352) -- 0:00:46
301500 -- (-307.992) (-302.661) [-303.490] (-307.605) * (-304.846) [-304.145] (-305.167) (-303.732) -- 0:00:46
302000 -- (-303.298) (-306.317) (-303.151) [-304.154] * [-307.453] (-303.827) (-305.149) (-303.596) -- 0:00:46
302500 -- [-303.352] (-304.161) (-302.708) (-307.067) * (-304.945) (-305.727) [-303.657] (-302.953) -- 0:00:46
303000 -- (-303.015) [-301.965] (-303.008) (-306.360) * [-303.644] (-306.809) (-305.657) (-304.239) -- 0:00:46
303500 -- (-303.145) (-303.874) [-305.528] (-306.128) * (-303.974) [-304.910] (-305.926) (-302.759) -- 0:00:45
304000 -- [-302.862] (-304.139) (-303.385) (-303.515) * (-306.054) [-303.856] (-304.032) (-303.015) -- 0:00:45
304500 -- [-303.862] (-304.244) (-305.129) (-304.163) * (-304.032) (-302.601) [-302.823] (-302.887) -- 0:00:45
305000 -- (-304.776) (-302.849) [-307.281] (-306.623) * [-303.549] (-302.832) (-303.950) (-302.440) -- 0:00:45
Average standard deviation of split frequencies: 0.018230
305500 -- (-304.838) [-302.737] (-303.705) (-304.422) * (-305.939) (-303.122) [-303.278] (-305.920) -- 0:00:45
306000 -- [-303.418] (-303.371) (-305.110) (-305.429) * [-305.740] (-306.188) (-304.507) (-304.423) -- 0:00:45
306500 -- (-306.745) (-305.536) [-302.274] (-303.950) * (-303.862) (-305.801) (-304.462) [-303.496] -- 0:00:45
307000 -- (-306.505) (-304.713) (-305.742) [-303.718] * (-306.082) (-304.154) (-303.287) [-305.601] -- 0:00:45
307500 -- [-304.484] (-305.494) (-310.652) (-309.230) * (-304.348) (-305.738) [-305.071] (-306.674) -- 0:00:45
308000 -- (-304.639) (-304.171) (-303.872) [-304.215] * (-306.601) (-305.003) [-303.130] (-306.300) -- 0:00:44
308500 -- (-303.336) (-309.006) [-304.892] (-302.636) * (-303.833) (-305.190) (-308.106) [-304.002] -- 0:00:44
309000 -- [-302.708] (-302.907) (-309.547) (-302.726) * (-305.178) (-305.164) (-303.033) [-304.881] -- 0:00:44
309500 -- (-305.832) (-303.558) [-302.358] (-306.264) * (-306.843) (-310.981) [-305.278] (-303.600) -- 0:00:44
310000 -- (-303.872) (-304.428) (-306.423) [-303.187] * (-305.899) (-309.635) (-302.868) [-302.064] -- 0:00:44
Average standard deviation of split frequencies: 0.017197
310500 -- (-304.480) (-308.005) (-304.484) [-303.485] * (-306.934) (-305.969) [-302.159] (-303.255) -- 0:00:44
311000 -- (-302.551) [-307.917] (-303.446) (-302.947) * (-303.527) (-302.765) [-302.166] (-304.254) -- 0:00:44
311500 -- (-302.511) (-303.703) (-303.197) [-302.838] * [-304.715] (-304.727) (-302.201) (-309.281) -- 0:00:44
312000 -- (-303.099) (-305.345) (-304.020) [-302.571] * (-305.627) (-305.373) (-304.751) [-304.359] -- 0:00:44
312500 -- (-305.001) (-304.205) [-303.326] (-303.708) * [-307.481] (-303.214) (-303.542) (-303.313) -- 0:00:44
313000 -- [-303.799] (-302.899) (-304.003) (-305.022) * (-302.294) (-308.518) [-303.431] (-303.387) -- 0:00:43
313500 -- [-303.942] (-303.974) (-303.416) (-305.277) * (-302.777) [-302.464] (-304.763) (-303.045) -- 0:00:43
314000 -- [-302.820] (-305.746) (-302.367) (-303.319) * (-305.567) (-305.460) (-307.624) [-303.775] -- 0:00:43
314500 -- [-303.933] (-304.244) (-308.608) (-303.220) * [-302.807] (-304.339) (-302.904) (-305.416) -- 0:00:43
315000 -- (-308.803) (-304.662) (-303.366) [-302.448] * [-303.369] (-303.181) (-307.322) (-304.064) -- 0:00:45
Average standard deviation of split frequencies: 0.017156
315500 -- (-307.682) [-305.192] (-306.241) (-307.195) * (-303.972) (-305.660) [-304.055] (-307.299) -- 0:00:45
316000 -- (-304.903) (-306.331) (-303.943) [-308.300] * [-302.938] (-304.881) (-303.139) (-303.842) -- 0:00:45
316500 -- (-303.796) (-302.423) (-303.335) [-302.458] * (-305.131) [-304.768] (-304.078) (-305.184) -- 0:00:45
317000 -- (-303.776) (-308.541) [-302.825] (-302.870) * (-304.771) (-305.435) (-303.224) [-306.554] -- 0:00:45
317500 -- [-303.172] (-305.076) (-303.936) (-303.886) * (-303.809) (-308.220) (-305.305) [-302.667] -- 0:00:45
318000 -- (-306.319) (-303.237) (-303.737) [-303.890] * (-306.150) (-303.064) [-304.988] (-302.493) -- 0:00:45
318500 -- (-306.503) [-303.252] (-303.010) (-305.034) * (-305.568) [-303.689] (-303.687) (-307.470) -- 0:00:44
319000 -- (-304.885) (-305.080) (-303.067) [-304.396] * (-302.639) [-303.245] (-302.837) (-303.218) -- 0:00:44
319500 -- (-304.664) [-302.947] (-302.107) (-302.554) * (-303.462) (-307.415) [-304.018] (-303.079) -- 0:00:44
320000 -- (-306.090) [-302.995] (-304.977) (-302.326) * (-304.817) (-304.299) (-307.903) [-305.459] -- 0:00:44
Average standard deviation of split frequencies: 0.016253
320500 -- [-302.627] (-302.270) (-302.386) (-304.148) * (-303.637) (-304.824) (-305.652) [-305.671] -- 0:00:44
321000 -- (-301.856) (-302.827) [-303.451] (-306.929) * (-305.841) (-302.586) (-305.446) [-304.908] -- 0:00:44
321500 -- (-305.034) [-308.720] (-302.794) (-306.146) * (-303.456) [-302.656] (-306.305) (-306.637) -- 0:00:44
322000 -- (-306.422) (-306.205) [-302.503] (-305.024) * (-303.935) (-304.526) (-303.177) [-304.813] -- 0:00:44
322500 -- (-305.041) (-305.028) [-303.179] (-307.710) * (-303.688) [-304.577] (-307.103) (-307.002) -- 0:00:44
323000 -- (-303.788) (-306.433) [-307.724] (-304.523) * (-303.103) (-303.369) [-304.112] (-306.620) -- 0:00:44
323500 -- (-302.628) (-302.520) (-306.041) [-303.843] * (-302.142) (-305.485) [-306.120] (-309.620) -- 0:00:43
324000 -- [-303.997] (-309.518) (-305.827) (-303.165) * (-303.157) (-307.836) [-303.384] (-304.801) -- 0:00:43
324500 -- [-304.619] (-306.016) (-303.340) (-303.639) * (-302.551) (-306.013) (-303.366) [-302.694] -- 0:00:43
325000 -- (-304.077) [-308.320] (-304.859) (-308.449) * [-302.890] (-310.766) (-308.853) (-303.608) -- 0:00:43
Average standard deviation of split frequencies: 0.015424
325500 -- (-302.297) (-304.824) (-303.840) [-303.933] * (-303.103) (-303.632) [-302.129] (-306.844) -- 0:00:43
326000 -- (-302.641) [-303.637] (-304.661) (-302.855) * [-303.569] (-306.851) (-306.386) (-302.970) -- 0:00:43
326500 -- [-304.493] (-304.417) (-305.066) (-304.037) * [-304.970] (-306.907) (-303.881) (-305.221) -- 0:00:43
327000 -- (-303.757) (-303.165) [-306.642] (-305.366) * (-305.182) (-307.408) [-302.889] (-306.972) -- 0:00:43
327500 -- (-303.563) (-306.123) (-303.940) [-304.581] * [-304.489] (-303.468) (-303.399) (-302.886) -- 0:00:43
328000 -- (-303.237) [-303.295] (-303.649) (-304.163) * (-304.887) [-303.396] (-305.728) (-303.170) -- 0:00:43
328500 -- [-305.713] (-302.505) (-304.103) (-303.456) * (-305.575) [-307.459] (-303.049) (-303.558) -- 0:00:42
329000 -- [-303.891] (-303.393) (-304.001) (-303.938) * (-305.972) [-303.572] (-303.603) (-302.938) -- 0:00:42
329500 -- (-305.238) (-303.202) (-306.770) [-304.365] * (-303.765) (-305.073) (-302.638) [-302.825] -- 0:00:42
330000 -- [-303.510] (-304.290) (-305.226) (-305.072) * (-306.397) [-303.513] (-303.544) (-303.134) -- 0:00:42
Average standard deviation of split frequencies: 0.015603
330500 -- [-304.365] (-305.211) (-303.222) (-302.775) * [-303.757] (-303.811) (-305.817) (-304.886) -- 0:00:42
331000 -- (-304.162) (-304.064) (-304.034) [-307.860] * (-304.257) (-306.497) [-304.363] (-302.934) -- 0:00:42
331500 -- (-303.206) (-305.893) [-303.512] (-303.893) * (-305.082) (-302.854) (-306.623) [-306.031] -- 0:00:42
332000 -- (-306.237) (-305.369) [-303.851] (-306.017) * [-303.991] (-302.798) (-303.290) (-307.623) -- 0:00:44
332500 -- [-305.657] (-302.912) (-304.789) (-303.583) * (-302.785) (-303.713) [-302.474] (-308.023) -- 0:00:44
333000 -- [-304.185] (-302.624) (-302.865) (-305.379) * [-302.449] (-303.985) (-304.789) (-304.215) -- 0:00:44
333500 -- [-304.599] (-303.566) (-304.862) (-303.200) * (-303.484) (-302.296) (-305.226) [-302.972] -- 0:00:43
334000 -- (-303.204) (-303.957) (-303.676) [-304.370] * (-303.279) [-303.844] (-304.761) (-303.596) -- 0:00:43
334500 -- (-303.587) (-303.507) (-307.008) [-302.794] * (-304.563) (-304.241) (-303.980) [-303.544] -- 0:00:43
335000 -- (-304.767) [-302.771] (-303.143) (-302.951) * (-306.275) (-303.368) [-302.677] (-305.657) -- 0:00:43
Average standard deviation of split frequencies: 0.014809
335500 -- (-304.598) (-304.651) [-303.334] (-304.002) * (-306.902) (-303.703) (-305.813) [-302.053] -- 0:00:43
336000 -- (-304.124) (-304.861) (-303.390) [-305.170] * [-304.637] (-302.349) (-305.355) (-307.495) -- 0:00:43
336500 -- [-305.349] (-302.821) (-303.237) (-303.045) * (-305.440) [-304.694] (-302.462) (-305.163) -- 0:00:43
337000 -- (-303.607) (-311.050) [-304.812] (-303.788) * [-304.045] (-307.583) (-302.278) (-306.750) -- 0:00:43
337500 -- [-305.514] (-307.872) (-305.718) (-303.576) * [-303.054] (-305.036) (-303.301) (-304.154) -- 0:00:43
338000 -- (-307.150) (-308.874) [-302.973] (-302.706) * [-307.592] (-306.083) (-302.061) (-303.428) -- 0:00:43
338500 -- (-309.834) [-308.176] (-304.432) (-302.024) * (-304.905) (-302.302) [-302.084] (-304.089) -- 0:00:42
339000 -- (-304.654) (-305.988) (-305.221) [-304.565] * (-305.865) (-306.346) [-303.802] (-305.063) -- 0:00:42
339500 -- (-311.070) (-304.128) [-302.713] (-307.222) * (-303.764) [-308.229] (-303.843) (-305.217) -- 0:00:42
340000 -- (-304.148) (-304.856) (-303.055) [-308.130] * (-303.478) (-304.828) [-304.772] (-303.859) -- 0:00:42
Average standard deviation of split frequencies: 0.014001
340500 -- (-306.890) (-304.825) [-304.215] (-304.262) * [-302.287] (-306.351) (-307.167) (-305.727) -- 0:00:42
341000 -- [-310.254] (-305.838) (-305.219) (-305.862) * [-304.509] (-307.677) (-303.357) (-305.951) -- 0:00:42
341500 -- [-303.787] (-309.119) (-306.646) (-304.631) * (-305.719) (-308.026) [-302.163] (-302.604) -- 0:00:42
342000 -- [-307.436] (-304.692) (-305.348) (-302.588) * (-303.254) [-305.320] (-306.019) (-303.723) -- 0:00:42
342500 -- (-307.070) [-302.238] (-303.403) (-306.868) * [-303.419] (-306.411) (-304.611) (-302.603) -- 0:00:42
343000 -- (-302.884) (-303.268) (-304.894) [-303.327] * (-305.876) (-303.085) [-307.195] (-302.489) -- 0:00:42
343500 -- [-303.082] (-304.761) (-305.794) (-303.736) * (-304.762) (-303.037) [-302.651] (-302.337) -- 0:00:42
344000 -- [-302.394] (-302.760) (-303.534) (-307.922) * (-303.071) [-305.205] (-303.636) (-303.057) -- 0:00:41
344500 -- (-302.773) (-302.515) (-302.777) [-307.470] * (-307.680) (-305.601) (-303.393) [-309.118] -- 0:00:41
345000 -- [-303.352] (-305.822) (-304.076) (-304.128) * [-303.156] (-304.601) (-303.080) (-303.550) -- 0:00:41
Average standard deviation of split frequencies: 0.014457
345500 -- (-302.653) (-306.135) (-303.027) [-302.477] * (-305.527) (-306.155) (-305.117) [-303.419] -- 0:00:41
346000 -- (-302.880) [-303.908] (-304.624) (-308.936) * (-302.637) [-304.356] (-303.999) (-309.682) -- 0:00:41
346500 -- (-303.146) (-306.240) (-305.249) [-302.562] * (-303.006) [-305.246] (-303.711) (-307.318) -- 0:00:41
347000 -- (-306.550) (-302.911) (-307.036) [-303.876] * (-302.818) (-306.975) [-304.173] (-306.610) -- 0:00:41
347500 -- (-306.082) [-302.796] (-303.771) (-306.905) * (-301.858) (-303.611) (-303.959) [-303.797] -- 0:00:41
348000 -- (-304.892) [-303.282] (-305.533) (-305.312) * (-305.522) (-304.990) (-303.433) [-305.374] -- 0:00:41
348500 -- (-304.261) (-304.116) (-307.927) [-303.229] * (-303.129) (-303.559) [-306.473] (-304.228) -- 0:00:41
349000 -- (-305.340) [-305.840] (-305.766) (-303.183) * (-304.594) (-305.832) (-302.856) [-307.836] -- 0:00:42
349500 -- (-307.631) (-304.030) [-305.661] (-305.431) * (-304.831) (-304.063) (-304.973) [-308.254] -- 0:00:42
350000 -- (-302.055) (-304.519) [-302.121] (-305.406) * (-309.191) [-303.838] (-304.589) (-302.118) -- 0:00:42
Average standard deviation of split frequencies: 0.014190
350500 -- (-302.837) [-304.278] (-302.122) (-303.316) * (-306.035) (-302.974) [-302.174] (-305.373) -- 0:00:42
351000 -- (-302.418) [-306.212] (-303.672) (-302.780) * (-303.762) (-302.552) (-302.280) [-305.981] -- 0:00:42
351500 -- (-303.597) (-303.849) [-304.852] (-302.726) * (-303.403) (-303.851) (-302.406) [-304.477] -- 0:00:42
352000 -- (-303.257) (-303.094) [-305.537] (-306.339) * (-302.558) (-302.977) [-304.157] (-304.409) -- 0:00:42
352500 -- (-302.766) (-305.911) [-304.083] (-302.342) * (-313.443) (-306.623) [-304.729] (-306.573) -- 0:00:42
353000 -- (-303.923) (-304.521) (-306.005) [-306.141] * (-305.758) [-302.147] (-304.242) (-310.605) -- 0:00:42
353500 -- (-304.540) (-304.221) [-306.632] (-307.003) * [-305.474] (-304.740) (-303.612) (-305.434) -- 0:00:42
354000 -- (-303.399) [-303.358] (-303.313) (-308.521) * (-305.375) (-306.553) [-302.617] (-304.801) -- 0:00:41
354500 -- [-305.269] (-306.581) (-304.860) (-302.376) * [-303.649] (-302.407) (-305.977) (-306.547) -- 0:00:41
355000 -- (-302.848) (-305.057) (-304.527) [-302.511] * (-304.753) [-305.938] (-304.835) (-308.944) -- 0:00:41
Average standard deviation of split frequencies: 0.014198
355500 -- (-306.621) [-307.232] (-305.754) (-305.017) * (-303.160) [-303.872] (-302.731) (-304.389) -- 0:00:41
356000 -- (-302.172) (-308.496) [-305.853] (-303.746) * (-304.325) [-302.584] (-303.970) (-309.233) -- 0:00:41
356500 -- (-301.957) [-304.706] (-306.895) (-303.750) * (-303.638) [-303.413] (-304.554) (-310.368) -- 0:00:41
357000 -- (-303.605) [-305.881] (-302.225) (-302.158) * [-303.405] (-303.567) (-304.437) (-307.693) -- 0:00:41
357500 -- [-303.462] (-304.684) (-304.382) (-310.483) * [-303.732] (-307.267) (-304.122) (-306.514) -- 0:00:41
358000 -- (-302.836) (-303.426) (-303.193) [-304.980] * [-302.170] (-305.659) (-303.251) (-304.078) -- 0:00:41
358500 -- [-304.058] (-304.173) (-303.329) (-305.864) * (-304.628) (-303.442) [-305.203] (-308.220) -- 0:00:41
359000 -- (-303.815) [-303.656] (-306.717) (-304.614) * (-306.460) (-303.110) (-304.052) [-303.611] -- 0:00:41
359500 -- (-304.263) (-302.885) [-303.838] (-305.614) * (-304.067) (-303.846) [-302.963] (-303.497) -- 0:00:40
360000 -- (-307.450) [-303.129] (-304.748) (-304.424) * [-305.731] (-305.737) (-303.606) (-303.523) -- 0:00:40
Average standard deviation of split frequencies: 0.013685
360500 -- [-302.836] (-305.797) (-303.440) (-305.927) * (-303.046) [-304.918] (-304.275) (-302.464) -- 0:00:40
361000 -- [-307.507] (-304.583) (-303.982) (-305.722) * (-308.818) (-303.545) [-303.120] (-303.923) -- 0:00:40
361500 -- [-303.595] (-302.259) (-308.176) (-302.886) * (-308.985) (-313.052) [-302.725] (-305.382) -- 0:00:40
362000 -- [-306.688] (-303.062) (-312.004) (-303.588) * (-305.235) [-302.867] (-303.643) (-305.699) -- 0:00:40
362500 -- (-302.126) (-305.806) (-309.922) [-303.608] * (-302.673) (-303.686) [-305.367] (-304.055) -- 0:00:40
363000 -- (-305.200) (-304.807) [-304.064] (-303.981) * (-304.951) [-303.158] (-305.120) (-303.387) -- 0:00:40
363500 -- (-303.240) (-305.629) (-303.238) [-304.565] * [-305.436] (-302.310) (-304.555) (-306.156) -- 0:00:40
364000 -- (-304.351) (-305.237) (-305.695) [-302.806] * (-303.615) (-307.713) (-302.636) [-303.469] -- 0:00:40
364500 -- (-302.957) [-303.672] (-305.809) (-311.314) * [-304.032] (-306.729) (-303.475) (-305.178) -- 0:00:40
365000 -- (-306.579) (-303.656) [-305.015] (-305.084) * [-304.642] (-305.096) (-305.063) (-309.243) -- 0:00:40
Average standard deviation of split frequencies: 0.013638
365500 -- (-302.835) (-304.374) [-304.478] (-305.805) * (-304.096) (-302.968) [-303.291] (-302.422) -- 0:00:39
366000 -- (-303.352) [-304.883] (-307.967) (-302.957) * (-304.869) (-305.526) (-303.666) [-302.949] -- 0:00:39
366500 -- (-307.750) (-304.914) (-303.130) [-301.962] * (-304.114) [-307.872] (-307.269) (-303.460) -- 0:00:41
367000 -- (-307.093) [-303.343] (-302.895) (-305.901) * (-308.188) (-303.995) [-306.876] (-303.518) -- 0:00:41
367500 -- (-303.871) (-304.093) [-303.432] (-307.113) * (-308.446) [-303.349] (-304.905) (-303.708) -- 0:00:41
368000 -- (-304.199) (-303.475) (-303.719) [-304.073] * (-310.920) (-305.327) [-302.834] (-303.860) -- 0:00:41
368500 -- (-307.159) (-308.342) (-302.146) [-305.219] * (-311.740) (-303.050) [-308.001] (-304.569) -- 0:00:41
369000 -- (-305.171) (-304.526) [-303.654] (-302.935) * (-305.716) (-306.630) [-305.389] (-303.599) -- 0:00:41
369500 -- (-306.645) (-309.476) [-302.040] (-304.648) * (-305.488) (-303.118) [-304.002] (-303.872) -- 0:00:40
370000 -- (-307.007) (-301.988) [-304.356] (-303.216) * [-302.844] (-302.107) (-305.447) (-302.972) -- 0:00:40
Average standard deviation of split frequencies: 0.013495
370500 -- (-304.120) [-305.108] (-307.262) (-303.141) * [-305.565] (-301.930) (-303.190) (-303.922) -- 0:00:40
371000 -- (-311.146) (-303.530) (-305.020) [-303.161] * (-303.415) (-305.840) (-302.079) [-308.130] -- 0:00:40
371500 -- (-304.464) (-305.369) (-305.121) [-303.162] * (-303.890) [-305.613] (-302.966) (-307.500) -- 0:00:40
372000 -- (-303.525) (-304.382) [-302.583] (-302.765) * [-303.219] (-304.092) (-303.916) (-305.253) -- 0:00:40
372500 -- (-302.524) [-304.353] (-302.063) (-304.879) * (-304.349) [-305.577] (-305.139) (-302.300) -- 0:00:40
373000 -- (-303.690) (-305.115) [-302.580] (-302.230) * (-303.176) (-305.260) (-304.854) [-303.303] -- 0:00:40
373500 -- (-306.678) (-304.559) [-302.309] (-305.154) * [-306.861] (-308.354) (-303.811) (-303.562) -- 0:00:40
374000 -- (-302.871) (-303.700) (-302.938) [-303.857] * (-303.403) [-306.018] (-304.717) (-308.077) -- 0:00:40
374500 -- (-302.279) (-303.278) (-309.176) [-307.627] * (-305.655) [-303.354] (-302.858) (-303.848) -- 0:00:40
375000 -- [-302.396] (-304.808) (-307.578) (-306.967) * [-305.363] (-305.059) (-308.550) (-305.149) -- 0:00:40
Average standard deviation of split frequencies: 0.014348
375500 -- (-305.107) (-305.008) (-305.160) [-303.572] * (-302.430) (-304.607) (-305.222) [-305.427] -- 0:00:39
376000 -- (-304.400) (-312.988) (-304.364) [-304.491] * (-304.196) (-304.967) [-303.910] (-306.431) -- 0:00:39
376500 -- (-304.143) (-303.310) [-302.944] (-304.990) * (-310.924) (-303.959) [-303.288] (-304.634) -- 0:00:39
377000 -- (-303.652) [-304.987] (-306.738) (-304.488) * (-308.775) [-303.269] (-304.771) (-306.704) -- 0:00:39
377500 -- (-303.062) [-303.812] (-306.558) (-304.429) * [-302.310] (-302.853) (-304.614) (-308.269) -- 0:00:39
378000 -- (-305.513) [-304.034] (-304.057) (-304.595) * [-302.266] (-302.716) (-304.542) (-309.707) -- 0:00:39
378500 -- (-304.914) [-305.913] (-302.708) (-305.483) * (-303.506) (-304.076) (-303.880) [-304.596] -- 0:00:39
379000 -- (-307.591) [-305.309] (-305.352) (-303.531) * [-302.839] (-303.957) (-303.295) (-303.643) -- 0:00:39
379500 -- (-304.948) (-303.287) (-305.204) [-307.008] * [-302.637] (-302.885) (-303.005) (-303.101) -- 0:00:39
380000 -- [-304.265] (-306.784) (-302.554) (-306.998) * [-305.161] (-308.565) (-304.187) (-305.380) -- 0:00:39
Average standard deviation of split frequencies: 0.013966
380500 -- (-305.163) (-303.320) (-305.201) [-302.978] * (-305.620) (-306.837) (-305.997) [-308.418] -- 0:00:39
381000 -- (-303.314) [-304.868] (-304.609) (-304.409) * [-304.808] (-315.045) (-303.149) (-303.175) -- 0:00:38
381500 -- (-302.178) (-303.168) (-305.013) [-304.904] * (-307.074) [-303.526] (-304.738) (-302.739) -- 0:00:38
382000 -- (-305.205) [-306.827] (-305.871) (-306.821) * (-306.657) (-303.241) (-304.646) [-305.402] -- 0:00:38
382500 -- (-304.416) (-304.062) [-306.391] (-308.883) * (-303.860) (-307.756) (-305.543) [-304.356] -- 0:00:38
383000 -- (-307.010) (-304.465) [-308.220] (-307.675) * (-303.837) [-303.937] (-305.057) (-304.474) -- 0:00:38
383500 -- [-304.113] (-302.373) (-304.601) (-305.196) * (-301.918) [-303.947] (-306.726) (-303.830) -- 0:00:40
384000 -- (-304.132) [-305.813] (-304.780) (-305.558) * [-302.863] (-305.598) (-302.310) (-305.892) -- 0:00:40
384500 -- (-306.959) (-304.050) [-305.551] (-303.211) * (-304.925) (-307.472) [-302.063] (-303.190) -- 0:00:40
385000 -- (-305.079) (-306.058) [-305.310] (-307.159) * (-303.234) [-304.511] (-303.077) (-302.775) -- 0:00:39
Average standard deviation of split frequencies: 0.013977
385500 -- (-304.242) (-308.857) (-302.592) [-304.402] * [-303.075] (-305.328) (-302.577) (-303.083) -- 0:00:39
386000 -- (-304.144) (-303.611) (-308.899) [-302.496] * (-304.004) (-305.581) (-304.073) [-306.096] -- 0:00:39
386500 -- (-304.804) [-303.061] (-306.467) (-302.959) * [-302.385] (-304.428) (-304.016) (-304.351) -- 0:00:39
387000 -- (-305.139) (-303.006) [-305.353] (-304.576) * [-302.174] (-304.400) (-307.103) (-305.980) -- 0:00:39
387500 -- (-304.944) (-303.503) [-304.415] (-307.959) * [-303.005] (-307.258) (-304.826) (-305.763) -- 0:00:39
388000 -- [-303.125] (-307.050) (-308.828) (-304.466) * (-304.740) [-304.883] (-302.377) (-305.888) -- 0:00:39
388500 -- (-305.714) (-302.525) (-303.459) [-304.257] * (-304.169) [-305.593] (-308.796) (-303.776) -- 0:00:39
389000 -- (-303.282) (-304.527) [-304.069] (-303.345) * (-307.515) (-303.117) (-305.469) [-302.747] -- 0:00:39
389500 -- [-304.347] (-302.973) (-305.897) (-305.285) * (-306.347) (-303.827) (-305.854) [-302.239] -- 0:00:39
390000 -- (-305.260) [-303.161] (-307.332) (-303.530) * (-308.849) (-307.417) (-306.932) [-302.171] -- 0:00:39
Average standard deviation of split frequencies: 0.013810
390500 -- (-305.795) (-304.882) (-303.111) [-309.022] * (-304.585) (-307.727) (-303.463) [-307.056] -- 0:00:39
391000 -- [-306.780] (-307.504) (-312.118) (-307.065) * (-305.174) [-304.319] (-305.070) (-304.859) -- 0:00:38
391500 -- (-305.360) (-308.817) (-305.233) [-304.334] * [-303.905] (-306.439) (-308.310) (-305.342) -- 0:00:38
392000 -- (-304.243) (-303.384) [-304.703] (-304.192) * (-303.700) [-305.663] (-308.614) (-306.080) -- 0:00:38
392500 -- (-307.460) (-308.147) (-303.249) [-304.027] * (-308.129) [-302.257] (-304.279) (-303.857) -- 0:00:38
393000 -- (-303.271) [-306.801] (-304.875) (-304.204) * (-303.519) [-303.803] (-303.799) (-302.007) -- 0:00:38
393500 -- (-304.577) [-305.193] (-303.367) (-306.596) * [-303.614] (-303.472) (-303.848) (-303.879) -- 0:00:38
394000 -- (-304.386) (-304.811) [-303.547] (-305.924) * (-304.984) (-302.912) [-302.431] (-302.218) -- 0:00:38
394500 -- (-303.667) [-304.253] (-306.199) (-303.929) * [-304.497] (-307.370) (-302.275) (-302.082) -- 0:00:38
395000 -- (-305.787) [-304.994] (-307.019) (-303.855) * (-302.796) (-302.388) (-304.942) [-304.892] -- 0:00:38
Average standard deviation of split frequencies: 0.014020
395500 -- (-304.993) (-304.472) [-305.163] (-304.170) * [-302.396] (-307.161) (-305.958) (-305.955) -- 0:00:38
396000 -- (-304.056) (-308.395) (-305.902) [-303.596] * (-303.500) [-306.760] (-311.281) (-304.767) -- 0:00:38
396500 -- (-305.716) (-306.005) [-305.146] (-305.710) * (-304.505) [-304.161] (-305.172) (-304.596) -- 0:00:38
397000 -- [-303.994] (-304.434) (-306.336) (-305.491) * (-304.600) (-306.504) [-308.316] (-302.672) -- 0:00:37
397500 -- (-308.314) [-302.412] (-302.584) (-309.132) * (-303.863) (-305.257) [-304.709] (-305.809) -- 0:00:37
398000 -- (-305.833) (-303.788) [-302.419] (-304.635) * (-302.872) (-303.275) (-302.216) [-302.534] -- 0:00:37
398500 -- [-305.196] (-302.990) (-303.040) (-304.181) * (-304.124) [-302.445] (-303.327) (-305.368) -- 0:00:37
399000 -- (-305.807) (-306.416) (-305.477) [-304.448] * [-304.689] (-302.296) (-303.555) (-305.579) -- 0:00:37
399500 -- (-305.778) [-303.970] (-302.774) (-304.682) * (-304.193) [-303.378] (-303.943) (-302.664) -- 0:00:37
400000 -- (-305.873) [-305.158] (-302.916) (-307.223) * [-302.754] (-303.622) (-305.167) (-302.168) -- 0:00:37
Average standard deviation of split frequencies: 0.013565
400500 -- [-305.616] (-303.951) (-304.614) (-308.065) * (-304.942) [-302.996] (-305.107) (-305.234) -- 0:00:38
401000 -- (-302.377) (-306.680) [-309.352] (-304.112) * (-303.568) (-304.242) [-303.609] (-303.371) -- 0:00:38
401500 -- (-304.741) (-310.738) [-304.298] (-302.331) * [-304.245] (-310.157) (-305.129) (-302.878) -- 0:00:38
402000 -- [-303.388] (-306.278) (-306.652) (-306.721) * (-312.759) (-304.866) [-306.217] (-303.303) -- 0:00:38
402500 -- (-303.531) (-306.045) [-304.172] (-305.402) * (-305.249) [-309.399] (-315.348) (-302.184) -- 0:00:38
403000 -- (-305.264) (-303.694) (-303.621) [-302.513] * (-303.584) (-308.336) (-303.114) [-303.981] -- 0:00:38
403500 -- (-307.026) (-304.744) [-302.187] (-302.720) * (-304.863) [-304.195] (-303.226) (-304.124) -- 0:00:38
404000 -- [-304.111] (-304.534) (-303.743) (-304.954) * (-304.753) (-304.056) (-304.236) [-304.141] -- 0:00:38
404500 -- (-303.473) [-304.378] (-306.516) (-306.553) * (-306.737) (-305.877) (-305.000) [-306.262] -- 0:00:38
405000 -- (-310.261) [-303.493] (-304.978) (-304.980) * [-303.821] (-305.530) (-303.747) (-304.379) -- 0:00:38
Average standard deviation of split frequencies: 0.012909
405500 -- (-306.009) (-302.982) (-303.022) [-303.611] * (-305.322) [-302.294] (-304.363) (-303.821) -- 0:00:38
406000 -- [-303.004] (-302.477) (-303.944) (-304.711) * (-304.032) (-306.552) [-303.323] (-307.284) -- 0:00:38
406500 -- (-304.992) (-307.177) (-304.641) [-303.654] * (-304.078) (-305.683) (-307.532) [-303.307] -- 0:00:37
407000 -- (-302.417) (-304.299) (-303.980) [-302.989] * [-306.916] (-303.529) (-307.501) (-305.316) -- 0:00:37
407500 -- (-305.908) (-303.281) (-305.076) [-305.242] * (-304.424) [-304.058] (-303.512) (-304.468) -- 0:00:37
408000 -- (-307.095) (-303.986) (-302.504) [-304.341] * (-303.573) (-303.305) (-304.122) [-303.084] -- 0:00:37
408500 -- [-302.181] (-306.647) (-303.827) (-305.343) * [-303.531] (-303.082) (-302.897) (-307.003) -- 0:00:37
409000 -- (-303.361) (-304.188) [-302.815] (-306.236) * (-303.471) (-305.276) (-304.031) [-305.540] -- 0:00:37
409500 -- (-303.117) [-302.853] (-305.107) (-304.936) * (-304.331) (-308.197) [-304.842] (-312.278) -- 0:00:37
410000 -- (-305.842) (-302.851) [-302.898] (-303.248) * (-304.037) (-307.423) (-304.942) [-310.787] -- 0:00:37
Average standard deviation of split frequencies: 0.012694
410500 -- (-302.926) [-302.888] (-306.232) (-305.132) * [-302.557] (-302.475) (-303.435) (-305.226) -- 0:00:37
411000 -- (-304.552) (-305.681) (-309.718) [-305.168] * (-304.223) (-303.645) (-302.610) [-307.485] -- 0:00:37
411500 -- (-302.592) (-304.744) (-306.761) [-306.666] * (-305.360) (-309.969) (-306.683) [-302.536] -- 0:00:37
412000 -- (-303.460) (-304.260) [-303.048] (-303.364) * (-303.591) [-303.053] (-307.036) (-302.499) -- 0:00:37
412500 -- (-304.840) (-304.587) (-303.391) [-302.094] * (-303.121) [-305.980] (-304.856) (-302.584) -- 0:00:37
413000 -- (-303.869) (-303.844) (-302.641) [-302.811] * (-305.356) (-304.635) [-307.061] (-303.265) -- 0:00:36
413500 -- (-303.374) (-303.572) [-302.886] (-303.852) * (-305.739) (-308.777) (-309.294) [-303.259] -- 0:00:36
414000 -- (-304.411) (-304.096) (-303.999) [-304.510] * (-303.055) (-304.573) (-305.345) [-304.422] -- 0:00:36
414500 -- (-303.420) [-304.963] (-306.046) (-303.850) * (-308.521) (-303.641) (-305.479) [-305.191] -- 0:00:36
415000 -- (-306.094) (-302.950) (-302.464) [-303.112] * (-305.278) (-302.326) (-302.848) [-303.038] -- 0:00:36
Average standard deviation of split frequencies: 0.011798
415500 -- [-305.315] (-302.256) (-304.080) (-302.804) * (-304.114) [-305.593] (-304.936) (-302.568) -- 0:00:36
416000 -- (-306.633) [-303.390] (-306.656) (-302.929) * (-302.658) (-304.672) [-304.061] (-304.470) -- 0:00:36
416500 -- (-310.075) (-306.012) (-308.212) [-303.870] * (-303.105) [-302.435] (-304.276) (-305.012) -- 0:00:36
417000 -- [-307.237] (-307.787) (-305.588) (-302.867) * [-303.456] (-303.577) (-305.405) (-305.390) -- 0:00:36
417500 -- [-308.099] (-303.846) (-303.631) (-303.427) * [-304.000] (-305.627) (-305.604) (-302.876) -- 0:00:37
418000 -- (-303.533) (-305.575) (-303.419) [-307.332] * [-302.312] (-302.896) (-307.637) (-304.706) -- 0:00:37
418500 -- (-305.840) (-302.917) [-304.404] (-308.407) * (-303.261) (-303.059) [-304.552] (-303.556) -- 0:00:37
419000 -- (-305.387) [-303.036] (-304.649) (-306.547) * [-302.757] (-305.750) (-303.110) (-304.205) -- 0:00:37
419500 -- (-303.319) [-303.375] (-307.289) (-306.456) * [-303.498] (-305.366) (-302.770) (-302.778) -- 0:00:37
420000 -- [-303.992] (-303.166) (-306.678) (-303.421) * [-304.533] (-303.600) (-303.361) (-303.221) -- 0:00:37
Average standard deviation of split frequencies: 0.010996
420500 -- (-305.189) (-302.900) [-309.095] (-303.219) * (-305.179) [-305.585] (-304.633) (-304.324) -- 0:00:37
421000 -- (-302.524) [-305.086] (-305.723) (-303.322) * (-303.780) (-302.885) (-303.205) [-303.168] -- 0:00:37
421500 -- (-304.968) (-305.915) [-304.036] (-306.890) * (-304.956) [-306.548] (-306.532) (-304.164) -- 0:00:37
422000 -- (-303.957) (-303.682) (-307.846) [-305.747] * (-302.659) [-310.016] (-304.302) (-303.418) -- 0:00:36
422500 -- (-303.749) [-307.696] (-304.587) (-304.528) * (-302.554) (-313.710) [-301.944] (-304.516) -- 0:00:36
423000 -- [-303.267] (-305.778) (-302.278) (-303.564) * (-303.581) (-309.336) (-304.026) [-303.541] -- 0:00:36
423500 -- (-302.845) (-304.117) (-303.558) [-304.756] * (-305.513) [-305.322] (-304.686) (-303.681) -- 0:00:36
424000 -- (-304.059) [-305.945] (-306.551) (-306.171) * [-308.122] (-307.697) (-302.496) (-304.579) -- 0:00:36
424500 -- (-304.164) (-304.023) [-305.483] (-305.327) * (-302.043) [-303.156] (-303.308) (-305.259) -- 0:00:36
425000 -- (-302.596) (-307.040) [-305.378] (-307.245) * [-303.591] (-302.130) (-304.674) (-304.808) -- 0:00:36
Average standard deviation of split frequencies: 0.011131
425500 -- [-303.430] (-308.019) (-305.621) (-305.033) * (-305.786) [-306.012] (-306.315) (-304.067) -- 0:00:36
426000 -- (-303.538) (-306.335) (-305.699) [-303.189] * (-304.645) (-306.610) [-302.742] (-302.374) -- 0:00:36
426500 -- (-303.329) [-305.540] (-312.256) (-303.983) * (-302.637) (-303.478) (-302.591) [-304.540] -- 0:00:36
427000 -- (-306.301) (-303.957) [-303.670] (-303.392) * (-305.789) (-305.206) (-305.180) [-302.857] -- 0:00:36
427500 -- (-304.174) [-303.992] (-307.135) (-309.663) * (-304.265) (-304.414) [-303.728] (-307.114) -- 0:00:36
428000 -- (-307.312) (-309.048) (-305.286) [-303.849] * (-302.369) [-307.280] (-302.502) (-305.249) -- 0:00:36
428500 -- (-302.596) (-308.115) (-306.174) [-302.107] * (-302.789) [-304.257] (-307.449) (-303.941) -- 0:00:36
429000 -- (-303.915) (-306.502) (-304.809) [-302.721] * (-303.179) (-302.572) [-303.813] (-304.621) -- 0:00:35
429500 -- (-302.353) (-306.034) [-303.258] (-303.318) * (-303.867) (-303.451) (-306.193) [-302.790] -- 0:00:35
430000 -- (-303.695) [-304.584] (-305.226) (-305.430) * (-303.866) (-304.911) [-302.327] (-303.784) -- 0:00:35
Average standard deviation of split frequencies: 0.011356
430500 -- (-305.467) [-304.643] (-305.565) (-303.411) * (-305.192) (-306.116) [-302.419] (-305.027) -- 0:00:35
431000 -- (-304.276) (-303.097) [-306.546] (-303.932) * (-304.001) (-304.629) [-302.247] (-304.425) -- 0:00:35
431500 -- (-304.428) [-302.822] (-305.207) (-304.722) * (-304.275) [-304.875] (-306.105) (-304.721) -- 0:00:35
432000 -- [-304.739] (-302.434) (-307.276) (-304.429) * [-305.178] (-303.808) (-304.473) (-303.754) -- 0:00:35
432500 -- (-303.728) (-302.060) [-305.910] (-303.222) * (-304.219) (-307.507) [-305.104] (-303.665) -- 0:00:35
433000 -- (-304.807) (-303.712) [-303.974] (-305.412) * (-306.432) (-308.004) (-309.857) [-305.066] -- 0:00:35
433500 -- [-305.726] (-303.882) (-304.282) (-307.109) * (-305.547) [-306.681] (-303.813) (-306.004) -- 0:00:35
434000 -- (-302.627) (-303.232) (-306.946) [-303.496] * (-303.417) [-306.198] (-305.166) (-304.964) -- 0:00:35
434500 -- (-306.482) (-303.238) [-304.358] (-306.162) * (-303.524) (-302.793) [-305.424] (-304.698) -- 0:00:36
435000 -- (-302.911) (-303.830) [-303.929] (-304.123) * (-303.080) (-302.597) [-305.375] (-303.097) -- 0:00:36
Average standard deviation of split frequencies: 0.011575
435500 -- [-302.329] (-302.894) (-305.760) (-305.331) * (-303.995) (-303.716) [-303.209] (-304.836) -- 0:00:36
436000 -- [-304.966] (-303.002) (-303.030) (-304.593) * [-303.407] (-304.717) (-305.220) (-303.921) -- 0:00:36
436500 -- (-302.950) (-303.904) (-305.824) [-304.781] * [-303.957] (-304.851) (-303.938) (-302.960) -- 0:00:36
437000 -- (-305.062) [-303.794] (-306.093) (-304.875) * [-303.700] (-305.101) (-307.218) (-305.174) -- 0:00:36
437500 -- (-304.139) [-303.270] (-304.660) (-304.937) * (-304.485) [-305.158] (-309.084) (-308.158) -- 0:00:36
438000 -- (-304.203) (-305.284) [-304.652] (-304.795) * [-303.662] (-303.703) (-305.466) (-307.990) -- 0:00:35
438500 -- [-303.432] (-304.999) (-305.387) (-303.286) * (-304.228) (-302.257) [-308.119] (-309.214) -- 0:00:35
439000 -- (-304.079) (-304.630) (-307.844) [-305.539] * (-305.924) (-305.049) (-303.659) [-305.399] -- 0:00:35
439500 -- (-305.285) (-302.005) (-302.869) [-302.434] * (-305.812) [-302.132] (-305.292) (-305.964) -- 0:00:35
440000 -- (-305.165) [-302.669] (-303.918) (-302.645) * (-303.195) [-306.083] (-304.714) (-305.424) -- 0:00:35
Average standard deviation of split frequencies: 0.011641
440500 -- (-305.704) [-302.964] (-303.537) (-302.296) * (-302.855) (-301.983) [-304.330] (-312.390) -- 0:00:35
441000 -- (-303.692) [-305.572] (-304.346) (-307.472) * [-302.767] (-303.610) (-303.728) (-305.069) -- 0:00:35
441500 -- (-304.126) (-305.660) [-310.502] (-304.391) * (-304.609) (-303.228) [-302.570] (-302.195) -- 0:00:35
442000 -- (-305.056) [-303.648] (-305.942) (-307.219) * (-309.462) [-303.529] (-303.915) (-301.982) -- 0:00:35
442500 -- (-304.741) (-308.024) [-302.710] (-305.946) * (-304.119) [-303.648] (-304.506) (-303.163) -- 0:00:35
443000 -- [-303.711] (-305.689) (-305.507) (-302.495) * (-305.588) (-305.489) (-302.799) [-303.289] -- 0:00:35
443500 -- [-303.159] (-304.693) (-306.688) (-303.260) * [-302.700] (-304.359) (-306.507) (-306.073) -- 0:00:35
444000 -- (-302.247) (-304.426) (-302.423) [-304.973] * [-306.763] (-304.688) (-303.340) (-305.246) -- 0:00:35
444500 -- (-302.619) [-306.179] (-303.241) (-303.900) * (-303.386) (-305.440) (-302.630) [-303.256] -- 0:00:34
445000 -- (-308.600) (-303.060) (-305.079) [-303.145] * (-304.190) (-303.717) (-304.505) [-305.225] -- 0:00:34
Average standard deviation of split frequencies: 0.010570
445500 -- (-306.049) (-303.387) (-302.070) [-307.755] * [-304.513] (-303.436) (-306.681) (-304.679) -- 0:00:34
446000 -- (-307.091) (-306.232) (-304.041) [-302.997] * [-306.623] (-304.324) (-308.567) (-302.453) -- 0:00:34
446500 -- [-303.642] (-303.500) (-303.607) (-302.161) * (-306.323) [-303.487] (-304.679) (-302.711) -- 0:00:34
447000 -- (-303.658) [-306.215] (-304.562) (-303.155) * [-302.173] (-303.382) (-302.673) (-305.557) -- 0:00:34
447500 -- (-308.396) (-306.184) (-303.673) [-304.587] * (-304.001) (-305.148) [-305.701] (-305.498) -- 0:00:34
448000 -- (-305.280) [-305.559] (-304.165) (-307.067) * (-303.067) [-305.955] (-304.316) (-304.000) -- 0:00:34
448500 -- (-304.049) (-304.415) (-303.742) [-304.006] * (-302.147) (-305.425) [-306.820] (-304.866) -- 0:00:34
449000 -- [-302.698] (-302.616) (-306.179) (-304.301) * (-304.787) (-305.416) [-307.221] (-302.857) -- 0:00:34
449500 -- (-304.031) (-303.272) (-305.452) [-303.331] * (-303.842) (-303.008) [-305.714] (-303.521) -- 0:00:34
450000 -- (-304.218) (-303.312) (-310.338) [-305.623] * [-304.032] (-308.446) (-304.647) (-304.307) -- 0:00:34
Average standard deviation of split frequencies: 0.010329
450500 -- (-302.590) [-304.416] (-307.196) (-303.027) * [-304.230] (-304.186) (-303.480) (-306.498) -- 0:00:34
451000 -- (-304.499) (-304.409) [-304.899] (-302.735) * (-307.744) (-302.771) [-302.079] (-306.754) -- 0:00:34
451500 -- (-303.152) (-304.994) (-307.551) [-302.956] * (-304.168) [-304.381] (-308.010) (-302.159) -- 0:00:35
452000 -- (-305.105) [-305.389] (-302.648) (-304.954) * (-302.681) (-305.425) (-304.796) [-303.650] -- 0:00:35
452500 -- (-302.487) (-305.013) [-302.649] (-304.488) * [-305.728] (-311.355) (-305.990) (-305.266) -- 0:00:35
453000 -- (-307.084) (-304.691) (-302.559) [-302.615] * (-303.917) [-309.131] (-302.893) (-302.617) -- 0:00:35
453500 -- (-305.137) [-305.294] (-307.264) (-303.167) * [-304.037] (-306.845) (-304.066) (-305.137) -- 0:00:34
454000 -- (-306.252) (-304.639) (-305.342) [-303.374] * [-302.954] (-304.296) (-303.328) (-304.065) -- 0:00:34
454500 -- [-305.925] (-310.176) (-306.295) (-307.412) * (-303.640) [-306.024] (-305.300) (-302.932) -- 0:00:34
455000 -- (-304.274) (-302.208) (-303.924) [-303.965] * (-304.080) [-303.891] (-303.653) (-305.691) -- 0:00:34
Average standard deviation of split frequencies: 0.010824
455500 -- (-303.042) [-303.375] (-303.106) (-302.496) * (-306.791) (-303.855) [-304.388] (-302.195) -- 0:00:34
456000 -- [-306.123] (-308.613) (-303.355) (-306.656) * [-302.874] (-303.444) (-305.099) (-303.591) -- 0:00:34
456500 -- (-303.614) (-303.842) (-306.015) [-304.920] * (-302.480) (-305.891) (-309.467) [-302.861] -- 0:00:34
457000 -- (-303.775) (-305.124) (-302.920) [-302.528] * (-307.816) [-303.174] (-305.549) (-303.578) -- 0:00:34
457500 -- (-303.784) (-305.641) (-302.658) [-302.775] * (-302.755) (-303.128) (-307.321) [-310.496] -- 0:00:34
458000 -- (-302.923) [-306.358] (-304.526) (-304.137) * (-302.116) [-304.518] (-305.822) (-303.663) -- 0:00:34
458500 -- (-303.195) (-306.163) (-303.206) [-305.662] * (-303.220) (-303.566) [-303.194] (-304.321) -- 0:00:34
459000 -- (-306.084) (-303.884) (-302.797) [-305.298] * [-304.174] (-302.597) (-302.742) (-308.996) -- 0:00:34
459500 -- (-303.757) (-303.104) [-302.618] (-304.351) * (-308.589) [-303.830] (-304.523) (-305.030) -- 0:00:34
460000 -- (-305.244) (-303.782) [-303.560] (-305.085) * (-308.169) (-307.669) [-304.275] (-305.894) -- 0:00:34
Average standard deviation of split frequencies: 0.011497
460500 -- (-303.644) (-304.893) [-302.771] (-303.173) * [-307.159] (-309.481) (-307.528) (-306.644) -- 0:00:33
461000 -- [-303.879] (-305.187) (-303.874) (-303.576) * [-303.118] (-302.755) (-302.039) (-302.289) -- 0:00:33
461500 -- (-304.812) [-304.147] (-302.667) (-304.341) * (-303.923) (-303.771) [-304.655] (-302.485) -- 0:00:33
462000 -- (-306.416) [-304.629] (-304.053) (-302.413) * [-302.573] (-303.918) (-305.325) (-302.601) -- 0:00:33
462500 -- (-303.406) (-302.850) (-304.348) [-304.071] * (-305.826) [-303.627] (-304.357) (-305.427) -- 0:00:33
463000 -- (-307.822) (-306.762) [-306.330] (-302.844) * (-308.360) (-302.618) (-303.357) [-305.587] -- 0:00:33
463500 -- (-305.708) [-304.244] (-308.983) (-302.803) * (-303.451) [-304.247] (-305.246) (-307.176) -- 0:00:33
464000 -- (-303.125) (-307.588) (-309.053) [-304.144] * (-307.727) [-305.720] (-303.698) (-303.722) -- 0:00:33
464500 -- (-303.256) (-303.394) (-308.405) [-303.456] * [-307.908] (-303.171) (-305.009) (-311.418) -- 0:00:33
465000 -- (-303.742) [-302.548] (-311.433) (-304.116) * [-303.076] (-303.859) (-302.970) (-302.541) -- 0:00:33
Average standard deviation of split frequencies: 0.012199
465500 -- (-302.318) (-302.442) (-309.974) [-304.065] * (-310.922) [-309.296] (-303.587) (-304.145) -- 0:00:33
466000 -- (-303.431) [-305.234] (-304.186) (-304.061) * [-308.475] (-302.221) (-305.455) (-310.078) -- 0:00:33
466500 -- (-305.416) (-303.367) [-304.964] (-307.156) * [-303.995] (-303.611) (-304.369) (-308.878) -- 0:00:33
467000 -- (-306.327) [-307.089] (-309.887) (-302.654) * (-304.307) (-304.524) (-304.496) [-306.775] -- 0:00:33
467500 -- (-306.406) (-303.285) (-302.454) [-305.165] * (-303.529) [-303.688] (-302.844) (-304.494) -- 0:00:33
468000 -- (-304.431) (-305.725) (-302.890) [-303.917] * (-304.363) (-305.005) [-304.268] (-308.423) -- 0:00:32
468500 -- (-305.558) (-302.232) (-302.735) [-308.049] * (-306.337) [-304.944] (-303.384) (-305.541) -- 0:00:34
469000 -- (-303.281) (-303.298) (-307.270) [-307.083] * [-303.189] (-305.466) (-302.930) (-302.985) -- 0:00:33
469500 -- (-302.923) (-303.024) (-304.944) [-305.421] * (-302.908) (-308.118) [-303.175] (-303.912) -- 0:00:33
470000 -- (-302.572) [-302.307] (-307.464) (-302.825) * [-302.740] (-304.892) (-302.522) (-302.555) -- 0:00:33
Average standard deviation of split frequencies: 0.012137
470500 -- (-304.947) (-302.769) (-304.143) [-302.898] * [-303.047] (-304.886) (-303.828) (-303.303) -- 0:00:33
471000 -- (-307.258) (-304.055) [-307.670] (-308.533) * (-307.935) [-302.551] (-308.499) (-306.389) -- 0:00:33
471500 -- [-304.813] (-304.649) (-304.918) (-304.696) * (-306.358) (-307.917) (-307.515) [-304.098] -- 0:00:33
472000 -- (-305.833) (-303.520) (-306.333) [-309.148] * (-307.238) [-304.160] (-302.014) (-303.689) -- 0:00:33
472500 -- (-302.854) (-307.540) [-308.990] (-304.846) * (-302.911) (-304.310) (-304.861) [-304.332] -- 0:00:33
473000 -- [-303.395] (-303.801) (-304.567) (-305.288) * [-302.952] (-304.233) (-304.391) (-303.024) -- 0:00:33
473500 -- (-303.156) (-303.713) (-303.135) [-302.985] * [-306.290] (-304.493) (-303.003) (-303.074) -- 0:00:33
474000 -- [-303.026] (-304.768) (-302.802) (-304.460) * (-304.812) (-306.320) [-302.776] (-305.415) -- 0:00:33
474500 -- (-302.692) (-304.556) [-303.304] (-302.480) * (-303.342) (-307.355) (-307.041) [-302.476] -- 0:00:33
475000 -- (-302.600) (-304.023) (-307.774) [-303.321] * (-303.357) (-303.829) [-302.025] (-307.085) -- 0:00:33
Average standard deviation of split frequencies: 0.012059
475500 -- (-307.845) [-302.972] (-309.734) (-305.485) * (-302.409) (-306.612) (-302.355) [-303.909] -- 0:00:33
476000 -- (-303.821) [-302.289] (-302.642) (-303.909) * [-303.453] (-305.527) (-303.811) (-306.591) -- 0:00:33
476500 -- (-306.755) (-302.143) [-305.658] (-304.216) * (-304.055) (-304.714) [-304.314] (-302.822) -- 0:00:32
477000 -- (-304.071) [-303.451] (-302.260) (-302.894) * (-302.073) (-304.691) (-303.899) [-302.889] -- 0:00:32
477500 -- [-306.429] (-302.646) (-303.752) (-305.893) * (-304.329) [-308.208] (-306.437) (-303.307) -- 0:00:32
478000 -- (-303.952) (-303.234) (-303.962) [-305.137] * (-304.592) (-302.923) (-305.490) [-304.317] -- 0:00:32
478500 -- (-304.597) [-304.171] (-302.690) (-311.059) * (-305.662) [-307.734] (-302.474) (-305.659) -- 0:00:32
479000 -- (-303.491) [-302.868] (-303.114) (-304.011) * (-304.546) [-302.052] (-303.692) (-303.003) -- 0:00:32
479500 -- (-304.587) (-303.438) (-305.522) [-303.315] * (-309.236) (-303.101) (-303.403) [-308.633] -- 0:00:32
480000 -- [-302.939] (-302.969) (-304.887) (-304.500) * (-309.524) (-303.371) [-304.158] (-304.411) -- 0:00:32
Average standard deviation of split frequencies: 0.011830
480500 -- (-303.312) [-302.303] (-302.434) (-303.910) * (-305.425) (-302.787) (-302.609) [-306.834] -- 0:00:32
481000 -- [-304.557] (-305.440) (-306.718) (-305.003) * (-304.258) [-305.037] (-304.760) (-305.979) -- 0:00:32
481500 -- (-302.785) (-304.301) (-303.040) [-302.865] * (-305.663) (-303.234) [-310.615] (-304.386) -- 0:00:32
482000 -- (-304.311) (-304.162) (-304.037) [-304.601] * (-302.838) (-303.585) (-304.210) [-304.475] -- 0:00:32
482500 -- (-307.256) (-302.552) (-304.310) [-304.685] * [-302.174] (-303.098) (-303.039) (-302.468) -- 0:00:32
483000 -- (-305.391) (-304.937) [-304.065] (-303.334) * (-303.950) (-302.839) [-302.942] (-305.765) -- 0:00:32
483500 -- (-303.737) (-304.490) [-304.437] (-303.956) * (-303.254) (-304.584) (-308.193) [-305.777] -- 0:00:32
484000 -- (-303.178) [-305.499] (-305.327) (-303.593) * (-303.867) (-303.911) [-306.760] (-310.308) -- 0:00:31
484500 -- (-302.843) (-308.310) (-303.907) [-304.136] * (-303.676) [-304.732] (-303.047) (-303.520) -- 0:00:31
485000 -- [-305.034] (-306.537) (-307.927) (-306.175) * (-303.198) (-304.226) (-304.103) [-302.256] -- 0:00:31
Average standard deviation of split frequencies: 0.012039
485500 -- (-303.153) (-302.131) [-304.711] (-307.146) * (-307.964) (-304.114) (-302.491) [-306.913] -- 0:00:31
486000 -- (-302.804) (-303.023) (-303.731) [-306.023] * [-305.719] (-302.557) (-305.791) (-304.444) -- 0:00:32
486500 -- (-303.611) (-303.595) [-303.483] (-304.311) * (-304.839) [-301.895] (-305.901) (-305.206) -- 0:00:32
487000 -- (-304.228) (-306.843) (-305.472) [-305.926] * (-302.527) [-304.686] (-302.425) (-304.444) -- 0:00:32
487500 -- (-304.217) [-302.836] (-304.932) (-306.296) * (-306.624) (-305.777) (-307.332) [-303.911] -- 0:00:32
488000 -- (-305.295) (-303.430) [-303.615] (-306.475) * (-306.781) (-308.473) (-304.467) [-305.649] -- 0:00:32
488500 -- [-303.859] (-308.426) (-304.577) (-304.802) * (-303.586) (-308.109) (-304.209) [-302.693] -- 0:00:32
489000 -- (-303.019) (-306.346) [-305.945] (-305.120) * (-307.096) (-304.053) (-302.860) [-307.274] -- 0:00:32
489500 -- (-304.110) (-308.253) (-304.598) [-303.774] * (-306.459) (-302.728) [-305.392] (-303.016) -- 0:00:32
490000 -- [-304.017] (-309.732) (-308.123) (-304.645) * (-306.529) (-303.344) (-309.126) [-302.949] -- 0:00:32
Average standard deviation of split frequencies: 0.011811
490500 -- [-306.696] (-305.563) (-303.808) (-306.408) * (-308.472) [-303.949] (-304.911) (-303.346) -- 0:00:32
491000 -- [-303.305] (-304.610) (-304.523) (-302.871) * (-305.615) (-307.495) [-304.889] (-305.259) -- 0:00:32
491500 -- (-304.646) [-304.470] (-304.079) (-303.005) * [-305.377] (-304.671) (-302.953) (-302.226) -- 0:00:32
492000 -- (-306.815) [-305.560] (-307.887) (-302.716) * (-302.999) (-307.325) [-305.339] (-304.745) -- 0:00:32
492500 -- [-304.955] (-304.897) (-307.770) (-304.917) * (-304.937) (-309.042) (-304.154) [-302.886] -- 0:00:31
493000 -- [-306.350] (-305.003) (-303.225) (-302.515) * [-303.060] (-307.827) (-304.890) (-303.861) -- 0:00:31
493500 -- (-302.522) [-307.495] (-304.578) (-303.460) * [-303.176] (-307.158) (-302.889) (-304.081) -- 0:00:31
494000 -- [-302.298] (-306.450) (-306.091) (-304.738) * [-303.412] (-312.509) (-304.990) (-302.594) -- 0:00:31
494500 -- [-302.240] (-302.224) (-303.670) (-305.920) * (-305.110) [-304.397] (-302.746) (-306.314) -- 0:00:31
495000 -- (-303.273) (-303.239) (-303.235) [-303.359] * [-302.685] (-308.004) (-305.571) (-310.059) -- 0:00:31
Average standard deviation of split frequencies: 0.012299
495500 -- [-303.304] (-303.574) (-303.517) (-306.600) * [-304.903] (-305.694) (-302.340) (-305.081) -- 0:00:31
496000 -- (-305.022) (-306.991) [-304.232] (-302.975) * (-304.105) (-303.234) (-303.420) [-307.421] -- 0:00:31
496500 -- (-305.687) (-304.996) (-306.122) [-302.542] * (-302.619) (-305.518) [-302.582] (-306.186) -- 0:00:31
497000 -- (-305.744) (-305.544) (-308.087) [-306.700] * (-304.850) (-306.964) [-303.918] (-307.391) -- 0:00:31
497500 -- (-305.479) (-307.771) (-304.311) [-303.676] * (-306.331) (-305.626) (-303.199) [-311.631] -- 0:00:31
498000 -- (-306.807) (-305.124) (-303.626) [-303.944] * (-303.410) (-304.101) (-306.309) [-310.301] -- 0:00:31
498500 -- (-303.130) (-304.088) [-303.087] (-302.454) * [-304.592] (-304.950) (-303.846) (-304.037) -- 0:00:31
499000 -- (-303.649) (-305.549) (-302.840) [-302.146] * [-304.652] (-308.460) (-307.515) (-304.111) -- 0:00:31
499500 -- (-303.163) (-303.608) [-303.978] (-303.267) * (-306.064) (-306.671) [-304.481] (-305.303) -- 0:00:31
500000 -- (-310.694) [-303.402] (-303.194) (-302.797) * (-305.652) [-304.509] (-306.424) (-303.814) -- 0:00:31
Average standard deviation of split frequencies: 0.013459
500500 -- (-303.126) (-305.254) [-302.472] (-305.387) * (-307.115) [-302.547] (-308.750) (-304.268) -- 0:00:30
501000 -- (-304.460) [-303.523] (-303.465) (-302.598) * (-307.155) (-304.655) [-304.457] (-306.417) -- 0:00:30
501500 -- (-303.962) (-307.592) (-302.984) [-305.501] * (-305.348) [-303.329] (-304.895) (-304.443) -- 0:00:30
502000 -- (-305.873) [-305.340] (-303.633) (-306.586) * (-305.243) (-305.928) (-305.419) [-306.045] -- 0:00:30
502500 -- (-302.911) (-302.818) (-306.507) [-303.018] * (-305.047) [-305.015] (-303.739) (-303.352) -- 0:00:31
503000 -- (-304.980) (-302.942) (-303.724) [-304.224] * [-304.375] (-305.498) (-305.596) (-306.678) -- 0:00:31
503500 -- [-303.470] (-303.730) (-311.489) (-303.239) * [-304.253] (-305.303) (-304.478) (-303.223) -- 0:00:31
504000 -- [-303.634] (-303.453) (-306.587) (-303.782) * (-305.348) [-305.856] (-304.430) (-308.287) -- 0:00:31
504500 -- [-303.848] (-301.993) (-305.314) (-305.038) * (-302.642) [-305.276] (-303.919) (-305.535) -- 0:00:31
505000 -- [-302.685] (-302.347) (-303.473) (-304.064) * (-303.030) (-303.252) [-304.422] (-308.603) -- 0:00:31
Average standard deviation of split frequencies: 0.013302
505500 -- (-304.213) (-302.343) (-303.982) [-303.594] * (-302.274) (-304.560) (-303.342) [-303.347] -- 0:00:31
506000 -- (-308.296) [-303.160] (-302.735) (-303.671) * (-302.547) [-305.294] (-303.921) (-304.958) -- 0:00:31
506500 -- (-304.079) [-303.938] (-303.181) (-302.919) * [-304.901] (-304.099) (-304.406) (-304.604) -- 0:00:31
507000 -- (-306.142) (-304.548) [-305.902] (-302.429) * (-304.271) (-302.891) [-303.764] (-309.845) -- 0:00:31
507500 -- (-302.156) (-302.616) (-303.910) [-304.519] * (-303.940) (-303.413) (-302.976) [-303.634] -- 0:00:31
508000 -- (-302.951) [-303.573] (-305.068) (-305.620) * (-306.486) [-303.953] (-303.093) (-302.944) -- 0:00:30
508500 -- (-308.277) (-303.703) [-306.175] (-305.319) * [-304.379] (-306.878) (-303.696) (-304.961) -- 0:00:30
509000 -- (-305.653) [-304.087] (-305.805) (-304.215) * (-302.705) (-303.422) (-307.027) [-305.374] -- 0:00:30
509500 -- [-302.512] (-305.787) (-303.988) (-306.118) * (-307.321) (-305.948) (-306.964) [-303.287] -- 0:00:30
510000 -- [-304.779] (-305.454) (-305.487) (-305.548) * (-305.491) (-304.929) [-304.483] (-303.327) -- 0:00:30
Average standard deviation of split frequencies: 0.013077
510500 -- (-307.824) (-303.749) (-304.662) [-303.109] * [-306.276] (-311.552) (-305.853) (-303.265) -- 0:00:30
511000 -- (-304.891) (-302.413) [-302.708] (-303.407) * (-305.909) (-309.312) (-307.527) [-303.520] -- 0:00:30
511500 -- (-307.981) [-302.849] (-305.956) (-306.116) * [-304.880] (-308.667) (-305.375) (-304.794) -- 0:00:30
512000 -- (-305.499) (-303.494) (-302.592) [-302.918] * (-303.697) (-305.653) (-305.211) [-304.555] -- 0:00:30
512500 -- [-304.244] (-308.044) (-306.014) (-302.614) * [-302.706] (-304.030) (-301.962) (-303.785) -- 0:00:30
513000 -- [-302.570] (-304.750) (-302.683) (-303.893) * [-302.661] (-306.575) (-304.825) (-306.133) -- 0:00:30
513500 -- [-304.150] (-303.939) (-306.309) (-303.008) * (-304.531) (-303.252) [-302.818] (-303.984) -- 0:00:30
514000 -- (-303.545) [-302.863] (-309.413) (-304.267) * (-305.779) (-304.208) (-305.039) [-302.771] -- 0:00:30
514500 -- (-302.703) (-305.440) (-304.595) [-304.828] * (-303.978) (-302.790) (-303.507) [-304.117] -- 0:00:30
515000 -- (-302.371) (-303.843) [-303.685] (-303.276) * (-304.532) (-305.155) [-302.792] (-303.649) -- 0:00:30
Average standard deviation of split frequencies: 0.012736
515500 -- (-302.907) (-304.413) (-304.571) [-304.046] * (-306.052) (-309.271) [-304.399] (-304.104) -- 0:00:30
516000 -- [-304.654] (-303.981) (-303.616) (-308.576) * (-308.138) [-303.210] (-305.956) (-304.391) -- 0:00:30
516500 -- (-307.323) [-303.665] (-303.218) (-303.883) * (-306.233) [-302.708] (-304.541) (-304.277) -- 0:00:29
517000 -- (-305.397) (-303.599) [-302.780] (-305.601) * (-304.311) (-304.353) [-304.639] (-303.630) -- 0:00:30
517500 -- [-307.451] (-302.950) (-305.332) (-310.251) * (-306.418) (-303.738) (-311.010) [-303.438] -- 0:00:30
518000 -- [-307.265] (-304.857) (-306.843) (-305.035) * (-308.633) (-305.065) [-303.703] (-302.897) -- 0:00:30
518500 -- (-309.494) (-304.037) [-304.978] (-303.493) * (-304.095) [-304.863] (-306.139) (-304.858) -- 0:00:30
519000 -- (-305.836) [-304.063] (-309.861) (-302.497) * (-304.205) (-303.735) [-304.701] (-304.439) -- 0:00:30
519500 -- (-303.911) [-304.054] (-306.292) (-305.599) * (-303.973) (-302.744) [-302.156] (-303.192) -- 0:00:30
520000 -- (-304.532) [-302.525] (-308.163) (-304.831) * [-302.601] (-304.605) (-304.603) (-302.961) -- 0:00:30
Average standard deviation of split frequencies: 0.012977
520500 -- [-302.951] (-304.283) (-306.716) (-304.205) * (-302.873) (-304.547) (-307.459) [-303.633] -- 0:00:30
521000 -- [-304.916] (-307.112) (-303.130) (-304.357) * (-302.976) (-303.668) [-303.720] (-303.026) -- 0:00:30
521500 -- [-303.962] (-302.271) (-308.222) (-303.679) * (-309.398) (-302.120) (-303.469) [-303.537] -- 0:00:30
522000 -- (-302.874) (-303.944) (-304.506) [-302.707] * (-309.051) [-303.890] (-303.171) (-304.359) -- 0:00:30
522500 -- (-303.588) [-303.546] (-304.879) (-303.396) * [-304.376] (-302.629) (-307.026) (-305.657) -- 0:00:30
523000 -- (-303.249) (-304.654) [-303.905] (-303.688) * (-303.070) (-303.250) (-304.705) [-303.529] -- 0:00:30
523500 -- (-304.202) (-304.110) [-303.779] (-307.976) * (-307.929) (-303.575) (-302.576) [-308.176] -- 0:00:30
524000 -- [-303.733] (-303.053) (-307.918) (-308.844) * (-305.360) (-303.179) [-303.046] (-302.508) -- 0:00:29
524500 -- (-303.585) [-304.826] (-308.803) (-305.503) * (-302.559) (-306.188) (-303.214) [-302.323] -- 0:00:29
525000 -- [-304.409] (-304.326) (-304.602) (-305.619) * (-304.512) (-303.805) (-302.655) [-302.284] -- 0:00:29
Average standard deviation of split frequencies: 0.013294
525500 -- [-304.388] (-302.789) (-304.160) (-303.758) * (-304.168) (-305.548) [-302.407] (-302.797) -- 0:00:29
526000 -- (-305.107) [-303.787] (-306.028) (-304.508) * (-304.029) [-304.402] (-303.705) (-303.334) -- 0:00:29
526500 -- (-303.021) (-307.394) (-304.143) [-306.154] * (-302.546) [-303.482] (-302.749) (-302.624) -- 0:00:29
527000 -- [-302.878] (-303.856) (-310.251) (-305.938) * (-304.118) (-304.101) (-304.461) [-302.864] -- 0:00:29
527500 -- [-302.905] (-302.345) (-305.493) (-305.743) * [-304.437] (-305.759) (-306.314) (-303.075) -- 0:00:29
528000 -- (-309.564) [-302.369] (-310.353) (-302.516) * (-301.855) [-305.115] (-302.630) (-302.313) -- 0:00:29
528500 -- (-305.130) (-303.855) [-304.775] (-304.686) * [-302.361] (-306.007) (-308.914) (-304.167) -- 0:00:29
529000 -- (-303.991) (-309.790) [-305.057] (-304.296) * (-304.033) (-306.568) [-304.571] (-305.168) -- 0:00:29
529500 -- (-306.118) (-310.636) [-304.203] (-305.414) * (-302.512) (-306.378) [-303.125] (-304.108) -- 0:00:29
530000 -- (-303.801) (-310.446) (-304.065) [-305.011] * (-306.991) (-305.491) [-303.301] (-303.516) -- 0:00:29
Average standard deviation of split frequencies: 0.013226
530500 -- (-304.705) (-304.438) [-302.403] (-302.780) * [-303.633] (-303.600) (-305.951) (-304.654) -- 0:00:29
531000 -- [-305.342] (-304.044) (-302.711) (-302.238) * (-303.028) [-305.268] (-304.160) (-302.689) -- 0:00:29
531500 -- (-305.880) (-304.904) [-304.605] (-303.822) * (-303.381) [-304.224] (-303.324) (-308.595) -- 0:00:29
532000 -- (-305.224) [-304.595] (-304.755) (-303.990) * (-305.079) (-302.733) [-302.924] (-303.760) -- 0:00:29
532500 -- (-305.889) (-302.406) [-304.276] (-305.179) * (-305.344) (-302.668) (-304.640) [-303.746] -- 0:00:28
533000 -- (-305.877) (-303.509) [-304.395] (-303.709) * (-303.653) (-307.361) [-304.529] (-302.371) -- 0:00:28
533500 -- (-303.351) [-307.769] (-306.390) (-304.467) * (-304.903) (-303.717) [-304.108] (-307.366) -- 0:00:28
534000 -- (-304.449) (-302.235) (-304.497) [-303.317] * (-307.431) (-302.877) (-306.048) [-306.750] -- 0:00:28
534500 -- (-302.923) [-301.953] (-303.002) (-303.112) * [-306.691] (-303.294) (-302.967) (-309.741) -- 0:00:29
535000 -- (-308.869) (-306.519) [-306.851] (-305.353) * (-303.661) (-303.915) (-304.358) [-302.710] -- 0:00:29
Average standard deviation of split frequencies: 0.014365
535500 -- (-307.366) (-310.283) [-304.151] (-304.524) * [-302.524] (-305.811) (-304.166) (-302.456) -- 0:00:29
536000 -- (-305.663) [-304.611] (-303.115) (-310.096) * (-308.164) (-303.999) [-305.656] (-303.369) -- 0:00:29
536500 -- (-305.635) [-302.249] (-303.935) (-305.185) * (-303.424) [-303.153] (-307.469) (-306.600) -- 0:00:29
537000 -- (-305.976) (-304.893) (-303.324) [-303.050] * (-303.434) [-302.978] (-303.391) (-302.433) -- 0:00:29
537500 -- (-302.912) [-302.194] (-304.129) (-305.200) * [-306.926] (-304.760) (-303.602) (-305.825) -- 0:00:29
538000 -- (-302.371) (-302.964) [-303.750] (-303.007) * (-302.854) (-304.988) (-304.165) [-303.183] -- 0:00:29
538500 -- (-303.964) (-305.782) [-303.400] (-303.255) * [-302.726] (-304.725) (-305.198) (-307.063) -- 0:00:29
539000 -- (-306.556) [-302.217] (-302.151) (-303.579) * (-302.895) [-306.218] (-302.361) (-304.835) -- 0:00:29
539500 -- [-303.060] (-304.622) (-304.970) (-304.896) * (-305.300) [-305.336] (-304.030) (-305.598) -- 0:00:29
540000 -- [-304.090] (-304.221) (-302.885) (-306.181) * (-305.784) [-304.326] (-302.797) (-306.398) -- 0:00:28
Average standard deviation of split frequencies: 0.013321
540500 -- (-304.519) (-305.236) [-303.482] (-304.346) * (-305.076) (-305.401) [-302.562] (-302.452) -- 0:00:28
541000 -- [-306.045] (-305.334) (-304.182) (-303.615) * (-306.058) [-303.327] (-303.064) (-305.672) -- 0:00:28
541500 -- (-308.286) [-302.203] (-304.901) (-304.137) * (-304.271) (-304.113) (-308.859) [-303.167] -- 0:00:28
542000 -- [-304.740] (-302.352) (-303.495) (-304.212) * (-304.150) [-306.182] (-305.471) (-308.346) -- 0:00:28
542500 -- (-303.617) [-303.582] (-303.413) (-306.518) * (-302.601) (-303.764) [-302.619] (-304.336) -- 0:00:28
543000 -- [-304.426] (-304.504) (-302.042) (-305.278) * (-309.282) (-306.914) [-304.411] (-307.299) -- 0:00:28
543500 -- (-304.499) (-303.415) [-302.202] (-303.392) * (-305.382) (-306.570) [-303.778] (-304.712) -- 0:00:28
544000 -- (-307.395) (-304.995) [-302.586] (-303.361) * [-303.396] (-306.641) (-303.793) (-305.582) -- 0:00:28
544500 -- (-303.631) (-303.767) [-302.897] (-304.325) * (-305.290) (-303.671) (-306.725) [-304.347] -- 0:00:28
545000 -- (-305.107) [-303.098] (-303.868) (-306.729) * (-303.314) (-303.497) (-303.540) [-304.017] -- 0:00:28
Average standard deviation of split frequencies: 0.013622
545500 -- [-303.184] (-307.734) (-305.434) (-308.984) * [-305.173] (-306.050) (-304.160) (-303.939) -- 0:00:28
546000 -- (-303.911) (-303.984) [-303.075] (-308.437) * (-304.009) (-304.809) (-306.200) [-303.759] -- 0:00:28
546500 -- (-310.259) (-307.141) [-302.807] (-304.983) * (-308.735) (-303.464) (-304.972) [-304.559] -- 0:00:28
547000 -- (-303.010) (-306.497) (-304.553) [-302.338] * [-303.257] (-305.655) (-305.593) (-303.896) -- 0:00:28
547500 -- (-302.038) [-303.566] (-303.680) (-302.995) * (-305.681) (-303.154) (-302.948) [-304.046] -- 0:00:28
548000 -- (-303.496) (-304.660) [-303.763] (-304.748) * (-305.016) (-306.743) [-303.360] (-304.228) -- 0:00:28
548500 -- (-302.271) [-304.524] (-306.031) (-302.806) * (-305.541) [-308.243] (-307.360) (-302.742) -- 0:00:27
549000 -- [-304.022] (-304.419) (-304.694) (-308.502) * (-305.636) (-305.697) (-304.973) [-302.214] -- 0:00:27
549500 -- (-307.614) (-302.158) (-305.799) [-303.587] * (-308.785) (-304.524) [-303.429] (-304.386) -- 0:00:27
550000 -- (-302.996) [-302.606] (-306.285) (-304.902) * [-303.743] (-303.879) (-302.249) (-307.314) -- 0:00:27
Average standard deviation of split frequencies: 0.013364
550500 -- (-303.573) [-302.547] (-304.817) (-304.268) * [-302.667] (-304.571) (-305.936) (-308.453) -- 0:00:27
551000 -- (-303.206) (-304.402) (-305.003) [-305.215] * [-304.612] (-304.989) (-308.879) (-304.329) -- 0:00:27
551500 -- (-302.963) (-305.887) (-305.066) [-302.250] * (-302.386) (-305.582) [-302.547] (-304.572) -- 0:00:28
552000 -- (-304.312) (-307.303) [-304.784] (-303.416) * (-301.987) (-306.168) [-303.090] (-304.286) -- 0:00:28
552500 -- (-304.208) (-305.861) (-307.684) [-303.984] * (-304.516) (-306.521) (-302.836) [-306.763] -- 0:00:28
553000 -- (-304.383) (-305.055) [-303.080] (-303.711) * (-302.878) (-303.226) [-303.193] (-303.086) -- 0:00:28
553500 -- (-303.493) (-302.913) (-305.098) [-302.991] * (-303.715) (-302.853) (-303.181) [-303.580] -- 0:00:28
554000 -- (-303.527) (-304.670) (-303.815) [-304.777] * (-303.664) [-301.819] (-302.428) (-303.977) -- 0:00:28
554500 -- (-303.137) (-309.475) [-305.553] (-303.466) * (-303.781) (-305.251) [-303.097] (-303.188) -- 0:00:28
555000 -- (-304.258) (-303.451) [-304.487] (-303.389) * [-302.708] (-303.157) (-307.646) (-303.229) -- 0:00:28
Average standard deviation of split frequencies: 0.013754
555500 -- (-303.940) (-303.688) [-304.149] (-305.911) * (-303.283) (-302.331) [-303.318] (-303.839) -- 0:00:28
556000 -- (-302.578) [-303.840] (-308.639) (-302.559) * (-305.004) (-303.388) (-305.031) [-302.543] -- 0:00:27
556500 -- (-303.083) (-304.512) [-303.012] (-303.540) * [-303.380] (-306.048) (-304.511) (-303.526) -- 0:00:27
557000 -- (-305.894) (-302.952) [-305.423] (-302.398) * [-307.644] (-307.151) (-306.268) (-303.538) -- 0:00:27
557500 -- (-307.054) (-304.848) [-306.088] (-305.957) * [-303.569] (-304.151) (-303.044) (-305.889) -- 0:00:27
558000 -- (-302.083) [-302.280] (-303.595) (-305.546) * (-304.738) (-303.935) [-303.274] (-304.834) -- 0:00:27
558500 -- (-308.013) [-302.888] (-305.290) (-303.522) * (-301.948) (-305.894) (-303.603) [-305.228] -- 0:00:27
559000 -- (-304.008) [-306.178] (-304.943) (-304.588) * (-304.407) [-308.381] (-305.001) (-303.702) -- 0:00:27
559500 -- (-305.607) (-303.206) [-305.590] (-303.523) * (-305.193) (-305.569) (-303.043) [-302.697] -- 0:00:27
560000 -- (-303.251) (-307.007) [-306.240] (-306.045) * (-310.286) [-307.548] (-307.373) (-302.633) -- 0:00:27
Average standard deviation of split frequencies: 0.013593
560500 -- [-303.741] (-303.190) (-308.691) (-303.235) * [-307.909] (-304.381) (-305.982) (-303.897) -- 0:00:27
561000 -- (-309.973) (-303.052) [-303.784] (-302.644) * [-306.242] (-305.948) (-311.476) (-306.020) -- 0:00:27
561500 -- (-302.886) (-303.198) (-302.832) [-302.930] * (-308.875) (-306.623) (-308.825) [-302.573] -- 0:00:27
562000 -- (-304.014) (-303.312) (-302.671) [-304.584] * [-305.564] (-304.287) (-303.596) (-304.059) -- 0:00:27
562500 -- [-306.280] (-303.617) (-302.464) (-305.109) * (-305.584) (-303.667) [-303.363] (-302.547) -- 0:00:27
563000 -- [-305.938] (-302.543) (-303.508) (-311.598) * (-304.516) (-306.705) [-303.289] (-303.022) -- 0:00:27
563500 -- (-302.798) [-305.005] (-303.044) (-304.029) * (-304.656) (-313.833) [-307.245] (-305.256) -- 0:00:27
564000 -- [-303.806] (-308.028) (-303.134) (-303.962) * [-303.590] (-304.802) (-305.882) (-304.088) -- 0:00:27
564500 -- (-302.568) [-306.368] (-304.342) (-305.586) * (-304.174) (-303.717) (-309.472) [-305.999] -- 0:00:27
565000 -- (-304.625) (-305.808) [-301.937] (-304.026) * [-303.222] (-304.204) (-303.746) (-304.702) -- 0:00:26
Average standard deviation of split frequencies: 0.013927
565500 -- (-303.576) (-303.920) [-304.101] (-307.687) * (-307.025) (-303.089) [-304.036] (-303.837) -- 0:00:26
566000 -- [-302.641] (-305.477) (-304.349) (-302.853) * [-302.257] (-304.099) (-303.988) (-303.601) -- 0:00:26
566500 -- [-302.306] (-310.171) (-302.869) (-303.305) * (-306.180) [-303.367] (-303.782) (-304.164) -- 0:00:26
567000 -- (-304.475) (-307.031) (-304.711) [-307.851] * (-305.108) (-309.120) [-304.705] (-302.826) -- 0:00:26
567500 -- (-304.618) (-303.380) [-303.351] (-302.741) * (-311.609) (-302.847) (-304.418) [-307.632] -- 0:00:26
568000 -- (-305.200) [-302.958] (-302.779) (-303.656) * (-303.846) (-303.401) [-302.870] (-304.051) -- 0:00:26
568500 -- (-303.327) (-303.915) [-305.298] (-303.158) * (-303.123) (-304.101) [-305.195] (-302.873) -- 0:00:26
569000 -- (-302.736) (-304.427) (-302.382) [-304.638] * (-302.765) (-306.164) [-306.922] (-304.961) -- 0:00:27
569500 -- (-304.252) (-303.092) [-302.819] (-304.612) * (-303.651) (-304.307) [-306.870] (-307.665) -- 0:00:27
570000 -- (-307.789) (-302.723) [-303.741] (-304.170) * [-302.244] (-303.960) (-305.672) (-308.108) -- 0:00:27
Average standard deviation of split frequencies: 0.014043
570500 -- (-304.942) [-302.794] (-304.642) (-308.954) * (-302.129) (-303.160) [-305.618] (-302.524) -- 0:00:27
571000 -- (-301.941) (-303.931) [-304.208] (-305.481) * (-303.084) [-302.950] (-303.730) (-302.737) -- 0:00:27
571500 -- [-302.437] (-302.542) (-302.748) (-302.763) * (-303.599) [-302.682] (-304.389) (-304.692) -- 0:00:26
572000 -- (-303.825) [-302.636] (-302.507) (-303.183) * (-303.656) (-302.290) (-303.130) [-305.419] -- 0:00:26
572500 -- (-310.326) [-303.389] (-306.626) (-304.967) * (-305.747) (-303.446) (-307.185) [-303.170] -- 0:00:26
573000 -- [-306.187] (-305.336) (-303.380) (-305.844) * (-303.565) (-307.595) [-302.328] (-304.010) -- 0:00:26
573500 -- [-302.924] (-303.691) (-303.878) (-312.678) * (-305.813) [-303.641] (-302.950) (-303.172) -- 0:00:26
574000 -- (-306.764) (-307.185) (-305.559) [-306.467] * (-307.070) (-307.100) (-303.164) [-304.472] -- 0:00:26
574500 -- (-305.113) (-307.064) (-304.827) [-308.036] * (-305.377) (-307.730) (-305.558) [-303.799] -- 0:00:26
575000 -- [-303.669] (-304.696) (-304.912) (-303.859) * (-307.012) (-306.376) [-305.421] (-302.760) -- 0:00:26
Average standard deviation of split frequencies: 0.015186
575500 -- (-304.846) (-306.002) [-304.363] (-304.826) * (-303.453) [-304.936] (-304.234) (-306.042) -- 0:00:26
576000 -- (-302.905) (-306.939) [-305.216] (-303.749) * (-303.308) [-303.172] (-305.007) (-301.982) -- 0:00:26
576500 -- (-306.282) (-302.790) [-304.285] (-306.298) * [-307.669] (-304.060) (-304.923) (-304.789) -- 0:00:26
577000 -- (-302.876) (-305.143) (-307.853) [-307.661] * (-305.436) (-303.705) [-304.694] (-303.881) -- 0:00:26
577500 -- (-306.273) [-304.020] (-303.537) (-310.773) * (-303.613) [-304.239] (-303.592) (-303.151) -- 0:00:26
578000 -- [-303.615] (-305.223) (-304.717) (-307.451) * [-304.373] (-307.769) (-303.112) (-305.088) -- 0:00:26
578500 -- (-307.488) (-302.302) [-305.113] (-312.781) * (-306.506) (-305.248) (-305.196) [-303.642] -- 0:00:26
579000 -- (-305.339) (-304.337) [-304.245] (-312.402) * [-302.294] (-306.443) (-304.126) (-307.176) -- 0:00:26
579500 -- (-305.723) [-302.753] (-304.626) (-303.940) * (-309.238) (-307.777) [-306.335] (-306.726) -- 0:00:26
580000 -- (-308.920) [-304.058] (-302.649) (-309.056) * (-306.552) (-303.643) (-304.289) [-303.460] -- 0:00:26
Average standard deviation of split frequencies: 0.014974
580500 -- (-302.862) [-304.143] (-303.525) (-304.697) * (-303.484) (-307.366) [-304.306] (-303.259) -- 0:00:26
581000 -- (-304.925) (-304.693) [-302.713] (-307.043) * (-309.532) [-304.273] (-305.765) (-304.970) -- 0:00:25
581500 -- (-304.623) (-302.551) (-305.527) [-303.399] * (-305.150) (-306.197) (-309.293) [-304.399] -- 0:00:25
582000 -- [-303.424] (-306.797) (-306.756) (-302.244) * (-306.055) (-309.206) (-305.113) [-304.391] -- 0:00:25
582500 -- [-304.625] (-306.048) (-305.018) (-304.394) * (-302.485) (-310.392) (-306.650) [-306.548] -- 0:00:25
583000 -- [-305.139] (-302.171) (-303.700) (-303.327) * [-301.994] (-306.880) (-305.093) (-302.535) -- 0:00:25
583500 -- (-304.495) [-303.289] (-302.484) (-303.627) * (-301.982) (-305.254) [-302.785] (-305.136) -- 0:00:25
584000 -- (-304.311) (-303.851) [-304.160] (-306.074) * (-303.056) [-307.209] (-304.534) (-308.268) -- 0:00:25
584500 -- [-304.073] (-306.015) (-302.244) (-304.602) * (-302.517) [-303.665] (-304.470) (-304.284) -- 0:00:25
585000 -- [-302.947] (-305.580) (-305.767) (-304.912) * (-302.502) (-303.470) (-302.125) [-304.204] -- 0:00:25
Average standard deviation of split frequencies: 0.014748
585500 -- (-302.955) [-304.285] (-304.287) (-304.570) * (-304.396) [-303.363] (-307.035) (-307.883) -- 0:00:25
586000 -- (-306.410) [-302.980] (-307.634) (-312.066) * (-302.789) [-307.255] (-305.290) (-305.195) -- 0:00:26
586500 -- (-302.814) (-303.489) (-304.448) [-305.364] * [-310.259] (-305.766) (-302.648) (-303.751) -- 0:00:26
587000 -- (-302.730) [-302.788] (-302.867) (-302.890) * (-303.389) (-302.380) [-304.055] (-309.104) -- 0:00:26
587500 -- (-304.269) [-304.735] (-302.951) (-303.284) * (-304.638) (-304.844) [-306.640] (-305.776) -- 0:00:25
588000 -- (-303.925) (-305.027) (-303.422) [-308.515] * (-303.589) (-302.935) [-307.602] (-304.127) -- 0:00:25
588500 -- (-306.441) (-305.601) (-306.608) [-306.648] * (-303.259) (-304.542) [-305.156] (-307.358) -- 0:00:25
589000 -- [-304.208] (-304.274) (-303.683) (-306.705) * [-305.161] (-305.010) (-303.528) (-303.715) -- 0:00:25
589500 -- (-304.784) (-303.021) (-303.764) [-303.384] * (-304.113) (-307.439) (-304.105) [-304.044] -- 0:00:25
590000 -- (-302.549) (-305.214) (-303.985) [-304.918] * (-302.378) [-305.793] (-305.215) (-303.887) -- 0:00:25
Average standard deviation of split frequencies: 0.014986
590500 -- (-304.784) (-306.614) (-305.430) [-305.383] * (-307.167) (-306.882) [-304.314] (-307.565) -- 0:00:25
591000 -- [-303.031] (-303.537) (-305.383) (-302.763) * (-303.072) (-304.265) [-305.822] (-304.803) -- 0:00:25
591500 -- (-302.858) (-303.554) (-311.113) [-302.675] * (-303.671) (-302.789) [-308.316] (-304.249) -- 0:00:25
592000 -- (-303.902) (-303.546) [-306.503] (-302.925) * (-304.330) (-302.742) [-304.598] (-303.206) -- 0:00:25
592500 -- (-304.777) (-305.614) [-302.933] (-304.623) * (-302.963) (-305.061) (-302.460) [-302.435] -- 0:00:25
593000 -- (-308.437) [-306.301] (-305.546) (-302.380) * (-303.564) (-308.002) (-302.592) [-302.997] -- 0:00:25
593500 -- (-306.526) (-304.512) [-303.265] (-303.268) * [-305.558] (-304.585) (-302.774) (-306.000) -- 0:00:25
594000 -- (-307.401) (-305.296) [-303.546] (-302.608) * [-305.692] (-303.065) (-306.265) (-306.149) -- 0:00:25
594500 -- (-305.575) (-306.634) [-304.492] (-303.193) * (-306.255) (-303.404) [-303.456] (-304.800) -- 0:00:25
595000 -- (-303.676) [-304.834] (-302.869) (-306.943) * (-312.666) (-303.458) [-303.830] (-303.516) -- 0:00:25
Average standard deviation of split frequencies: 0.014545
595500 -- (-307.737) (-304.344) [-304.309] (-303.642) * (-308.354) (-303.223) (-307.341) [-304.040] -- 0:00:25
596000 -- (-304.364) [-304.807] (-305.961) (-303.771) * (-312.788) (-304.953) (-303.973) [-304.948] -- 0:00:25
596500 -- (-304.291) (-306.184) [-302.619] (-308.778) * (-303.903) (-304.023) [-306.710] (-305.561) -- 0:00:25
597000 -- (-305.629) (-307.052) (-303.488) [-304.988] * [-305.047] (-305.548) (-303.862) (-303.836) -- 0:00:24
597500 -- (-305.610) (-304.388) (-303.778) [-304.174] * (-305.891) (-302.720) [-303.841] (-306.375) -- 0:00:24
598000 -- (-306.391) [-305.652] (-303.891) (-302.567) * [-303.273] (-302.967) (-305.101) (-305.609) -- 0:00:24
598500 -- [-302.144] (-302.880) (-304.485) (-303.491) * [-302.279] (-304.178) (-304.216) (-304.085) -- 0:00:24
599000 -- (-303.106) (-305.210) (-304.177) [-303.117] * (-303.324) (-309.505) [-302.716] (-302.105) -- 0:00:24
599500 -- (-306.776) [-308.803] (-302.766) (-302.815) * [-303.333] (-304.401) (-303.394) (-310.025) -- 0:00:24
600000 -- (-304.599) [-305.632] (-305.352) (-301.916) * (-302.373) (-303.214) (-302.448) [-308.506] -- 0:00:24
Average standard deviation of split frequencies: 0.015129
600500 -- [-304.054] (-303.072) (-305.124) (-303.820) * [-306.216] (-304.365) (-305.753) (-305.834) -- 0:00:24
601000 -- (-307.104) (-305.612) [-306.499] (-305.017) * (-305.272) (-303.998) (-302.447) [-303.815] -- 0:00:24
601500 -- (-304.255) (-307.819) [-303.555] (-307.088) * (-303.899) [-304.389] (-303.845) (-305.251) -- 0:00:24
602000 -- (-307.444) (-304.161) (-305.697) [-302.550] * (-302.721) (-304.382) (-304.551) [-303.980] -- 0:00:25
602500 -- (-305.119) (-305.744) (-302.710) [-303.491] * (-302.701) (-302.851) (-303.491) [-305.408] -- 0:00:25
603000 -- (-307.963) (-308.029) [-304.833] (-306.474) * [-302.461] (-302.590) (-304.799) (-307.574) -- 0:00:25
603500 -- [-306.975] (-307.214) (-305.825) (-302.331) * (-310.299) (-302.764) (-306.812) [-303.531] -- 0:00:24
604000 -- (-303.533) [-302.592] (-303.115) (-304.223) * [-308.498] (-303.809) (-302.976) (-306.977) -- 0:00:24
604500 -- (-305.072) [-304.620] (-304.943) (-304.467) * (-307.854) [-303.875] (-304.277) (-309.636) -- 0:00:24
605000 -- (-303.181) (-304.818) [-305.893] (-311.284) * (-304.554) (-303.383) (-302.086) [-305.283] -- 0:00:24
Average standard deviation of split frequencies: 0.014045
605500 -- (-303.801) [-304.110] (-303.905) (-313.622) * (-304.468) (-305.494) (-302.289) [-305.173] -- 0:00:24
606000 -- (-304.667) [-303.833] (-304.116) (-310.880) * [-302.882] (-305.591) (-302.792) (-306.995) -- 0:00:24
606500 -- (-305.720) [-305.258] (-305.118) (-305.835) * (-304.124) (-305.471) (-304.423) [-303.178] -- 0:00:24
607000 -- (-303.168) (-303.772) (-304.277) [-306.450] * (-304.001) (-304.209) [-304.455] (-302.072) -- 0:00:24
607500 -- (-305.192) (-304.609) (-303.851) [-309.157] * [-303.085] (-302.611) (-304.821) (-306.023) -- 0:00:24
608000 -- (-307.838) (-303.244) [-304.040] (-305.085) * (-306.082) (-305.832) [-303.237] (-308.473) -- 0:00:24
608500 -- [-303.806] (-307.113) (-303.160) (-302.875) * [-307.401] (-307.487) (-303.755) (-306.073) -- 0:00:24
609000 -- (-311.514) (-302.834) [-304.694] (-303.697) * (-305.689) (-303.043) (-304.291) [-303.662] -- 0:00:24
609500 -- (-305.641) (-303.514) [-303.703] (-302.644) * (-304.269) (-303.149) [-304.128] (-302.910) -- 0:00:24
610000 -- (-303.445) (-307.738) [-303.526] (-304.891) * [-304.237] (-305.198) (-302.415) (-302.908) -- 0:00:24
Average standard deviation of split frequencies: 0.013852
610500 -- [-305.294] (-307.597) (-305.022) (-303.126) * (-307.374) (-302.932) (-304.143) [-303.326] -- 0:00:24
611000 -- (-304.512) [-304.579] (-305.259) (-305.217) * (-308.278) (-302.900) (-306.305) [-303.374] -- 0:00:24
611500 -- (-303.335) (-305.742) [-309.655] (-307.777) * [-306.579] (-303.509) (-304.438) (-304.141) -- 0:00:24
612000 -- [-303.726] (-306.869) (-304.854) (-303.697) * [-306.156] (-302.282) (-306.735) (-304.698) -- 0:00:24
612500 -- [-304.497] (-305.909) (-303.184) (-302.968) * (-304.723) (-303.855) (-304.410) [-304.003] -- 0:00:24
613000 -- (-302.980) (-306.869) [-302.919] (-302.712) * (-305.128) (-302.844) [-303.164] (-304.823) -- 0:00:23
613500 -- (-304.012) [-302.147] (-302.384) (-303.961) * (-302.499) [-303.761] (-303.034) (-304.127) -- 0:00:23
614000 -- (-306.709) [-303.537] (-305.519) (-303.923) * (-303.943) (-302.214) [-307.052] (-303.641) -- 0:00:23
614500 -- [-306.245] (-303.490) (-306.121) (-304.851) * [-304.961] (-302.749) (-303.358) (-304.062) -- 0:00:23
615000 -- (-306.031) (-302.522) (-303.020) [-304.145] * (-305.391) (-304.122) (-305.790) [-303.825] -- 0:00:23
Average standard deviation of split frequencies: 0.012829
615500 -- (-303.519) [-304.570] (-303.902) (-303.174) * [-304.478] (-310.356) (-303.889) (-303.810) -- 0:00:23
616000 -- (-302.685) [-304.032] (-305.085) (-303.072) * (-309.372) [-307.053] (-305.090) (-304.732) -- 0:00:23
616500 -- (-304.214) (-303.312) (-306.703) [-304.239] * (-306.407) (-308.139) (-304.410) [-307.468] -- 0:00:23
617000 -- (-305.023) (-303.169) (-305.300) [-302.295] * [-306.352] (-303.905) (-305.254) (-305.027) -- 0:00:23
617500 -- (-303.644) (-304.889) (-305.062) [-305.080] * (-305.443) (-302.747) (-303.496) [-302.379] -- 0:00:23
618000 -- (-304.460) [-303.739] (-304.272) (-304.080) * (-307.473) [-304.378] (-304.295) (-308.462) -- 0:00:24
618500 -- [-302.460] (-303.772) (-303.504) (-305.374) * (-305.011) [-304.992] (-306.070) (-303.606) -- 0:00:24
619000 -- (-303.996) (-305.379) [-305.166] (-303.674) * (-302.843) [-305.056] (-307.320) (-312.525) -- 0:00:24
619500 -- (-305.025) [-305.617] (-303.088) (-304.357) * [-307.110] (-303.029) (-305.580) (-305.013) -- 0:00:23
620000 -- [-302.529] (-304.633) (-307.989) (-306.007) * [-303.680] (-304.784) (-303.850) (-303.524) -- 0:00:23
Average standard deviation of split frequencies: 0.012510
620500 -- (-306.339) [-303.124] (-304.117) (-307.939) * (-302.724) [-302.548] (-302.558) (-307.013) -- 0:00:23
621000 -- (-308.180) [-303.528] (-305.827) (-306.270) * [-302.710] (-302.403) (-303.624) (-310.185) -- 0:00:23
621500 -- (-303.277) (-302.369) [-305.867] (-307.726) * [-308.526] (-306.085) (-303.782) (-303.586) -- 0:00:23
622000 -- (-304.922) [-303.173] (-306.771) (-303.301) * (-305.596) (-302.518) [-304.375] (-304.282) -- 0:00:23
622500 -- (-303.230) (-306.833) (-306.469) [-307.693] * (-304.758) [-303.219] (-307.169) (-308.238) -- 0:00:23
623000 -- [-306.221] (-303.287) (-304.037) (-303.650) * (-302.723) (-304.266) (-308.524) [-303.722] -- 0:00:23
623500 -- (-308.911) (-308.528) [-303.333] (-303.823) * (-305.126) [-305.300] (-310.562) (-304.724) -- 0:00:23
624000 -- (-302.536) (-310.720) [-304.375] (-302.459) * (-305.064) (-306.178) [-305.849] (-306.543) -- 0:00:23
624500 -- [-302.569] (-305.349) (-303.429) (-305.838) * (-306.170) (-303.655) (-305.444) [-304.699] -- 0:00:23
625000 -- [-303.665] (-304.592) (-302.874) (-306.284) * (-309.970) [-303.156] (-307.083) (-306.145) -- 0:00:23
Average standard deviation of split frequencies: 0.013346
625500 -- [-303.192] (-303.827) (-303.164) (-302.856) * (-303.007) (-305.695) (-303.981) [-305.906] -- 0:00:23
626000 -- [-303.143] (-305.635) (-304.663) (-302.985) * (-304.120) (-302.566) (-302.105) [-306.139] -- 0:00:23
626500 -- (-306.147) [-304.474] (-303.391) (-304.102) * (-304.230) (-304.388) [-302.113] (-312.089) -- 0:00:23
627000 -- (-305.704) (-305.663) (-304.822) [-303.450] * [-304.185] (-306.604) (-302.846) (-314.436) -- 0:00:23
627500 -- (-303.700) (-302.769) [-303.508] (-311.394) * (-302.605) [-304.869] (-303.189) (-303.105) -- 0:00:23
628000 -- (-302.269) (-305.170) [-302.575] (-305.760) * (-302.651) (-304.398) (-303.774) [-303.334] -- 0:00:23
628500 -- (-302.618) (-311.665) (-302.875) [-304.745] * (-303.888) (-306.286) [-305.320] (-306.584) -- 0:00:23
629000 -- [-303.556] (-306.239) (-302.961) (-303.314) * (-304.255) [-302.766] (-303.526) (-304.573) -- 0:00:23
629500 -- (-303.687) (-302.463) [-303.881] (-306.396) * (-304.180) (-303.569) (-305.000) [-304.338] -- 0:00:22
630000 -- (-303.305) (-304.093) [-305.511] (-305.540) * (-303.652) [-304.108] (-302.238) (-309.204) -- 0:00:22
Average standard deviation of split frequencies: 0.012956
630500 -- (-304.410) [-303.300] (-302.081) (-303.388) * (-309.673) [-302.366] (-303.544) (-305.161) -- 0:00:22
631000 -- (-309.203) [-304.113] (-303.962) (-308.317) * (-303.948) [-308.369] (-302.473) (-303.057) -- 0:00:22
631500 -- (-304.194) (-305.563) [-302.333] (-305.496) * (-303.492) (-303.670) (-304.434) [-305.969] -- 0:00:22
632000 -- (-310.980) (-305.062) (-302.391) [-302.043] * (-304.997) (-308.896) (-303.000) [-302.556] -- 0:00:22
632500 -- (-304.769) (-309.415) [-302.884] (-302.162) * (-308.940) [-304.453] (-302.610) (-306.998) -- 0:00:22
633000 -- [-306.405] (-307.578) (-305.216) (-302.369) * (-303.807) [-304.092] (-302.913) (-307.023) -- 0:00:22
633500 -- (-305.340) (-305.533) (-311.547) [-305.732] * (-302.971) (-303.709) (-302.735) [-303.654] -- 0:00:22
634000 -- [-302.893] (-303.754) (-303.678) (-307.341) * (-302.935) (-302.701) (-307.288) [-302.838] -- 0:00:22
634500 -- (-305.560) (-303.250) (-303.697) [-302.492] * (-304.022) (-302.203) [-303.210] (-302.993) -- 0:00:23
635000 -- [-303.727] (-304.619) (-303.633) (-306.636) * [-303.850] (-302.441) (-304.298) (-304.136) -- 0:00:22
Average standard deviation of split frequencies: 0.013259
635500 -- [-304.008] (-305.614) (-303.836) (-304.957) * (-303.776) (-302.142) (-304.453) [-302.712] -- 0:00:22
636000 -- (-304.807) [-304.189] (-303.328) (-307.603) * (-304.349) (-302.444) [-304.048] (-306.129) -- 0:00:22
636500 -- (-302.888) [-305.535] (-303.167) (-302.934) * (-305.645) (-304.211) [-303.470] (-302.917) -- 0:00:22
637000 -- (-303.048) (-302.730) (-306.918) [-304.522] * (-303.747) [-304.124] (-306.861) (-303.614) -- 0:00:22
637500 -- [-303.782] (-302.903) (-306.809) (-302.518) * (-303.052) (-309.699) [-304.218] (-303.100) -- 0:00:22
638000 -- (-306.321) (-302.870) (-306.703) [-303.248] * (-303.724) (-306.250) [-303.982] (-305.853) -- 0:00:22
638500 -- (-303.329) (-302.435) [-304.691] (-304.656) * (-305.945) (-304.761) [-303.721] (-308.718) -- 0:00:22
639000 -- [-303.019] (-302.522) (-302.725) (-303.892) * (-303.673) [-303.627] (-303.107) (-303.655) -- 0:00:22
639500 -- (-307.131) (-303.435) (-304.109) [-302.022] * (-303.166) (-302.921) [-302.485] (-303.655) -- 0:00:22
640000 -- [-302.527] (-307.280) (-303.472) (-303.847) * (-304.802) (-303.368) (-302.977) [-305.812] -- 0:00:22
Average standard deviation of split frequencies: 0.011773
640500 -- (-304.107) (-309.406) (-304.959) [-309.995] * [-302.416] (-303.849) (-303.010) (-304.265) -- 0:00:22
641000 -- [-308.103] (-303.672) (-306.621) (-303.381) * (-305.360) (-304.026) [-305.736] (-303.459) -- 0:00:22
641500 -- (-304.823) [-304.490] (-303.186) (-306.603) * (-302.158) [-304.771] (-306.030) (-302.788) -- 0:00:22
642000 -- [-303.237] (-303.812) (-305.946) (-304.733) * (-303.399) (-312.783) [-303.307] (-303.585) -- 0:00:22
642500 -- (-305.021) (-303.235) (-303.569) [-305.695] * (-304.685) (-303.782) [-303.500] (-305.015) -- 0:00:22
643000 -- [-305.599] (-303.647) (-305.130) (-306.280) * (-305.388) (-303.275) [-302.971] (-302.202) -- 0:00:22
643500 -- (-306.339) (-306.315) (-310.442) [-303.694] * (-307.882) (-304.148) [-304.734] (-302.009) -- 0:00:22
644000 -- (-303.943) [-306.895] (-308.147) (-303.210) * (-304.820) [-305.851] (-302.997) (-301.829) -- 0:00:22
644500 -- (-305.710) [-302.351] (-308.707) (-302.425) * (-305.522) (-302.879) (-303.463) [-303.640] -- 0:00:22
645000 -- (-305.759) (-304.864) (-310.128) [-302.642] * (-307.772) (-304.272) [-302.420] (-305.721) -- 0:00:22
Average standard deviation of split frequencies: 0.011504
645500 -- (-303.472) (-304.847) [-303.849] (-303.952) * (-304.148) (-302.797) (-304.530) [-305.466] -- 0:00:21
646000 -- (-306.968) [-303.218] (-305.791) (-305.454) * (-307.190) [-303.372] (-308.297) (-305.600) -- 0:00:21
646500 -- (-306.520) (-309.035) (-307.974) [-303.349] * (-301.874) (-308.984) [-303.692] (-304.320) -- 0:00:21
647000 -- (-304.092) [-306.375] (-304.809) (-303.616) * [-305.150] (-303.241) (-308.848) (-302.288) -- 0:00:21
647500 -- (-303.345) (-304.161) (-304.816) [-304.414] * [-305.751] (-303.084) (-302.294) (-305.405) -- 0:00:21
648000 -- (-303.988) [-304.509] (-306.087) (-303.529) * [-303.657] (-308.250) (-303.004) (-304.262) -- 0:00:21
648500 -- (-301.868) (-304.461) [-304.528] (-304.444) * [-302.576] (-305.877) (-303.141) (-304.874) -- 0:00:21
649000 -- [-303.926] (-302.848) (-303.632) (-303.702) * (-302.498) (-303.178) [-302.768] (-305.399) -- 0:00:21
649500 -- (-302.896) (-308.136) (-302.061) [-306.785] * (-302.027) (-306.434) (-305.338) [-306.019] -- 0:00:21
650000 -- [-303.509] (-305.320) (-302.485) (-303.825) * (-305.832) (-304.213) (-302.426) [-302.882] -- 0:00:21
Average standard deviation of split frequencies: 0.011501
650500 -- (-304.649) (-305.957) (-304.426) [-302.330] * (-307.638) (-302.754) (-304.513) [-304.402] -- 0:00:21
651000 -- (-304.333) (-304.270) (-302.735) [-302.656] * (-303.885) (-306.950) (-307.171) [-304.520] -- 0:00:21
651500 -- (-303.140) [-302.693] (-302.135) (-304.470) * (-303.564) (-304.215) [-307.357] (-303.905) -- 0:00:21
652000 -- (-304.620) (-303.259) [-302.612] (-304.454) * (-303.901) (-303.404) [-305.297] (-302.791) -- 0:00:21
652500 -- (-302.564) (-304.542) (-304.599) [-304.078] * [-308.508] (-305.448) (-306.125) (-302.655) -- 0:00:21
653000 -- (-305.393) [-302.387] (-304.570) (-310.384) * (-308.269) (-307.193) [-302.422] (-302.315) -- 0:00:21
653500 -- (-303.995) (-302.359) (-306.342) [-304.436] * (-305.757) (-304.599) [-303.859] (-307.430) -- 0:00:21
654000 -- (-303.261) (-306.126) (-305.398) [-305.586] * [-301.987] (-305.152) (-307.604) (-302.865) -- 0:00:21
654500 -- (-305.730) [-303.479] (-304.379) (-306.173) * [-302.582] (-306.263) (-307.504) (-305.177) -- 0:00:21
655000 -- (-304.296) (-307.150) (-301.941) [-303.125] * [-302.519] (-307.214) (-304.285) (-305.141) -- 0:00:21
Average standard deviation of split frequencies: 0.011371
655500 -- (-307.020) (-307.902) [-303.754] (-305.604) * [-305.620] (-308.093) (-304.279) (-303.790) -- 0:00:21
656000 -- [-303.679] (-302.823) (-303.754) (-304.551) * (-304.075) (-304.055) (-302.715) [-303.103] -- 0:00:21
656500 -- (-305.228) (-307.140) (-306.761) [-303.126] * (-303.930) (-306.972) [-303.427] (-303.554) -- 0:00:21
657000 -- (-305.108) (-307.188) (-302.987) [-303.873] * (-305.008) (-303.771) [-304.197] (-302.060) -- 0:00:21
657500 -- (-305.171) [-306.919] (-302.426) (-307.266) * [-303.133] (-306.960) (-304.290) (-303.095) -- 0:00:21
658000 -- (-304.878) (-303.857) (-303.066) [-302.914] * (-303.730) [-302.916] (-303.092) (-305.132) -- 0:00:21
658500 -- [-303.005] (-301.914) (-302.788) (-303.021) * (-305.701) [-306.064] (-303.642) (-304.681) -- 0:00:21
659000 -- [-303.049] (-303.117) (-302.971) (-303.464) * (-302.848) (-305.129) [-303.724] (-309.225) -- 0:00:21
659500 -- (-304.922) [-302.121] (-304.953) (-306.072) * (-303.540) (-302.823) [-303.477] (-305.288) -- 0:00:21
660000 -- [-305.067] (-308.092) (-304.307) (-308.024) * [-304.064] (-303.582) (-306.041) (-305.416) -- 0:00:21
Average standard deviation of split frequencies: 0.010787
660500 -- (-304.818) (-309.434) (-302.830) [-302.713] * [-305.729] (-303.281) (-304.167) (-303.953) -- 0:00:21
661000 -- (-306.241) (-302.596) (-304.313) [-303.412] * (-302.826) [-304.251] (-306.541) (-304.391) -- 0:00:21
661500 -- [-306.343] (-304.816) (-306.377) (-303.369) * [-306.465] (-302.888) (-304.153) (-305.975) -- 0:00:20
662000 -- (-305.549) (-302.643) (-307.801) [-303.793] * [-303.701] (-304.099) (-305.101) (-304.045) -- 0:00:20
662500 -- (-304.898) [-304.275] (-303.373) (-306.789) * [-310.231] (-305.676) (-303.678) (-306.669) -- 0:00:20
663000 -- (-302.752) (-305.001) [-303.083] (-303.078) * [-305.269] (-306.298) (-304.732) (-304.062) -- 0:00:20
663500 -- (-302.898) (-303.110) [-302.422] (-303.192) * (-304.865) (-304.715) (-303.920) [-303.820] -- 0:00:20
664000 -- (-302.881) [-302.542] (-306.084) (-305.631) * (-303.300) (-306.144) [-303.661] (-304.479) -- 0:00:20
664500 -- (-304.495) (-302.743) (-302.397) [-303.686] * (-305.052) (-304.240) (-305.419) [-306.860] -- 0:00:20
665000 -- (-302.574) [-305.671] (-303.504) (-302.847) * [-303.718] (-304.629) (-310.907) (-307.911) -- 0:00:20
Average standard deviation of split frequencies: 0.010742
665500 -- (-303.640) (-303.462) [-305.463] (-303.142) * [-305.202] (-303.250) (-303.549) (-309.493) -- 0:00:20
666000 -- (-302.214) (-304.389) (-304.449) [-302.251] * (-308.617) [-303.180] (-303.757) (-303.216) -- 0:00:20
666500 -- (-304.876) (-303.359) (-306.652) [-303.419] * [-305.070] (-302.708) (-303.687) (-303.490) -- 0:00:20
667000 -- (-304.485) (-302.695) [-304.781] (-304.767) * (-304.146) (-303.390) [-308.044] (-304.107) -- 0:00:20
667500 -- (-306.649) (-305.233) (-303.555) [-304.266] * (-304.644) [-304.216] (-304.843) (-304.576) -- 0:00:20
668000 -- [-302.154] (-302.907) (-303.759) (-305.088) * (-303.557) [-305.494] (-305.208) (-305.073) -- 0:00:20
668500 -- [-302.613] (-304.047) (-303.856) (-307.240) * (-302.532) [-303.522] (-304.925) (-304.681) -- 0:00:20
669000 -- (-305.272) (-307.084) [-304.652] (-303.200) * (-305.907) (-304.544) (-302.643) [-303.904] -- 0:00:20
669500 -- (-304.432) [-303.000] (-305.782) (-303.351) * (-308.177) [-303.686] (-306.677) (-302.949) -- 0:00:20
670000 -- (-303.493) (-303.919) [-303.213] (-303.811) * [-304.031] (-303.257) (-307.869) (-306.668) -- 0:00:20
Average standard deviation of split frequencies: 0.010957
670500 -- [-302.569] (-305.128) (-303.490) (-308.108) * [-304.565] (-303.281) (-305.621) (-306.333) -- 0:00:20
671000 -- (-303.602) [-304.005] (-302.371) (-306.395) * (-304.865) (-303.136) [-304.032] (-306.241) -- 0:00:20
671500 -- [-303.267] (-302.748) (-304.427) (-303.283) * (-310.949) (-304.117) [-302.790] (-302.351) -- 0:00:20
672000 -- [-305.710] (-303.565) (-306.156) (-306.390) * (-304.813) (-305.289) [-303.058] (-303.166) -- 0:00:20
672500 -- (-305.978) (-304.079) [-302.894] (-307.016) * (-306.035) [-303.992] (-307.766) (-302.456) -- 0:00:20
673000 -- (-306.771) [-302.639] (-302.526) (-308.079) * [-303.769] (-303.542) (-303.442) (-302.451) -- 0:00:20
673500 -- (-303.978) (-304.057) (-303.792) [-303.097] * (-309.969) [-302.537] (-305.604) (-307.622) -- 0:00:20
674000 -- (-304.979) (-312.128) (-302.826) [-304.469] * (-306.378) (-303.875) (-302.753) [-304.990] -- 0:00:20
674500 -- (-305.135) (-305.125) (-302.739) [-308.571] * [-303.213] (-304.935) (-304.152) (-303.322) -- 0:00:20
675000 -- (-307.635) [-306.029] (-302.068) (-308.232) * (-303.055) (-304.690) [-302.864] (-308.389) -- 0:00:20
Average standard deviation of split frequencies: 0.011527
675500 -- [-304.701] (-304.307) (-303.753) (-303.362) * (-304.980) [-305.936] (-303.717) (-303.208) -- 0:00:20
676000 -- [-303.324] (-304.709) (-305.423) (-303.820) * (-303.953) [-303.399] (-303.358) (-304.789) -- 0:00:20
676500 -- (-307.440) (-310.234) (-307.437) [-302.566] * (-304.810) (-302.922) (-303.162) [-303.776] -- 0:00:20
677000 -- (-304.213) (-305.604) (-305.571) [-304.221] * (-305.281) (-305.193) [-302.636] (-302.791) -- 0:00:20
677500 -- [-303.378] (-303.943) (-304.340) (-303.022) * (-303.568) [-303.146] (-303.140) (-303.106) -- 0:00:19
678000 -- (-306.114) (-305.019) (-305.715) [-303.012] * (-307.943) (-302.732) (-304.544) [-302.670] -- 0:00:19
678500 -- (-305.478) (-305.566) (-306.189) [-302.786] * [-304.304] (-304.986) (-303.002) (-303.807) -- 0:00:19
679000 -- (-303.675) [-304.678] (-302.712) (-302.944) * (-302.514) [-303.954] (-302.719) (-306.617) -- 0:00:19
679500 -- (-304.238) [-302.742] (-303.325) (-303.500) * (-305.897) (-303.888) [-304.153] (-306.589) -- 0:00:19
680000 -- [-304.581] (-303.835) (-304.092) (-304.590) * [-302.504] (-302.592) (-304.169) (-302.701) -- 0:00:19
Average standard deviation of split frequencies: 0.010778
680500 -- (-307.487) (-302.086) [-303.292] (-305.008) * (-305.667) [-303.455] (-303.532) (-302.352) -- 0:00:19
681000 -- (-303.377) [-304.080] (-303.159) (-303.828) * (-304.220) [-306.083] (-302.389) (-303.062) -- 0:00:19
681500 -- (-303.421) (-303.624) [-303.964] (-304.638) * (-304.588) (-302.928) [-302.748] (-304.297) -- 0:00:19
682000 -- (-307.026) (-304.889) (-304.306) [-303.427] * (-303.658) [-304.329] (-304.750) (-304.966) -- 0:00:19
682500 -- (-304.944) [-302.093] (-304.781) (-303.475) * (-308.844) (-302.300) (-305.072) [-305.152] -- 0:00:19
683000 -- (-302.558) (-307.665) [-305.154] (-303.548) * (-307.921) (-303.436) (-302.240) [-303.036] -- 0:00:19
683500 -- (-303.405) [-304.440] (-302.758) (-303.676) * (-306.869) [-305.325] (-302.624) (-309.070) -- 0:00:19
684000 -- [-303.536] (-304.186) (-303.883) (-305.512) * (-305.922) (-308.099) (-302.166) [-302.924] -- 0:00:19
684500 -- (-306.036) (-304.044) (-306.603) [-305.041] * (-305.708) (-305.940) [-302.718] (-303.007) -- 0:00:19
685000 -- (-305.867) [-302.285] (-303.171) (-304.900) * (-304.069) (-305.172) [-303.563] (-312.543) -- 0:00:19
Average standard deviation of split frequencies: 0.011210
685500 -- (-307.713) (-303.360) (-302.886) [-304.200] * (-303.018) (-307.662) [-303.639] (-303.406) -- 0:00:19
686000 -- (-305.757) (-306.023) (-304.293) [-305.849] * (-303.362) (-306.974) (-304.332) [-305.977] -- 0:00:19
686500 -- [-306.274] (-304.049) (-305.038) (-305.422) * (-305.508) [-303.890] (-303.655) (-305.121) -- 0:00:19
687000 -- (-306.620) (-305.019) (-302.549) [-303.646] * (-307.123) [-303.246] (-304.408) (-303.067) -- 0:00:19
687500 -- (-302.562) (-306.014) [-302.643] (-307.385) * (-304.304) (-301.925) (-302.818) [-303.875] -- 0:00:19
688000 -- (-302.940) [-304.960] (-303.543) (-303.715) * [-303.322] (-302.370) (-304.400) (-303.704) -- 0:00:19
688500 -- (-303.429) (-308.286) [-304.752] (-303.424) * (-302.375) (-304.371) (-304.344) [-304.164] -- 0:00:19
689000 -- (-304.253) [-302.723] (-315.557) (-302.642) * (-303.866) [-304.393] (-305.870) (-309.732) -- 0:00:19
689500 -- [-302.598] (-307.976) (-303.160) (-302.011) * (-304.043) (-303.420) [-302.153] (-302.515) -- 0:00:19
690000 -- (-304.798) (-304.335) (-308.295) [-303.096] * [-303.708] (-303.362) (-303.481) (-302.686) -- 0:00:19
Average standard deviation of split frequencies: 0.011432
690500 -- (-302.166) (-304.140) [-303.749] (-304.048) * (-307.337) [-302.304] (-305.616) (-307.106) -- 0:00:19
691000 -- (-302.154) (-304.207) (-306.458) [-304.792] * (-308.147) (-306.074) (-304.104) [-307.797] -- 0:00:19
691500 -- (-302.646) [-302.288] (-305.950) (-306.346) * [-303.860] (-303.165) (-304.219) (-304.414) -- 0:00:19
692000 -- (-303.637) (-304.953) [-303.213] (-305.320) * (-302.604) [-307.672] (-304.978) (-304.250) -- 0:00:19
692500 -- [-303.843] (-306.563) (-303.394) (-304.838) * (-307.510) (-304.322) [-303.049] (-303.332) -- 0:00:19
693000 -- (-302.102) (-303.743) (-303.984) [-305.081] * (-303.819) (-302.370) (-307.995) [-304.772] -- 0:00:19
693500 -- [-306.156] (-309.229) (-303.509) (-305.780) * (-303.866) [-302.425] (-304.440) (-307.162) -- 0:00:19
694000 -- (-302.900) (-304.622) [-303.747] (-306.021) * [-304.523] (-302.467) (-305.986) (-306.753) -- 0:00:18
694500 -- (-302.725) (-306.198) (-303.695) [-304.478] * (-303.313) (-302.818) (-303.992) [-302.899] -- 0:00:18
695000 -- (-303.207) (-303.927) (-304.681) [-307.463] * (-305.379) (-302.813) [-302.994] (-303.273) -- 0:00:18
Average standard deviation of split frequencies: 0.011430
695500 -- (-306.938) (-306.517) (-303.625) [-303.784] * (-302.578) [-306.129] (-303.601) (-303.581) -- 0:00:18
696000 -- (-305.329) (-303.258) (-304.217) [-303.962] * (-304.922) (-308.916) (-302.546) [-303.205] -- 0:00:18
696500 -- [-302.527] (-305.853) (-302.474) (-307.436) * (-304.452) [-304.125] (-302.309) (-302.368) -- 0:00:18
697000 -- (-303.725) [-303.770] (-308.696) (-307.273) * [-303.683] (-303.512) (-306.634) (-303.283) -- 0:00:18
697500 -- (-303.863) [-303.459] (-306.004) (-302.726) * [-304.243] (-302.269) (-309.444) (-303.885) -- 0:00:18
698000 -- [-303.812] (-304.327) (-303.067) (-304.094) * (-306.517) (-308.922) [-302.724] (-305.512) -- 0:00:18
698500 -- (-302.912) (-302.390) [-305.186] (-302.402) * (-307.022) (-304.433) [-303.601] (-305.676) -- 0:00:18
699000 -- (-304.506) [-304.374] (-303.561) (-306.663) * (-303.336) [-304.246] (-308.226) (-303.123) -- 0:00:18
699500 -- [-303.358] (-304.488) (-305.084) (-303.203) * (-305.906) [-305.021] (-305.606) (-303.278) -- 0:00:18
700000 -- [-303.149] (-304.876) (-306.200) (-302.868) * [-306.141] (-305.289) (-304.867) (-306.352) -- 0:00:18
Average standard deviation of split frequencies: 0.011227
700500 -- (-302.232) [-306.833] (-302.787) (-303.623) * (-303.990) (-307.203) (-304.351) [-303.100] -- 0:00:18
701000 -- (-305.513) (-305.987) (-306.527) [-303.274] * (-302.991) [-304.007] (-303.319) (-304.251) -- 0:00:18
701500 -- (-303.827) [-305.473] (-305.277) (-304.774) * (-305.067) (-304.644) (-305.607) [-302.930] -- 0:00:18
702000 -- (-305.165) [-307.598] (-303.481) (-309.178) * (-303.202) (-303.382) [-306.962] (-302.884) -- 0:00:18
702500 -- (-303.059) (-304.105) (-311.366) [-302.719] * (-305.821) (-303.044) (-304.554) [-304.368] -- 0:00:18
703000 -- (-303.553) (-302.845) [-303.205] (-303.171) * [-304.494] (-303.660) (-306.990) (-303.619) -- 0:00:18
703500 -- [-305.466] (-302.431) (-303.575) (-305.024) * (-303.326) (-303.840) (-308.615) [-304.907] -- 0:00:18
704000 -- (-304.640) (-303.726) [-303.186] (-306.638) * (-303.955) [-303.255] (-302.518) (-309.557) -- 0:00:18
704500 -- [-305.158] (-304.128) (-304.098) (-307.904) * (-309.421) [-304.320] (-305.557) (-312.194) -- 0:00:18
705000 -- (-306.710) (-305.412) [-307.450] (-304.533) * (-304.460) (-302.708) [-304.693] (-304.034) -- 0:00:18
Average standard deviation of split frequencies: 0.011822
705500 -- (-310.355) (-306.183) [-305.810] (-304.079) * (-307.231) [-304.000] (-304.276) (-306.234) -- 0:00:18
706000 -- (-303.124) (-304.836) [-304.478] (-304.842) * [-302.717] (-303.400) (-304.615) (-304.388) -- 0:00:18
706500 -- (-305.922) [-304.035] (-303.314) (-304.606) * [-303.245] (-304.460) (-303.775) (-306.481) -- 0:00:18
707000 -- [-305.390] (-304.475) (-303.366) (-302.571) * (-303.319) [-305.582] (-308.814) (-303.002) -- 0:00:18
707500 -- [-303.592] (-306.350) (-306.178) (-302.798) * (-303.219) (-302.791) (-305.901) [-303.623] -- 0:00:18
708000 -- [-303.404] (-305.072) (-304.712) (-303.351) * (-303.555) [-303.146] (-303.785) (-303.602) -- 0:00:18
708500 -- [-304.334] (-303.688) (-306.680) (-302.599) * (-303.667) (-305.696) [-303.499] (-305.543) -- 0:00:18
709000 -- (-304.387) (-306.660) (-310.573) [-302.191] * (-303.140) (-304.057) [-302.728] (-303.491) -- 0:00:18
709500 -- (-307.601) [-303.485] (-308.283) (-305.611) * (-304.585) [-306.049] (-303.501) (-305.323) -- 0:00:18
710000 -- [-303.257] (-304.020) (-303.486) (-304.465) * (-308.254) (-311.068) [-304.496] (-307.196) -- 0:00:17
Average standard deviation of split frequencies: 0.011120
710500 -- [-305.997] (-303.760) (-303.810) (-303.980) * (-307.205) (-302.670) [-302.726] (-303.803) -- 0:00:17
711000 -- (-303.941) (-303.790) (-303.293) [-306.966] * [-302.814] (-303.718) (-304.871) (-305.235) -- 0:00:17
711500 -- [-307.912] (-304.981) (-303.204) (-303.350) * [-302.784] (-305.776) (-302.713) (-305.537) -- 0:00:17
712000 -- (-303.531) (-302.933) [-306.094] (-307.388) * (-302.815) (-311.782) (-302.582) [-302.405] -- 0:00:17
712500 -- (-304.362) [-303.313] (-304.928) (-305.421) * [-303.252] (-303.614) (-304.360) (-304.683) -- 0:00:17
713000 -- (-303.999) [-303.190] (-303.349) (-302.018) * (-306.532) (-305.064) (-304.746) [-306.469] -- 0:00:17
713500 -- [-303.472] (-308.352) (-306.191) (-303.192) * (-303.216) (-302.943) [-304.597] (-304.185) -- 0:00:17
714000 -- (-307.452) (-303.371) (-301.916) [-304.289] * [-303.340] (-304.289) (-305.282) (-305.350) -- 0:00:17
714500 -- (-304.190) (-303.672) (-304.477) [-304.935] * [-302.511] (-303.906) (-309.639) (-304.041) -- 0:00:17
715000 -- (-303.391) [-302.730] (-304.139) (-307.187) * (-304.517) [-306.426] (-304.885) (-304.879) -- 0:00:17
Average standard deviation of split frequencies: 0.010728
715500 -- (-302.638) [-305.748] (-303.622) (-305.691) * (-306.969) (-305.582) [-304.661] (-304.146) -- 0:00:17
716000 -- (-303.307) [-303.062] (-304.231) (-305.824) * (-304.163) (-304.579) [-304.173] (-310.770) -- 0:00:17
716500 -- (-305.164) (-302.760) [-306.952] (-306.931) * [-310.595] (-304.913) (-305.112) (-303.565) -- 0:00:17
717000 -- (-304.741) (-303.869) [-303.072] (-307.773) * [-303.709] (-306.391) (-311.602) (-304.928) -- 0:00:17
717500 -- (-303.337) (-302.313) (-304.578) [-302.486] * (-304.622) (-305.044) [-306.436] (-306.745) -- 0:00:17
718000 -- (-305.439) [-304.733] (-303.707) (-303.881) * (-304.765) [-302.809] (-305.167) (-307.738) -- 0:00:17
718500 -- (-306.792) (-304.095) (-305.591) [-302.435] * [-302.120] (-305.167) (-304.128) (-303.969) -- 0:00:17
719000 -- (-303.930) [-304.086] (-303.188) (-302.737) * (-303.297) (-303.189) [-303.214] (-307.580) -- 0:00:17
719500 -- (-303.354) [-303.458] (-302.197) (-305.462) * (-303.533) [-304.671] (-306.116) (-306.520) -- 0:00:17
720000 -- (-307.903) [-304.905] (-302.497) (-305.975) * (-305.947) (-306.800) (-304.652) [-304.390] -- 0:00:17
Average standard deviation of split frequencies: 0.010697
720500 -- (-302.546) (-305.440) (-304.527) [-303.786] * (-304.829) (-302.636) (-302.658) [-303.785] -- 0:00:17
721000 -- (-303.090) (-305.761) (-305.194) [-305.218] * (-303.913) [-304.115] (-304.736) (-308.161) -- 0:00:17
721500 -- (-303.988) (-307.673) (-302.732) [-304.186] * [-303.506] (-305.126) (-303.133) (-304.257) -- 0:00:17
722000 -- (-302.818) (-308.105) [-303.424] (-302.426) * (-304.959) (-306.842) [-305.842] (-304.523) -- 0:00:17
722500 -- (-303.471) [-306.768] (-306.703) (-303.605) * (-305.406) (-305.209) (-303.538) [-304.177] -- 0:00:17
723000 -- (-307.653) (-306.186) [-304.135] (-303.238) * (-307.341) (-305.092) [-304.149] (-303.805) -- 0:00:17
723500 -- (-306.472) [-302.858] (-302.666) (-303.472) * (-304.795) (-304.237) (-304.723) [-302.475] -- 0:00:17
724000 -- (-305.172) (-305.738) [-302.568] (-304.027) * (-302.479) [-303.411] (-304.298) (-306.380) -- 0:00:17
724500 -- (-302.296) (-309.287) (-303.210) [-303.501] * (-302.835) (-307.243) (-302.469) [-304.504] -- 0:00:17
725000 -- [-302.553] (-304.477) (-304.520) (-305.384) * (-304.780) (-303.046) [-303.047] (-303.920) -- 0:00:17
Average standard deviation of split frequencies: 0.010809
725500 -- (-307.226) (-303.596) [-302.931] (-306.187) * (-303.364) (-304.537) (-306.317) [-303.081] -- 0:00:17
726000 -- (-303.726) (-303.597) [-302.692] (-304.626) * [-302.285] (-303.262) (-305.163) (-304.444) -- 0:00:16
726500 -- (-308.325) (-305.578) [-305.507] (-303.978) * (-304.806) (-302.870) [-302.764] (-305.329) -- 0:00:16
727000 -- (-305.195) [-304.944] (-306.275) (-307.747) * (-304.448) [-304.526] (-304.225) (-305.345) -- 0:00:16
727500 -- (-316.729) [-304.222] (-304.629) (-308.972) * (-305.667) (-305.470) [-306.378] (-309.397) -- 0:00:16
728000 -- (-309.791) (-303.826) [-305.259] (-303.681) * (-303.984) (-306.318) [-305.483] (-308.502) -- 0:00:16
728500 -- (-305.715) (-302.985) (-303.923) [-306.823] * [-305.481] (-304.783) (-304.631) (-308.425) -- 0:00:16
729000 -- (-302.304) [-303.909] (-306.238) (-303.023) * (-303.998) (-303.200) [-306.717] (-304.518) -- 0:00:16
729500 -- (-302.699) (-304.793) (-304.076) [-304.742] * (-305.278) [-303.167] (-303.714) (-304.960) -- 0:00:16
730000 -- (-305.215) (-309.136) [-303.291] (-304.591) * (-303.231) [-304.274] (-304.012) (-308.716) -- 0:00:16
Average standard deviation of split frequencies: 0.011044
730500 -- (-306.677) (-303.333) (-304.227) [-307.303] * (-304.333) (-305.170) [-302.265] (-303.297) -- 0:00:16
731000 -- (-310.077) [-303.234] (-306.636) (-303.648) * (-303.313) (-305.970) (-305.244) [-302.751] -- 0:00:16
731500 -- (-307.520) [-303.723] (-304.942) (-304.318) * (-302.606) (-302.547) [-303.575] (-305.533) -- 0:00:16
732000 -- (-306.698) [-306.216] (-305.278) (-303.946) * (-303.436) (-303.219) [-305.246] (-306.376) -- 0:00:16
732500 -- (-304.873) (-305.389) [-306.700] (-302.468) * (-305.900) (-304.899) (-303.330) [-305.991] -- 0:00:16
733000 -- (-303.654) (-303.024) (-303.901) [-302.914] * (-305.160) [-303.754] (-304.976) (-304.796) -- 0:00:16
733500 -- (-304.939) [-303.372] (-303.398) (-305.468) * (-303.088) (-303.425) [-304.613] (-303.863) -- 0:00:16
734000 -- [-303.409] (-302.381) (-311.320) (-305.890) * (-303.325) (-306.287) (-308.494) [-304.523] -- 0:00:16
734500 -- (-304.170) (-303.753) (-305.008) [-305.019] * (-303.724) (-304.308) [-303.699] (-303.832) -- 0:00:16
735000 -- [-301.879] (-303.763) (-302.342) (-303.790) * (-307.079) [-303.773] (-303.314) (-303.013) -- 0:00:16
Average standard deviation of split frequencies: 0.011077
735500 -- [-307.793] (-303.402) (-302.894) (-302.931) * (-304.598) (-305.494) (-303.993) [-302.824] -- 0:00:16
736000 -- (-305.304) [-305.056] (-303.376) (-307.080) * (-303.861) (-305.411) [-308.679] (-303.774) -- 0:00:16
736500 -- [-302.574] (-302.691) (-305.903) (-308.206) * (-304.265) (-305.501) (-303.603) [-303.287] -- 0:00:16
737000 -- (-302.992) (-303.321) (-304.843) [-304.075] * [-304.804] (-303.803) (-302.799) (-303.221) -- 0:00:16
737500 -- (-305.550) [-306.615] (-309.432) (-302.785) * [-306.781] (-304.996) (-302.704) (-305.066) -- 0:00:16
738000 -- (-304.932) [-305.299] (-304.333) (-303.097) * (-310.702) (-303.800) [-302.347] (-303.937) -- 0:00:16
738500 -- (-305.478) (-303.792) [-308.039] (-303.579) * (-308.634) (-305.241) (-306.405) [-302.777] -- 0:00:16
739000 -- (-303.589) [-304.985] (-302.390) (-304.383) * (-306.632) (-303.812) [-305.904] (-303.578) -- 0:00:16
739500 -- (-305.535) (-303.516) [-307.753] (-304.050) * (-309.136) (-304.782) [-303.645] (-302.721) -- 0:00:16
740000 -- (-303.370) (-303.565) (-304.794) [-306.208] * (-307.441) (-306.740) (-304.579) [-303.704] -- 0:00:16
Average standard deviation of split frequencies: 0.011119
740500 -- (-303.744) [-302.810] (-307.811) (-303.409) * (-302.703) (-309.484) (-305.105) [-302.548] -- 0:00:16
741000 -- (-309.832) (-303.250) (-307.589) [-304.847] * (-305.574) (-302.519) [-303.574] (-302.591) -- 0:00:16
741500 -- (-308.272) (-305.300) [-307.799] (-303.444) * [-303.390] (-308.231) (-309.114) (-304.260) -- 0:00:16
742000 -- (-303.258) [-303.549] (-304.042) (-307.444) * [-304.947] (-302.908) (-305.792) (-308.248) -- 0:00:15
742500 -- (-310.026) [-304.075] (-304.709) (-302.420) * (-305.590) [-305.800] (-305.191) (-302.765) -- 0:00:15
743000 -- (-309.847) [-303.404] (-302.997) (-302.501) * (-304.415) (-305.076) [-310.206] (-310.135) -- 0:00:15
743500 -- (-305.216) [-302.911] (-302.679) (-302.475) * [-303.775] (-304.017) (-306.522) (-306.847) -- 0:00:15
744000 -- (-302.747) (-307.837) [-303.956] (-304.263) * [-304.933] (-303.714) (-303.545) (-302.957) -- 0:00:15
744500 -- [-304.305] (-303.826) (-302.983) (-305.790) * (-302.354) [-303.967] (-302.724) (-307.283) -- 0:00:15
745000 -- (-303.580) (-303.510) (-303.650) [-302.571] * (-304.999) [-303.779] (-304.465) (-302.978) -- 0:00:15
Average standard deviation of split frequencies: 0.011077
745500 -- (-303.151) (-308.627) (-303.082) [-308.095] * (-309.625) [-303.878] (-303.338) (-307.513) -- 0:00:15
746000 -- (-303.298) (-302.808) [-303.854] (-303.826) * [-303.267] (-302.901) (-303.922) (-307.059) -- 0:00:15
746500 -- (-303.567) (-307.471) [-303.486] (-305.036) * (-302.553) [-304.005] (-308.084) (-305.204) -- 0:00:15
747000 -- (-304.080) (-303.728) (-302.900) [-304.163] * [-303.105] (-303.553) (-302.151) (-305.260) -- 0:00:15
747500 -- (-303.702) (-306.135) (-303.449) [-303.013] * (-302.611) (-303.983) (-303.758) [-304.231] -- 0:00:15
748000 -- (-304.366) (-303.609) [-303.902] (-304.738) * (-304.797) [-305.638] (-303.232) (-307.846) -- 0:00:15
748500 -- (-303.020) (-306.674) [-303.321] (-303.129) * (-307.586) [-305.315] (-307.039) (-303.322) -- 0:00:15
749000 -- [-302.752] (-306.282) (-305.906) (-306.493) * [-306.511] (-302.748) (-306.118) (-302.263) -- 0:00:15
749500 -- [-304.060] (-303.858) (-309.840) (-304.870) * [-303.767] (-305.186) (-305.135) (-302.714) -- 0:00:15
750000 -- (-309.142) [-304.726] (-304.931) (-304.039) * [-303.063] (-304.577) (-303.915) (-302.637) -- 0:00:15
Average standard deviation of split frequencies: 0.011461
750500 -- (-305.925) (-303.365) [-306.551] (-304.494) * (-305.654) (-309.437) (-303.431) [-304.231] -- 0:00:15
751000 -- (-305.735) (-302.937) [-304.966] (-305.507) * [-302.846] (-306.704) (-304.353) (-304.929) -- 0:00:15
751500 -- (-309.195) [-304.627] (-302.784) (-306.245) * (-302.968) (-305.761) [-307.011] (-305.593) -- 0:00:15
752000 -- (-305.400) [-303.610] (-302.167) (-304.308) * (-303.616) (-302.561) [-307.282] (-303.789) -- 0:00:15
752500 -- (-305.754) (-304.774) (-304.610) [-304.475] * (-306.274) [-303.351] (-303.559) (-304.822) -- 0:00:15
753000 -- (-304.381) (-302.367) [-302.591] (-308.156) * [-303.293] (-304.467) (-304.308) (-302.405) -- 0:00:15
753500 -- (-309.537) [-303.164] (-305.084) (-310.963) * (-306.040) (-305.630) (-303.579) [-303.100] -- 0:00:15
754000 -- (-305.289) (-303.216) [-303.756] (-303.087) * (-303.779) (-303.786) [-307.240] (-305.749) -- 0:00:15
754500 -- (-306.153) (-307.517) [-302.531] (-302.543) * (-303.090) (-306.162) (-303.791) [-305.371] -- 0:00:15
755000 -- [-304.463] (-304.241) (-304.957) (-304.226) * (-303.930) (-305.710) [-302.347] (-303.211) -- 0:00:15
Average standard deviation of split frequencies: 0.011419
755500 -- (-303.624) [-303.690] (-303.014) (-305.065) * (-304.860) [-307.613] (-303.766) (-306.599) -- 0:00:15
756000 -- (-304.018) (-304.506) (-303.093) [-304.341] * (-305.520) [-305.573] (-306.980) (-302.495) -- 0:00:15
756500 -- (-303.490) (-303.274) (-304.264) [-304.035] * (-304.702) [-304.510] (-305.116) (-302.422) -- 0:00:15
757000 -- (-303.984) (-302.429) [-303.074] (-302.263) * (-304.311) (-304.869) (-304.833) [-302.939] -- 0:00:15
757500 -- [-307.246] (-304.109) (-303.673) (-304.557) * (-305.633) [-304.556] (-304.697) (-305.321) -- 0:00:15
758000 -- [-309.139] (-304.067) (-308.402) (-305.929) * [-302.369] (-305.433) (-302.705) (-303.795) -- 0:00:15
758500 -- (-304.217) (-303.456) (-304.628) [-304.469] * (-303.546) (-304.380) (-302.812) [-302.658] -- 0:00:14
759000 -- [-302.876] (-304.408) (-303.652) (-304.460) * (-306.420) [-302.596] (-303.487) (-305.356) -- 0:00:14
759500 -- (-303.141) (-303.989) [-305.122] (-304.701) * (-305.733) [-304.301] (-305.276) (-303.178) -- 0:00:14
760000 -- (-303.815) (-306.485) (-308.536) [-305.618] * (-302.754) [-303.099] (-304.417) (-304.466) -- 0:00:14
Average standard deviation of split frequencies: 0.011039
760500 -- [-302.547] (-305.264) (-306.358) (-306.851) * (-302.746) (-307.389) [-304.893] (-303.314) -- 0:00:14
761000 -- (-306.294) (-304.493) (-303.720) [-302.899] * (-305.721) (-305.395) (-309.043) [-302.587] -- 0:00:14
761500 -- (-303.159) (-303.572) (-303.624) [-303.847] * [-302.178] (-303.256) (-304.990) (-302.445) -- 0:00:14
762000 -- (-303.868) (-303.796) [-304.841] (-306.101) * [-302.384] (-306.448) (-306.422) (-307.902) -- 0:00:14
762500 -- (-305.442) (-304.286) [-303.853] (-305.476) * (-307.731) (-305.168) (-308.814) [-304.250] -- 0:00:14
763000 -- (-305.754) [-303.902] (-304.356) (-304.391) * (-302.649) (-303.687) (-308.014) [-305.541] -- 0:00:14
763500 -- [-305.122] (-306.348) (-304.127) (-306.370) * (-304.273) (-307.840) (-309.788) [-304.649] -- 0:00:14
764000 -- (-302.871) (-306.776) [-304.226] (-303.528) * [-303.134] (-304.361) (-306.296) (-304.257) -- 0:00:14
764500 -- (-304.750) [-306.153] (-305.714) (-305.262) * (-303.216) (-307.486) [-305.536] (-305.437) -- 0:00:14
765000 -- (-302.522) [-303.980] (-305.632) (-304.309) * [-303.205] (-307.352) (-305.014) (-303.717) -- 0:00:14
Average standard deviation of split frequencies: 0.010731
765500 -- (-303.376) [-303.376] (-304.301) (-302.812) * (-304.126) [-304.005] (-302.654) (-308.480) -- 0:00:14
766000 -- (-303.250) [-303.389] (-305.768) (-311.032) * [-303.585] (-302.965) (-303.085) (-305.147) -- 0:00:14
766500 -- [-307.471] (-304.363) (- 