--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:21:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/ispD/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -975.43          -979.31
2       -975.48          -979.03
--------------------------------------
TOTAL     -975.46          -979.18
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896100    0.091966    0.378443    1.495609    0.862402   1311.24   1375.78    1.000
r(A<->C){all}   0.169628    0.020811    0.000102    0.459708    0.134936     88.14    168.37    1.000
r(A<->G){all}   0.168587    0.019693    0.000033    0.445014    0.133978    303.28    330.89    1.000
r(A<->T){all}   0.167250    0.018532    0.000022    0.440501    0.132336    173.70    202.96    1.000
r(C<->G){all}   0.152619    0.016326    0.000191    0.406673    0.120580    183.70    283.58    1.000
r(C<->T){all}   0.171185    0.023075    0.000111    0.472217    0.126519    153.36    176.61    1.000
r(G<->T){all}   0.170730    0.020194    0.000078    0.451599    0.134247    214.25    262.20    1.000
pi(A){all}      0.152386    0.000177    0.127938    0.179020    0.152255   1237.35   1271.65    1.000
pi(C){all}      0.288959    0.000264    0.259240    0.322369    0.288615   1275.00   1371.76    1.000
pi(G){all}      0.334150    0.000305    0.299972    0.369283    0.333776   1072.46   1286.73    1.000
pi(T){all}      0.224506    0.000247    0.192267    0.252944    0.224455    946.42   1058.33    1.000
alpha{1,2}      0.429031    0.246419    0.000208    1.386995    0.258346   1067.90   1208.24    1.000
alpha{3}        0.462271    0.245375    0.000284    1.470481    0.296265   1164.94   1236.36    1.000
pinvar{all}     0.997767    0.000007    0.992777    0.999995    0.998560   1016.24   1097.42    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-934.30311
Model 2: PositiveSelection	-934.303111
Model 0: one-ratio	-934.303111
Model 7: beta	-934.30311
Model 8: beta&w>1	-934.303111


Model 0 vs 1	1.9999999949504854E-6

Model 2 vs 1	1.9999999949504854E-6

Model 8 vs 7	1.9999999949504854E-6
>C1
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C2
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C3
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C4
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C5
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C6
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=241 

C1              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C2              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C3              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C4              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C5              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C6              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
                **************************************************

C1              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C2              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C3              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C4              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C5              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C6              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
                **************************************************

C1              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C2              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C3              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C4              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C5              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C6              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
                **************************************************

C1              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C2              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C3              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C4              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C5              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C6              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
                **************************************************

C1              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C2              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C3              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C4              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C5              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C6              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
                *****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  241 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  241 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7230]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [7230]--->[7230]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.491 Mb, Max= 30.792 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C2              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C3              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C4              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C5              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C6              MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
                **************************************************

C1              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C2              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C3              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C4              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C5              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C6              VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
                **************************************************

C1              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C2              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C3              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C4              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C5              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C6              TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
                **************************************************

C1              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C2              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C3              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C4              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C5              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C6              DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
                **************************************************

C1              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C2              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C3              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C4              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C5              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C6              TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
                *****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C2              ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C3              ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C4              ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C5              ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C6              ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
                **************************************************

C1              GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C2              GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C3              GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C4              GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C5              GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C6              GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
                **************************************************

C1              GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C2              GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C3              GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C4              GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C5              GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C6              GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
                **************************************************

C1              GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C2              GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C3              GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C4              GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C5              GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C6              GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
                **************************************************

C1              GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C2              GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C3              GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C4              GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C5              GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C6              GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
                **************************************************

C1              TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C2              TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C3              TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C4              TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C5              TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C6              TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
                **************************************************

C1              ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C2              ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C3              ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C4              ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C5              ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C6              ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
                **************************************************

C1              TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C2              TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C3              TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C4              TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C5              TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C6              TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
                **************************************************

C1              ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C2              ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C3              ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C4              ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C5              ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C6              ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
                **************************************************

C1              GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C2              GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C3              GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C4              GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C5              GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C6              GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
                **************************************************

C1              GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C2              GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C3              GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C4              GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C5              GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C6              GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
                **************************************************

C1              TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C2              TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C3              TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C4              TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C5              TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C6              TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
                **************************************************

C1              ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C2              ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C3              ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C4              ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C5              ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C6              ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
                **************************************************

C1              CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C2              CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C3              CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C4              CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C5              CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C6              CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
                **************************************************

C1              TGGCGAAGAAGATTCTGCGCCGG
C2              TGGCGAAGAAGATTCTGCGCCGG
C3              TGGCGAAGAAGATTCTGCGCCGG
C4              TGGCGAAGAAGATTCTGCGCCGG
C5              TGGCGAAGAAGATTCTGCGCCGG
C6              TGGCGAAGAAGATTCTGCGCCGG
                ***********************



>C1
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C2
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C3
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C4
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C5
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C6
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C1
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C2
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C3
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C4
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C5
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C6
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 723 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579792790
      Setting output file names to "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1984031375
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0305485028
      Seed = 289688997
      Swapseed = 1579792790
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1618.108563 -- -24.965149
         Chain 2 -- -1618.108656 -- -24.965149
         Chain 3 -- -1618.108563 -- -24.965149
         Chain 4 -- -1618.108563 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1618.108563 -- -24.965149
         Chain 2 -- -1618.108656 -- -24.965149
         Chain 3 -- -1618.108563 -- -24.965149
         Chain 4 -- -1618.108656 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1618.109] (-1618.109) (-1618.109) (-1618.109) * [-1618.109] (-1618.109) (-1618.109) (-1618.109) 
        500 -- (-990.169) [-1000.098] (-988.274) (-988.404) * [-998.406] (-990.034) (-981.601) (-982.232) -- 0:00:00
       1000 -- (-982.775) (-1006.951) [-985.138] (-989.227) * [-981.653] (-981.259) (-990.017) (-988.087) -- 0:00:00
       1500 -- (-987.261) (-992.697) (-982.378) [-986.389] * (-987.104) (-986.219) (-986.143) [-982.396] -- 0:00:00
       2000 -- (-991.522) (-985.436) (-982.697) [-982.856] * (-983.652) [-981.667] (-987.990) (-984.192) -- 0:00:00
       2500 -- (-988.697) [-978.797] (-978.232) (-996.532) * (-981.036) (-988.387) (-981.673) [-982.289] -- 0:00:00
       3000 -- [-982.695] (-986.245) (-982.016) (-985.288) * (-988.264) (-993.803) [-980.780] (-980.493) -- 0:00:00
       3500 -- (-986.127) [-979.389] (-988.603) (-995.271) * (-986.531) (-984.650) (-988.585) [-984.989] -- 0:00:00
       4000 -- (-983.746) [-982.256] (-983.683) (-986.058) * (-983.836) (-990.173) [-983.024] (-979.237) -- 0:00:00
       4500 -- [-991.273] (-986.867) (-989.166) (-983.134) * (-982.635) (-994.273) (-982.559) [-986.209] -- 0:00:00
       5000 -- (-994.460) [-982.218] (-983.326) (-983.699) * (-982.723) [-982.920] (-977.807) (-982.239) -- 0:00:00

      Average standard deviation of split frequencies: 0.095647

       5500 -- (-986.135) (-986.416) (-979.835) [-984.544] * (-987.946) (-980.906) (-994.208) [-984.848] -- 0:00:00
       6000 -- (-993.617) (-980.107) [-979.412] (-982.560) * (-990.742) [-983.507] (-984.178) (-980.987) -- 0:00:00
       6500 -- (-984.836) [-986.414] (-979.220) (-986.089) * (-982.293) (-980.218) (-987.864) [-984.292] -- 0:00:00
       7000 -- (-1002.374) (-993.046) (-975.890) [-984.744] * [-982.801] (-987.204) (-984.827) (-984.274) -- 0:00:00
       7500 -- (-982.712) (-982.539) (-974.894) [-987.161] * [-985.893] (-981.963) (-983.799) (-987.124) -- 0:00:00
       8000 -- (-988.467) [-983.913] (-977.164) (-987.857) * (-991.372) [-991.634] (-984.238) (-974.633) -- 0:00:00
       8500 -- [-981.014] (-985.656) (-978.502) (-988.375) * (-988.191) (-987.831) (-985.296) [-976.404] -- 0:00:00
       9000 -- (-984.293) [-985.659] (-974.934) (-982.101) * (-988.661) (-984.579) [-979.190] (-976.263) -- 0:00:00
       9500 -- (-987.876) [-980.735] (-974.741) (-989.105) * (-991.849) (-984.067) (-981.412) [-978.465] -- 0:00:00
      10000 -- (-984.508) [-979.806] (-974.967) (-985.390) * (-982.019) (-989.588) (-988.378) [-977.746] -- 0:00:00

      Average standard deviation of split frequencies: 0.077866

      10500 -- [-985.465] (-981.012) (-974.804) (-984.070) * (-980.556) [-978.439] (-981.164) (-977.487) -- 0:00:00
      11000 -- (-980.387) [-981.520] (-974.825) (-988.184) * (-992.182) [-984.361] (-984.973) (-975.594) -- 0:00:00
      11500 -- (-989.781) (-979.878) [-974.522] (-990.637) * (-989.087) (-983.985) [-989.816] (-977.199) -- 0:00:00
      12000 -- (-988.134) [-980.328] (-974.946) (-985.893) * (-988.202) (-985.728) (-984.647) [-976.987] -- 0:00:00
      12500 -- (-990.209) [-981.934] (-975.914) (-986.848) * (-996.447) (-988.791) (-987.038) [-977.795] -- 0:00:00
      13000 -- [-981.818] (-988.889) (-974.659) (-987.727) * (-986.605) (-989.302) (-985.397) [-977.172] -- 0:01:15
      13500 -- (-990.570) [-987.579] (-978.374) (-993.184) * [-984.652] (-982.274) (-983.080) (-976.811) -- 0:01:13
      14000 -- (-994.792) (-983.380) [-978.078] (-985.351) * (-985.744) (-992.075) (-982.353) [-976.499] -- 0:01:10
      14500 -- (-992.065) (-985.683) [-974.923] (-981.828) * (-993.307) (-984.363) (-985.603) [-974.051] -- 0:01:07
      15000 -- [-982.217] (-1000.068) (-974.998) (-990.289) * [-987.844] (-980.170) (-989.031) (-979.497) -- 0:01:05

      Average standard deviation of split frequencies: 0.076859

      15500 -- (-986.395) (-986.486) [-975.684] (-997.905) * [-983.780] (-987.705) (-987.763) (-977.479) -- 0:01:03
      16000 -- [-986.867] (-983.539) (-975.767) (-976.271) * (-988.543) (-983.072) (-987.868) [-975.631] -- 0:01:01
      16500 -- (-991.278) (-992.697) [-975.492] (-977.366) * (-981.857) (-982.902) (-984.730) [-974.980] -- 0:00:59
      17000 -- [-986.335] (-983.321) (-977.583) (-976.711) * (-987.930) [-983.612] (-983.166) (-975.003) -- 0:00:57
      17500 -- (-989.343) [-988.760] (-975.558) (-977.601) * (-985.829) (-985.122) [-982.846] (-975.321) -- 0:00:56
      18000 -- (-981.474) (-981.207) (-976.782) [-976.872] * (-994.240) (-988.975) [-982.609] (-975.052) -- 0:00:54
      18500 -- [-980.306] (-987.477) (-978.262) (-975.906) * (-993.059) [-986.286] (-984.080) (-974.863) -- 0:00:53
      19000 -- (-989.148) (-977.378) (-974.737) [-975.345] * [-980.991] (-983.472) (-985.127) (-976.639) -- 0:00:51
      19500 -- (-989.148) (-983.064) (-976.585) [-977.106] * (-978.503) [-984.017] (-989.074) (-975.544) -- 0:00:50
      20000 -- [-985.120] (-978.365) (-977.259) (-978.045) * (-987.220) (-988.437) [-979.429] (-978.860) -- 0:00:49

      Average standard deviation of split frequencies: 0.041818

      20500 -- [-981.398] (-979.279) (-977.201) (-976.294) * [-982.655] (-984.531) (-988.534) (-975.412) -- 0:00:47
      21000 -- (-988.009) (-977.511) [-975.119] (-980.019) * (-987.696) [-985.208] (-982.768) (-974.741) -- 0:00:46
      21500 -- (-984.277) (-975.707) [-974.659] (-975.435) * (-994.483) (-987.828) (-989.476) [-974.951] -- 0:00:45
      22000 -- (-982.705) (-976.333) [-974.688] (-975.357) * (-983.829) [-986.032] (-984.923) (-976.918) -- 0:00:44
      22500 -- (-993.202) (-975.085) [-977.229] (-975.203) * [-981.297] (-981.280) (-989.488) (-975.827) -- 0:00:43
      23000 -- [-982.109] (-975.731) (-977.075) (-975.653) * (-990.475) [-978.981] (-986.030) (-976.202) -- 0:00:42
      23500 -- (-988.878) [-974.674] (-974.044) (-976.669) * [-996.489] (-985.144) (-984.322) (-976.536) -- 0:00:41
      24000 -- (-989.148) (-974.395) (-975.979) [-976.131] * [-986.273] (-986.464) (-983.181) (-975.975) -- 0:00:40
      24500 -- (-987.976) (-975.389) (-975.420) [-982.559] * (-982.046) (-986.093) [-984.877] (-974.468) -- 0:00:39
      25000 -- [-982.047] (-975.338) (-977.972) (-980.381) * (-988.562) [-988.509] (-987.685) (-975.455) -- 0:00:39

      Average standard deviation of split frequencies: 0.037125

      25500 -- (-989.112) [-974.133] (-975.495) (-977.681) * (-999.246) (-988.237) (-979.251) [-977.525] -- 0:00:38
      26000 -- (-975.236) [-975.516] (-974.584) (-975.048) * (-984.063) (-991.036) [-975.742] (-975.847) -- 0:00:37
      26500 -- [-975.508] (-976.003) (-975.614) (-976.893) * (-989.657) (-983.547) [-976.523] (-976.660) -- 0:00:36
      27000 -- [-976.903] (-975.022) (-974.588) (-977.274) * (-985.521) [-985.751] (-978.916) (-976.609) -- 0:00:36
      27500 -- (-974.687) (-977.745) [-975.465] (-975.773) * (-983.317) [-988.453] (-979.045) (-976.705) -- 0:00:35
      28000 -- (-976.059) (-975.168) (-974.227) [-976.738] * [-986.590] (-981.469) (-978.618) (-975.316) -- 0:01:09
      28500 -- [-976.862] (-976.345) (-974.640) (-975.746) * (-982.910) [-986.003] (-977.089) (-975.769) -- 0:01:08
      29000 -- (-975.955) (-976.017) (-975.011) [-974.763] * [-980.215] (-984.757) (-975.118) (-975.312) -- 0:01:06
      29500 -- [-975.849] (-976.426) (-975.648) (-977.174) * (-978.478) (-982.335) [-975.055] (-974.922) -- 0:01:05
      30000 -- [-976.116] (-975.894) (-976.197) (-977.606) * [-985.648] (-991.123) (-974.658) (-976.632) -- 0:01:04

      Average standard deviation of split frequencies: 0.042879

      30500 -- (-974.796) (-976.379) (-974.601) [-977.482] * (-985.755) (-979.073) [-975.862] (-975.254) -- 0:01:03
      31000 -- [-976.255] (-976.200) (-974.121) (-976.186) * (-992.531) [-981.176] (-974.296) (-976.512) -- 0:01:02
      31500 -- (-979.349) [-976.571] (-976.866) (-980.542) * (-993.990) (-985.890) (-975.736) [-976.091] -- 0:01:01
      32000 -- (-980.305) (-976.287) (-977.044) [-980.683] * [-984.100] (-989.026) (-974.082) (-976.058) -- 0:01:00
      32500 -- [-979.305] (-979.322) (-975.222) (-987.776) * [-981.508] (-986.506) (-974.484) (-975.938) -- 0:00:59
      33000 -- [-975.519] (-974.616) (-976.754) (-987.132) * (-981.269) (-990.539) (-976.594) [-976.960] -- 0:00:58
      33500 -- [-977.283] (-982.076) (-977.346) (-981.709) * (-993.360) (-982.517) [-975.228] (-979.144) -- 0:00:57
      34000 -- (-974.733) (-976.653) (-977.100) [-979.918] * (-983.414) (-986.182) [-974.672] (-976.988) -- 0:00:56
      34500 -- (-976.200) [-979.006] (-976.819) (-976.697) * (-981.740) (-985.476) [-975.339] (-975.915) -- 0:00:55
      35000 -- (-975.275) (-982.402) (-977.163) [-975.900] * (-985.270) (-991.942) [-974.316] (-979.190) -- 0:00:55

      Average standard deviation of split frequencies: 0.029635

      35500 -- [-975.233] (-975.542) (-977.873) (-974.219) * (-985.063) (-993.437) [-977.313] (-976.046) -- 0:00:54
      36000 -- (-975.941) (-974.303) [-977.877] (-975.556) * (-990.471) (-985.582) (-978.068) [-977.962] -- 0:00:53
      36500 -- (-974.912) (-976.745) [-977.206] (-979.097) * (-980.581) [-985.814] (-978.587) (-981.016) -- 0:00:52
      37000 -- (-978.066) (-978.361) (-977.397) [-978.618] * [-990.303] (-986.233) (-976.272) (-977.437) -- 0:00:52
      37500 -- (-975.035) [-975.810] (-981.073) (-977.132) * (-988.685) (-986.240) (-975.545) [-976.802] -- 0:00:51
      38000 -- [-977.059] (-977.092) (-979.720) (-977.011) * [-983.271] (-988.436) (-976.695) (-976.205) -- 0:00:50
      38500 -- (-976.225) (-977.919) (-981.563) [-975.010] * (-990.966) (-988.229) (-975.832) [-975.314] -- 0:00:49
      39000 -- [-976.855] (-977.606) (-976.379) (-976.416) * (-983.992) (-991.973) [-976.903] (-976.709) -- 0:00:49
      39500 -- (-976.952) (-976.044) [-976.211] (-976.512) * [-980.878] (-988.007) (-975.632) (-976.630) -- 0:00:48
      40000 -- (-976.059) [-975.606] (-977.666) (-977.683) * [-984.708] (-989.747) (-978.555) (-977.190) -- 0:00:48

      Average standard deviation of split frequencies: 0.027692

      40500 -- [-974.418] (-978.136) (-975.991) (-975.982) * (-986.203) (-991.065) [-977.406] (-974.655) -- 0:00:47
      41000 -- (-974.915) [-975.605] (-978.282) (-975.702) * (-988.685) (-989.859) [-976.775] (-975.019) -- 0:00:46
      41500 -- (-974.944) (-975.463) (-976.360) [-975.482] * (-994.032) (-988.515) (-976.995) [-975.069] -- 0:00:46
      42000 -- [-975.015] (-975.054) (-981.130) (-976.115) * (-985.007) (-994.561) (-974.420) [-983.550] -- 0:00:45
      42500 -- [-975.274] (-975.563) (-976.718) (-975.990) * (-985.124) (-988.467) [-974.449] (-976.494) -- 0:00:45
      43000 -- (-975.679) [-975.264] (-974.550) (-975.947) * (-990.627) (-989.799) (-974.207) [-976.192] -- 0:00:44
      43500 -- (-979.768) (-978.422) [-975.495] (-976.210) * [-984.427] (-987.400) (-974.671) (-975.679) -- 0:01:05
      44000 -- (-976.220) (-976.761) [-976.267] (-975.206) * (-986.271) [-983.974] (-974.671) (-976.948) -- 0:01:05
      44500 -- (-974.919) [-975.554] (-975.780) (-975.274) * (-989.912) (-992.644) [-976.193] (-975.064) -- 0:01:04
      45000 -- (-975.742) [-975.161] (-974.957) (-976.202) * (-984.955) (-986.880) (-978.423) [-975.896] -- 0:01:03

      Average standard deviation of split frequencies: 0.029768

      45500 -- (-977.639) (-988.353) (-977.780) [-975.129] * [-985.102] (-987.800) (-994.739) (-978.429) -- 0:01:02
      46000 -- (-978.456) (-979.122) (-974.570) [-980.058] * (-986.793) (-993.415) (-980.556) [-975.697] -- 0:01:02
      46500 -- (-977.314) (-976.781) [-974.931] (-976.735) * (-987.692) [-986.609] (-975.985) (-974.298) -- 0:01:01
      47000 -- (-976.471) (-974.323) [-976.883] (-983.950) * (-997.452) [-986.877] (-975.741) (-974.667) -- 0:01:00
      47500 -- (-978.352) [-975.228] (-977.325) (-979.274) * (-987.715) [-982.455] (-975.582) (-980.399) -- 0:01:00
      48000 -- (-976.070) [-974.735] (-979.360) (-976.201) * (-988.497) (-979.095) [-973.932] (-975.433) -- 0:00:59
      48500 -- [-974.432] (-976.246) (-980.352) (-975.874) * (-986.311) (-982.692) [-975.118] (-974.890) -- 0:00:58
      49000 -- (-976.307) (-974.627) (-975.483) [-975.131] * (-988.562) (-984.614) [-975.444] (-976.879) -- 0:00:58
      49500 -- (-977.019) (-975.119) (-980.404) [-976.779] * [-976.200] (-981.418) (-974.718) (-977.427) -- 0:00:57
      50000 -- (-979.984) (-975.442) (-977.370) [-974.539] * (-976.681) (-991.459) (-974.849) [-979.872] -- 0:00:57

      Average standard deviation of split frequencies: 0.028843

      50500 -- (-979.781) [-977.364] (-980.104) (-979.695) * [-975.710] (-983.306) (-974.214) (-976.059) -- 0:00:56
      51000 -- (-978.763) (-976.660) [-977.130] (-975.934) * (-978.646) (-989.006) [-976.963] (-979.020) -- 0:00:55
      51500 -- [-976.009] (-980.866) (-977.221) (-980.321) * (-976.844) (-982.452) (-976.047) [-978.173] -- 0:00:55
      52000 -- (-976.634) [-977.583] (-975.227) (-974.425) * (-977.019) (-982.933) [-974.701] (-975.973) -- 0:00:54
      52500 -- (-977.196) (-979.836) (-976.364) [-976.228] * [-973.997] (-984.642) (-976.879) (-977.126) -- 0:00:54
      53000 -- (-977.372) [-976.220] (-975.955) (-976.083) * (-975.587) (-983.095) (-976.035) [-980.791] -- 0:00:53
      53500 -- (-978.948) (-976.684) (-974.925) [-975.119] * (-975.445) (-995.640) (-979.814) [-979.086] -- 0:00:53
      54000 -- (-975.517) [-979.793] (-975.873) (-974.696) * (-974.039) [-982.723] (-979.544) (-977.192) -- 0:00:52
      54500 -- (-978.363) (-974.321) (-981.490) [-975.913] * [-978.498] (-980.721) (-975.525) (-979.452) -- 0:00:52
      55000 -- (-974.975) (-975.032) (-978.163) [-975.742] * (-978.513) [-983.258] (-977.716) (-981.131) -- 0:00:51

      Average standard deviation of split frequencies: 0.030570

      55500 -- (-974.552) (-980.955) [-977.600] (-977.730) * (-975.327) (-995.184) (-974.680) [-975.342] -- 0:00:51
      56000 -- (-978.051) (-975.217) [-974.843] (-976.456) * (-974.650) (-989.558) [-976.425] (-973.967) -- 0:00:50
      56500 -- (-975.875) (-977.142) [-976.307] (-980.116) * (-977.597) (-975.534) [-977.163] (-974.345) -- 0:00:50
      57000 -- (-975.460) (-977.325) [-975.095] (-974.523) * (-981.074) (-976.635) [-977.401] (-977.718) -- 0:00:49
      57500 -- [-976.395] (-975.241) (-975.106) (-974.606) * [-975.688] (-976.341) (-978.847) (-976.612) -- 0:00:49
      58000 -- (-975.902) [-976.696] (-977.964) (-974.564) * (-977.488) [-979.664] (-975.392) (-978.712) -- 0:01:04
      58500 -- (-976.540) [-977.183] (-977.499) (-975.280) * (-977.189) [-975.331] (-975.662) (-979.448) -- 0:01:04
      59000 -- [-975.307] (-983.455) (-981.217) (-976.054) * (-975.767) (-975.919) (-976.910) [-976.991] -- 0:01:03
      59500 -- (-976.770) (-980.719) [-976.071] (-974.997) * [-978.459] (-975.381) (-975.120) (-978.953) -- 0:01:03
      60000 -- (-980.689) [-974.147] (-976.059) (-982.334) * (-976.596) (-975.282) [-975.263] (-976.512) -- 0:01:02

      Average standard deviation of split frequencies: 0.027585

      60500 -- (-976.929) (-973.926) (-976.047) [-979.791] * (-976.759) [-976.074] (-974.683) (-983.878) -- 0:01:02
      61000 -- (-976.430) (-975.538) (-979.012) [-975.515] * (-974.836) [-978.891] (-975.296) (-980.705) -- 0:01:01
      61500 -- (-975.174) (-974.462) (-977.015) [-974.951] * (-974.608) (-976.817) (-976.206) [-977.944] -- 0:01:01
      62000 -- [-975.292] (-974.900) (-978.289) (-975.087) * (-975.995) [-975.913] (-974.823) (-977.951) -- 0:01:00
      62500 -- (-976.833) [-975.310] (-976.249) (-975.007) * [-973.796] (-977.704) (-974.444) (-975.163) -- 0:01:00
      63000 -- [-974.857] (-974.689) (-978.657) (-975.091) * (-977.630) (-975.778) [-975.025] (-977.128) -- 0:00:59
      63500 -- (-974.352) (-979.406) [-975.570] (-974.984) * (-977.661) (-977.860) [-975.914] (-977.855) -- 0:00:58
      64000 -- [-975.107] (-974.804) (-974.183) (-977.138) * (-975.108) (-978.635) (-975.408) [-977.948] -- 0:00:58
      64500 -- (-977.382) (-974.823) [-975.839] (-975.249) * [-975.115] (-974.418) (-979.050) (-976.988) -- 0:00:58
      65000 -- (-976.105) [-975.113] (-978.486) (-975.432) * (-975.605) (-976.455) (-976.570) [-975.926] -- 0:00:57

      Average standard deviation of split frequencies: 0.030611

      65500 -- (-976.036) (-974.901) (-980.202) [-974.447] * (-976.069) (-975.882) (-976.157) [-976.833] -- 0:00:57
      66000 -- [-974.907] (-977.439) (-977.076) (-974.959) * [-974.484] (-976.959) (-976.089) (-982.460) -- 0:00:56
      66500 -- (-975.808) [-974.767] (-976.482) (-976.106) * (-975.699) (-982.133) [-976.072] (-976.231) -- 0:00:56
      67000 -- (-974.756) (-976.610) (-978.728) [-976.322] * (-976.102) (-981.149) (-975.377) [-975.260] -- 0:00:55
      67500 -- (-974.604) (-974.599) (-976.661) [-977.494] * (-975.359) (-975.397) [-974.808] (-975.647) -- 0:00:55
      68000 -- (-976.572) (-979.861) (-976.188) [-979.302] * (-979.370) (-982.271) [-973.920] (-980.631) -- 0:00:54
      68500 -- [-975.626] (-975.523) (-977.171) (-975.594) * (-974.378) (-976.986) [-975.016] (-977.685) -- 0:00:54
      69000 -- (-976.300) [-974.849] (-975.944) (-978.431) * (-976.289) [-974.266] (-975.908) (-979.605) -- 0:00:53
      69500 -- [-976.893] (-974.510) (-974.890) (-975.678) * (-977.397) [-974.317] (-976.189) (-975.190) -- 0:00:53
      70000 -- (-975.967) (-978.323) (-974.277) [-976.591] * (-981.723) (-974.823) (-975.348) [-976.189] -- 0:00:53

      Average standard deviation of split frequencies: 0.026048

      70500 -- (-977.233) [-976.726] (-976.313) (-974.649) * (-980.907) (-979.038) (-976.595) [-974.536] -- 0:00:52
      71000 -- (-981.124) (-975.826) (-975.854) [-975.154] * (-977.232) (-980.014) (-974.885) [-974.571] -- 0:00:52
      71500 -- (-979.387) [-975.420] (-978.090) (-974.660) * (-977.983) (-976.486) [-975.508] (-975.167) -- 0:00:51
      72000 -- [-975.083] (-976.249) (-977.089) (-975.532) * [-975.821] (-974.343) (-975.491) (-975.196) -- 0:00:51
      72500 -- [-974.949] (-976.694) (-975.941) (-974.707) * (-975.465) [-975.597] (-975.491) (-975.815) -- 0:00:51
      73000 -- [-976.356] (-977.529) (-977.692) (-978.007) * (-975.450) [-977.466] (-977.389) (-976.059) -- 0:00:50
      73500 -- (-981.205) (-976.121) [-978.145] (-976.202) * [-975.117] (-975.728) (-977.616) (-977.532) -- 0:00:50
      74000 -- (-978.819) (-979.255) [-977.232] (-976.173) * (-976.155) [-975.970] (-977.720) (-974.914) -- 0:01:02
      74500 -- (-977.533) (-979.994) (-975.449) [-974.466] * (-975.112) (-979.344) (-976.626) [-977.499] -- 0:01:02
      75000 -- (-976.238) (-984.735) [-981.154] (-976.525) * (-975.140) (-975.182) [-975.119] (-976.277) -- 0:01:01

      Average standard deviation of split frequencies: 0.022399

      75500 -- (-974.423) [-974.667] (-977.594) (-977.663) * (-974.354) [-975.100] (-977.370) (-976.954) -- 0:01:01
      76000 -- (-976.382) [-974.608] (-975.539) (-976.147) * [-979.695] (-977.701) (-974.946) (-976.380) -- 0:01:00
      76500 -- (-979.295) (-974.534) (-979.340) [-977.808] * (-975.634) (-976.038) [-974.572] (-977.905) -- 0:01:00
      77000 -- (-976.640) (-976.529) (-976.728) [-977.022] * (-974.929) (-975.267) (-975.516) [-975.178] -- 0:00:59
      77500 -- (-977.777) (-978.292) [-976.729] (-978.358) * (-974.487) (-978.102) [-975.049] (-975.968) -- 0:00:59
      78000 -- [-976.953] (-978.858) (-978.982) (-976.028) * [-974.509] (-975.708) (-977.277) (-977.951) -- 0:00:59
      78500 -- [-976.890] (-975.415) (-978.842) (-978.858) * [-974.900] (-974.426) (-975.794) (-976.476) -- 0:00:58
      79000 -- (-976.344) (-976.052) (-978.769) [-979.867] * [-974.572] (-979.215) (-975.735) (-980.035) -- 0:00:58
      79500 -- (-974.262) [-978.468] (-975.146) (-978.783) * (-977.487) (-978.820) (-974.131) [-974.890] -- 0:00:57
      80000 -- [-977.446] (-976.819) (-975.122) (-976.523) * (-978.611) (-976.565) (-978.089) [-974.564] -- 0:00:57

      Average standard deviation of split frequencies: 0.025528

      80500 -- (-975.971) (-977.721) (-976.940) [-978.228] * (-977.877) (-978.634) (-975.256) [-977.465] -- 0:00:57
      81000 -- (-978.647) (-978.354) (-974.953) [-974.439] * [-976.271] (-975.204) (-977.216) (-974.072) -- 0:00:56
      81500 -- (-979.080) (-976.694) (-974.570) [-976.384] * (-978.466) (-975.846) (-974.901) [-974.285] -- 0:00:56
      82000 -- (-978.125) [-974.245] (-977.612) (-976.690) * (-978.909) (-976.396) (-976.180) [-974.711] -- 0:00:55
      82500 -- (-976.149) [-974.247] (-976.336) (-978.274) * [-975.724] (-977.428) (-976.791) (-974.705) -- 0:00:55
      83000 -- [-976.369] (-976.782) (-975.980) (-975.225) * [-977.460] (-975.299) (-976.320) (-975.824) -- 0:00:55
      83500 -- (-976.186) (-980.362) (-977.852) [-973.885] * [-985.064] (-977.994) (-975.740) (-973.984) -- 0:00:54
      84000 -- [-975.801] (-980.435) (-977.391) (-978.361) * [-975.472] (-979.816) (-977.781) (-978.607) -- 0:00:54
      84500 -- [-974.493] (-977.644) (-978.511) (-977.101) * (-978.319) (-977.342) [-974.852] (-976.376) -- 0:00:54
      85000 -- (-980.225) (-976.676) (-980.123) [-975.099] * (-974.114) (-976.942) [-975.805] (-975.793) -- 0:00:53

      Average standard deviation of split frequencies: 0.023657

      85500 -- (-977.562) (-974.943) [-977.130] (-978.638) * (-976.359) [-975.473] (-975.561) (-977.044) -- 0:00:53
      86000 -- (-976.761) (-978.330) (-979.939) [-976.842] * (-975.771) (-975.602) [-976.048] (-976.866) -- 0:00:53
      86500 -- (-978.022) [-977.530] (-976.923) (-976.493) * (-975.048) (-976.272) [-974.394] (-974.881) -- 0:00:52
      87000 -- (-975.586) [-974.943] (-976.058) (-976.750) * [-974.953] (-979.644) (-974.716) (-979.924) -- 0:00:52
      87500 -- (-979.177) (-976.281) [-976.414] (-976.510) * [-976.596] (-975.917) (-974.553) (-975.321) -- 0:00:52
      88000 -- (-975.878) (-974.444) (-978.009) [-976.582] * (-977.069) (-977.266) [-976.929] (-975.792) -- 0:00:51
      88500 -- (-974.105) (-974.889) [-974.755] (-977.497) * (-974.710) [-975.971] (-976.706) (-975.577) -- 0:00:51
      89000 -- [-974.136] (-976.083) (-974.929) (-977.927) * (-974.753) [-977.280] (-974.878) (-977.900) -- 0:00:51
      89500 -- (-974.503) (-976.800) [-977.038] (-976.548) * (-974.075) [-980.172] (-978.840) (-974.539) -- 0:00:50
      90000 -- (-976.096) (-978.272) (-977.053) [-976.100] * (-975.395) (-981.817) [-980.223] (-976.750) -- 0:00:50

      Average standard deviation of split frequencies: 0.023397

      90500 -- (-977.698) (-976.607) (-979.638) [-975.105] * (-974.784) (-976.414) (-977.629) [-975.971] -- 0:01:00
      91000 -- (-981.005) [-975.390] (-979.472) (-975.817) * (-974.841) (-977.427) [-977.299] (-975.133) -- 0:00:59
      91500 -- (-977.958) (-975.308) [-979.750] (-976.745) * [-976.024] (-974.354) (-978.384) (-975.528) -- 0:00:59
      92000 -- [-975.570] (-977.247) (-976.386) (-975.341) * (-974.557) (-978.534) (-979.238) [-974.886] -- 0:00:59
      92500 -- (-974.594) (-976.035) (-977.389) [-976.193] * (-976.683) (-975.974) (-976.763) [-976.520] -- 0:00:58
      93000 -- [-974.446] (-977.024) (-979.159) (-975.560) * (-976.467) [-976.782] (-977.724) (-975.872) -- 0:00:58
      93500 -- (-974.890) [-977.858] (-980.493) (-975.190) * [-979.049] (-981.656) (-977.219) (-975.687) -- 0:00:58
      94000 -- (-974.518) (-976.898) (-978.001) [-975.033] * (-976.793) (-977.537) (-976.203) [-978.155] -- 0:00:57
      94500 -- (-974.575) [-977.227] (-976.995) (-975.069) * (-975.631) (-977.372) [-974.197] (-977.585) -- 0:00:57
      95000 -- [-974.914] (-976.360) (-975.925) (-976.851) * (-974.728) [-975.638] (-974.390) (-976.136) -- 0:00:57

      Average standard deviation of split frequencies: 0.023777

      95500 -- [-976.808] (-976.701) (-975.718) (-978.764) * (-979.664) (-979.782) [-973.875] (-975.594) -- 0:00:56
      96000 -- (-973.997) [-974.643] (-976.023) (-975.765) * (-976.736) (-977.423) (-974.293) [-975.672] -- 0:00:56
      96500 -- (-974.311) (-976.318) [-976.546] (-975.674) * (-974.705) (-975.568) (-974.324) [-976.364] -- 0:00:56
      97000 -- (-974.932) (-974.290) [-976.097] (-976.429) * (-976.497) (-976.507) [-974.354] (-976.452) -- 0:00:55
      97500 -- (-975.764) (-975.777) [-976.543] (-975.216) * (-980.068) (-975.834) [-974.216] (-975.581) -- 0:00:55
      98000 -- (-977.021) (-976.924) [-976.113] (-976.279) * (-975.934) [-976.177] (-975.070) (-975.716) -- 0:00:55
      98500 -- (-977.559) [-975.848] (-977.472) (-976.530) * (-976.031) [-975.141] (-974.959) (-977.795) -- 0:00:54
      99000 -- (-976.543) [-977.306] (-979.035) (-976.968) * [-975.407] (-975.216) (-974.707) (-979.530) -- 0:00:54
      99500 -- (-974.740) (-975.026) (-979.608) [-973.903] * (-974.724) (-976.184) (-977.065) [-976.565] -- 0:00:54
      100000 -- (-975.317) [-976.750] (-976.157) (-974.428) * (-976.492) (-978.198) (-978.228) [-975.147] -- 0:00:54

      Average standard deviation of split frequencies: 0.025618

      100500 -- [-979.962] (-978.008) (-976.062) (-974.186) * (-975.047) (-976.027) (-974.299) [-976.961] -- 0:00:53
      101000 -- (-982.453) [-976.045] (-978.180) (-975.175) * (-975.747) [-976.389] (-975.761) (-974.843) -- 0:00:53
      101500 -- [-977.047] (-977.488) (-976.349) (-976.664) * [-976.428] (-978.149) (-975.117) (-977.772) -- 0:00:53
      102000 -- [-977.432] (-977.403) (-977.346) (-976.226) * [-981.430] (-975.634) (-975.247) (-976.405) -- 0:00:52
      102500 -- [-976.553] (-976.878) (-975.587) (-974.623) * (-976.338) (-975.392) (-976.229) [-977.012] -- 0:00:52
      103000 -- (-980.382) [-977.591] (-976.281) (-975.189) * (-978.110) [-979.931] (-975.180) (-979.208) -- 0:00:52
      103500 -- [-975.047] (-977.858) (-976.898) (-975.828) * (-977.734) (-975.525) (-979.258) [-975.030] -- 0:00:51
      104000 -- (-980.855) [-979.052] (-974.956) (-975.970) * (-977.220) (-980.579) [-974.285] (-977.144) -- 0:00:51
      104500 -- (-975.812) (-979.622) [-976.479] (-974.565) * [-976.604] (-977.634) (-976.205) (-976.367) -- 0:00:51
      105000 -- (-976.215) (-980.518) [-975.415] (-974.496) * (-981.149) (-975.921) [-975.316] (-977.685) -- 0:00:51

      Average standard deviation of split frequencies: 0.024354

      105500 -- (-974.098) [-976.857] (-974.169) (-974.101) * (-975.430) (-974.445) (-975.179) [-974.465] -- 0:00:50
      106000 -- (-974.343) (-974.964) [-974.374] (-981.863) * (-975.766) (-976.654) (-976.545) [-974.612] -- 0:00:50
      106500 -- [-975.190] (-977.162) (-975.537) (-974.861) * (-977.914) (-976.834) [-976.944] (-976.535) -- 0:00:58
      107000 -- (-978.498) (-981.821) [-975.282] (-974.254) * (-976.056) (-974.633) (-975.446) [-974.913] -- 0:00:58
      107500 -- (-974.568) [-977.783] (-975.311) (-974.980) * (-976.945) [-975.586] (-975.793) (-974.858) -- 0:00:58
      108000 -- (-979.043) (-979.124) [-975.705] (-976.898) * (-980.086) [-975.961] (-976.409) (-975.455) -- 0:00:57
      108500 -- (-975.849) [-977.492] (-975.748) (-974.684) * (-981.011) (-977.588) (-974.851) [-976.039] -- 0:00:57
      109000 -- (-977.167) (-975.324) (-978.651) [-975.898] * (-974.360) (-978.916) [-975.753] (-976.185) -- 0:00:57
      109500 -- [-975.952] (-975.094) (-975.182) (-977.046) * (-975.494) (-978.171) (-975.748) [-976.697] -- 0:00:56
      110000 -- (-977.349) [-974.457] (-974.985) (-975.324) * (-976.038) (-975.272) (-974.837) [-978.548] -- 0:00:56

      Average standard deviation of split frequencies: 0.021298

      110500 -- (-980.449) [-974.305] (-980.651) (-974.103) * (-974.860) (-973.986) [-974.711] (-979.132) -- 0:00:56
      111000 -- [-980.635] (-976.971) (-980.531) (-975.631) * [-976.549] (-974.628) (-976.739) (-980.594) -- 0:00:56
      111500 -- (-974.598) (-975.656) (-977.825) [-975.592] * (-974.128) [-976.390] (-976.913) (-974.674) -- 0:00:55
      112000 -- (-976.582) (-978.525) [-976.953] (-980.639) * (-978.748) (-974.273) [-976.709] (-976.219) -- 0:00:55
      112500 -- [-976.660] (-978.379) (-977.789) (-976.337) * (-976.928) (-977.448) [-976.098] (-976.084) -- 0:00:55
      113000 -- (-977.104) (-978.532) (-978.156) [-975.878] * (-975.245) (-974.637) [-978.203] (-977.191) -- 0:00:54
      113500 -- (-975.416) (-978.383) [-977.462] (-974.203) * (-975.423) (-975.643) [-978.682] (-977.361) -- 0:00:54
      114000 -- (-975.340) [-977.106] (-977.611) (-983.496) * (-984.293) (-975.299) [-975.149] (-977.125) -- 0:00:54
      114500 -- (-975.504) (-976.514) (-975.968) [-976.348] * (-977.349) (-976.821) [-977.518] (-978.750) -- 0:00:54
      115000 -- (-976.291) (-978.307) (-976.101) [-975.283] * (-974.816) (-978.338) (-976.900) [-978.392] -- 0:00:53

      Average standard deviation of split frequencies: 0.022030

      115500 -- (-976.655) [-976.594] (-979.744) (-975.755) * [-975.109] (-977.927) (-976.405) (-976.826) -- 0:00:53
      116000 -- (-980.518) (-975.219) [-976.558] (-975.748) * (-974.477) (-982.271) [-975.293] (-978.467) -- 0:00:53
      116500 -- (-977.434) [-977.330] (-975.774) (-976.601) * (-974.497) [-974.902] (-982.294) (-979.621) -- 0:00:53
      117000 -- [-981.439] (-976.920) (-979.930) (-976.450) * (-974.500) (-978.169) (-974.487) [-977.641] -- 0:00:52
      117500 -- (-978.592) (-977.403) [-978.413] (-977.483) * (-976.448) (-977.795) (-974.806) [-974.880] -- 0:00:52
      118000 -- (-976.215) (-975.837) (-978.636) [-978.389] * (-987.234) [-974.822] (-974.543) (-980.079) -- 0:00:52
      118500 -- (-976.215) (-975.198) (-978.329) [-977.591] * (-977.050) (-978.361) (-975.930) [-980.466] -- 0:00:52
      119000 -- (-978.696) (-974.719) (-983.059) [-974.999] * (-981.553) (-978.301) [-976.459] (-978.979) -- 0:00:51
      119500 -- (-979.706) [-978.793] (-977.133) (-974.813) * (-977.052) (-974.880) [-976.681] (-975.573) -- 0:00:51
      120000 -- (-976.384) (-974.669) (-976.543) [-976.158] * [-977.645] (-974.814) (-975.726) (-975.861) -- 0:00:51

      Average standard deviation of split frequencies: 0.024129

      120500 -- (-977.869) (-978.020) (-975.309) [-973.882] * (-975.211) (-977.635) [-976.890] (-975.132) -- 0:00:51
      121000 -- (-978.311) (-978.953) (-975.533) [-975.703] * (-977.590) [-974.656] (-976.249) (-977.879) -- 0:00:50
      121500 -- (-975.676) (-977.297) (-975.014) [-979.890] * (-977.569) (-975.188) [-975.380] (-978.352) -- 0:00:50
      122000 -- (-975.139) [-975.749] (-974.993) (-979.728) * (-978.009) (-978.015) [-974.996] (-978.499) -- 0:00:50
      122500 -- [-975.008] (-975.880) (-974.784) (-977.017) * (-976.825) (-976.921) [-976.843] (-975.725) -- 0:00:50
      123000 -- (-975.698) (-985.856) [-976.636] (-973.948) * (-975.227) (-977.849) [-977.925] (-976.060) -- 0:00:57
      123500 -- (-974.956) (-984.783) (-976.240) [-974.968] * (-975.953) [-978.000] (-980.563) (-976.510) -- 0:00:56
      124000 -- (-976.261) (-980.688) (-976.345) [-976.490] * (-976.776) (-976.014) [-976.682] (-977.842) -- 0:00:56
      124500 -- (-977.004) (-975.035) (-974.846) [-975.848] * (-983.737) (-974.118) (-976.740) [-976.023] -- 0:00:56
      125000 -- (-975.151) (-977.332) [-976.684] (-974.522) * (-979.925) (-975.907) (-976.243) [-974.010] -- 0:00:56

      Average standard deviation of split frequencies: 0.023196

      125500 -- (-974.558) (-975.097) (-979.685) [-974.777] * [-974.615] (-977.178) (-975.295) (-973.972) -- 0:00:55
      126000 -- (-975.648) (-977.440) (-977.136) [-974.538] * (-976.324) (-975.052) [-975.388] (-976.455) -- 0:00:55
      126500 -- (-975.165) [-974.482] (-977.804) (-977.249) * (-975.033) (-974.799) [-976.310] (-974.942) -- 0:00:55
      127000 -- (-974.107) (-975.431) [-976.055] (-974.450) * (-976.528) (-975.861) [-974.866] (-975.482) -- 0:00:54
      127500 -- (-975.209) (-975.806) (-974.170) [-979.367] * (-980.528) (-976.139) [-976.076] (-974.107) -- 0:00:54
      128000 -- (-981.184) (-974.614) [-974.838] (-975.504) * [-974.445] (-974.987) (-975.116) (-976.400) -- 0:00:54
      128500 -- (-974.431) [-977.755] (-976.640) (-988.685) * (-975.804) (-974.993) [-974.961] (-975.830) -- 0:00:54
      129000 -- (-978.959) [-976.751] (-975.492) (-976.974) * [-976.840] (-975.031) (-978.367) (-975.321) -- 0:00:54
      129500 -- [-980.075] (-975.886) (-974.746) (-979.192) * (-982.366) (-974.264) (-977.843) [-976.248] -- 0:00:53
      130000 -- [-978.448] (-976.981) (-975.214) (-976.954) * (-982.741) [-975.564] (-977.325) (-975.046) -- 0:00:53

      Average standard deviation of split frequencies: 0.023049

      130500 -- [-977.838] (-977.112) (-974.723) (-977.469) * (-978.437) (-975.358) [-977.208] (-975.679) -- 0:00:53
      131000 -- (-977.653) (-979.985) [-976.233] (-975.165) * (-976.037) (-976.469) (-976.248) [-975.834] -- 0:00:53
      131500 -- (-976.246) (-979.232) [-976.426] (-974.236) * (-975.604) (-976.934) (-976.005) [-976.624] -- 0:00:52
      132000 -- [-975.124] (-974.929) (-976.380) (-974.355) * [-974.916] (-978.612) (-974.921) (-982.340) -- 0:00:52
      132500 -- [-975.099] (-974.263) (-975.507) (-978.958) * [-976.354] (-974.366) (-975.063) (-975.216) -- 0:00:52
      133000 -- [-976.622] (-979.574) (-975.517) (-974.536) * (-976.310) (-975.804) (-974.373) [-974.837] -- 0:00:52
      133500 -- [-977.030] (-975.826) (-975.885) (-976.294) * (-975.584) (-975.507) [-974.137] (-975.118) -- 0:00:51
      134000 -- [-976.681] (-978.136) (-975.130) (-975.898) * (-974.667) (-974.019) (-978.346) [-977.564] -- 0:00:51
      134500 -- [-976.470] (-978.008) (-978.744) (-976.102) * [-974.733] (-975.301) (-977.552) (-975.765) -- 0:00:51
      135000 -- (-980.616) (-980.306) (-979.000) [-975.006] * (-974.762) (-975.362) (-981.049) [-974.692] -- 0:00:51

      Average standard deviation of split frequencies: 0.021491

      135500 -- (-981.794) (-977.980) [-977.375] (-975.985) * [-976.830] (-974.830) (-975.660) (-980.080) -- 0:00:51
      136000 -- (-982.963) (-977.027) (-979.080) [-974.924] * [-975.574] (-982.038) (-977.669) (-976.188) -- 0:00:50
      136500 -- (-985.110) (-974.421) (-978.802) [-975.635] * (-975.236) [-976.613] (-975.918) (-974.769) -- 0:00:50
      137000 -- (-980.006) (-976.433) (-976.690) [-974.559] * (-976.722) (-975.004) (-976.119) [-974.932] -- 0:00:50
      137500 -- (-975.151) (-976.048) [-977.377] (-976.532) * [-976.626] (-976.597) (-977.800) (-974.972) -- 0:00:50
      138000 -- (-975.595) (-974.293) [-976.642] (-976.390) * [-974.820] (-975.719) (-979.066) (-978.324) -- 0:00:49
      138500 -- [-975.665] (-974.950) (-979.316) (-975.265) * (-974.589) [-977.735] (-978.219) (-976.669) -- 0:00:49
      139000 -- (-980.914) (-980.409) [-977.353] (-976.233) * [-975.533] (-976.570) (-976.042) (-976.309) -- 0:00:49
      139500 -- (-976.046) [-975.956] (-975.653) (-977.805) * [-976.294] (-975.201) (-975.952) (-978.471) -- 0:00:55
      140000 -- (-978.453) (-975.915) (-974.732) [-974.592] * (-977.816) (-976.988) [-975.745] (-978.607) -- 0:00:55

      Average standard deviation of split frequencies: 0.021290

      140500 -- (-979.791) (-981.114) [-974.595] (-976.577) * (-975.960) [-975.080] (-977.447) (-978.082) -- 0:00:55
      141000 -- [-974.791] (-977.424) (-974.863) (-980.235) * (-976.638) (-976.854) [-977.940] (-977.920) -- 0:00:54
      141500 -- (-974.106) [-978.047] (-976.836) (-983.026) * (-976.844) (-977.887) (-982.417) [-978.920] -- 0:00:54
      142000 -- (-975.610) (-976.117) [-977.414] (-979.148) * (-976.797) (-974.579) [-975.227] (-975.591) -- 0:00:54
      142500 -- (-974.153) (-979.002) (-976.129) [-977.520] * (-978.976) [-974.521] (-977.371) (-974.615) -- 0:00:54
      143000 -- [-974.637] (-975.706) (-974.951) (-977.322) * (-976.582) [-974.915] (-974.816) (-976.188) -- 0:00:53
      143500 -- (-975.808) [-976.820] (-975.884) (-975.290) * (-978.798) (-981.627) (-974.277) [-977.581] -- 0:00:53
      144000 -- (-975.384) [-976.608] (-975.451) (-977.325) * (-977.947) (-978.459) [-976.808] (-977.065) -- 0:00:53
      144500 -- [-974.390] (-977.461) (-977.391) (-980.217) * (-976.002) [-976.745] (-978.429) (-977.536) -- 0:00:53
      145000 -- (-975.022) (-979.071) (-975.987) [-977.240] * (-975.933) (-978.800) [-974.092] (-976.234) -- 0:00:53

      Average standard deviation of split frequencies: 0.020987

      145500 -- (-974.456) (-977.576) (-976.437) [-973.945] * (-976.083) (-974.828) [-976.701] (-977.356) -- 0:00:52
      146000 -- (-973.885) (-975.945) [-977.618] (-975.776) * (-978.755) (-976.723) (-981.728) [-975.168] -- 0:00:52
      146500 -- (-978.700) (-976.894) (-976.824) [-975.012] * (-977.775) (-975.925) [-976.629] (-978.380) -- 0:00:52
      147000 -- (-974.736) [-975.620] (-977.624) (-977.994) * (-978.357) [-976.830] (-978.238) (-982.199) -- 0:00:52
      147500 -- (-978.727) [-976.619] (-978.903) (-977.084) * (-981.369) (-975.789) (-980.203) [-977.135] -- 0:00:52
      148000 -- (-979.647) [-977.726] (-977.273) (-977.412) * (-977.477) (-979.535) [-982.904] (-974.727) -- 0:00:51
      148500 -- (-976.610) [-974.327] (-979.258) (-975.353) * (-977.665) (-976.399) [-979.852] (-977.025) -- 0:00:51
      149000 -- (-974.456) [-975.832] (-978.116) (-975.730) * (-978.493) (-976.751) (-980.349) [-974.660] -- 0:00:51
      149500 -- (-974.120) (-975.606) [-975.000] (-978.261) * (-978.574) (-977.385) (-977.144) [-974.605] -- 0:00:51
      150000 -- (-975.700) (-979.223) (-977.539) [-974.225] * [-978.088] (-977.580) (-978.092) (-975.555) -- 0:00:51

      Average standard deviation of split frequencies: 0.020337

      150500 -- (-976.172) [-980.392] (-974.771) (-976.649) * (-976.168) (-975.218) (-977.754) [-977.035] -- 0:00:50
      151000 -- (-977.246) [-977.942] (-974.702) (-974.828) * (-974.966) [-975.639] (-975.299) (-977.491) -- 0:00:50
      151500 -- [-979.429] (-975.931) (-975.816) (-976.191) * (-975.841) (-974.654) (-977.121) [-974.754] -- 0:00:50
      152000 -- (-978.415) (-978.013) (-976.010) [-974.927] * (-979.975) (-975.873) [-974.489] (-974.649) -- 0:00:50
      152500 -- [-980.123] (-977.512) (-976.330) (-974.593) * (-975.180) (-975.606) (-974.810) [-974.549] -- 0:00:50
      153000 -- (-975.502) (-977.588) (-975.427) [-978.523] * (-978.413) (-975.182) (-975.159) [-974.453] -- 0:00:49
      153500 -- (-976.197) [-976.152] (-976.327) (-984.519) * [-975.061] (-974.801) (-975.571) (-974.429) -- 0:00:49
      154000 -- [-977.354] (-974.329) (-977.256) (-979.166) * [-973.726] (-974.862) (-975.068) (-974.324) -- 0:00:49
      154500 -- (-977.355) [-975.525] (-974.456) (-976.941) * (-982.451) [-975.405] (-975.541) (-973.892) -- 0:00:49
      155000 -- [-977.289] (-980.089) (-977.637) (-981.552) * (-975.708) [-976.280] (-975.545) (-974.347) -- 0:00:49

      Average standard deviation of split frequencies: 0.019642

      155500 -- (-977.912) (-976.714) (-979.340) [-978.887] * [-975.661] (-975.500) (-974.017) (-975.912) -- 0:00:48
      156000 -- (-977.693) [-980.876] (-976.699) (-981.715) * [-976.592] (-974.932) (-975.106) (-974.670) -- 0:00:54
      156500 -- [-975.219] (-980.127) (-975.497) (-977.203) * (-975.447) (-976.239) [-976.624] (-974.799) -- 0:00:53
      157000 -- (-976.341) [-980.340] (-974.709) (-977.647) * (-976.262) (-974.685) [-975.691] (-975.086) -- 0:00:53
      157500 -- (-974.197) [-978.267] (-974.817) (-975.902) * (-976.637) [-974.471] (-977.502) (-977.795) -- 0:00:53
      158000 -- (-974.958) (-977.468) (-975.042) [-975.667] * [-976.694] (-975.291) (-977.426) (-975.573) -- 0:00:53
      158500 -- (-975.286) (-980.766) [-974.447] (-977.879) * [-976.178] (-978.487) (-975.534) (-977.984) -- 0:00:53
      159000 -- [-975.697] (-976.014) (-981.289) (-977.497) * (-976.772) [-979.764] (-974.715) (-975.185) -- 0:00:52
      159500 -- (-975.670) (-977.698) (-975.194) [-976.126] * [-975.733] (-980.970) (-978.439) (-974.995) -- 0:00:52
      160000 -- (-976.431) (-975.999) [-974.982] (-979.342) * (-978.544) (-987.972) [-977.732] (-975.706) -- 0:00:52

      Average standard deviation of split frequencies: 0.020021

      160500 -- (-978.213) [-975.140] (-976.088) (-978.197) * (-975.197) (-981.614) (-974.961) [-975.388] -- 0:00:52
      161000 -- (-980.043) (-974.276) (-976.541) [-975.530] * (-977.605) (-974.408) [-976.180] (-975.787) -- 0:00:52
      161500 -- (-976.091) (-977.609) (-976.478) [-976.740] * (-977.988) (-974.555) (-975.371) [-977.014] -- 0:00:51
      162000 -- (-977.538) [-974.418] (-978.063) (-975.659) * [-975.834] (-977.064) (-975.806) (-974.488) -- 0:00:51
      162500 -- (-976.369) (-977.636) [-977.940] (-975.788) * (-975.780) [-975.599] (-975.887) (-974.602) -- 0:00:51
      163000 -- (-975.751) [-976.622] (-977.654) (-976.031) * [-978.163] (-976.412) (-975.154) (-977.472) -- 0:00:51
      163500 -- (-976.175) (-975.033) (-975.655) [-977.325] * (-975.996) [-975.797] (-976.213) (-975.257) -- 0:00:51
      164000 -- (-976.118) [-975.289] (-976.633) (-975.791) * (-976.676) (-974.855) [-975.155] (-975.612) -- 0:00:50
      164500 -- (-977.140) (-977.258) (-984.670) [-974.797] * [-977.444] (-974.855) (-974.954) (-975.055) -- 0:00:50
      165000 -- (-978.387) (-976.317) [-978.623] (-976.329) * (-975.819) (-975.372) [-975.993] (-975.060) -- 0:00:50

      Average standard deviation of split frequencies: 0.020046

      165500 -- (-978.909) (-976.415) (-976.968) [-977.906] * (-980.161) [-975.106] (-974.367) (-976.862) -- 0:00:50
      166000 -- [-976.336] (-975.556) (-977.541) (-977.274) * (-975.028) (-974.941) (-975.958) [-976.053] -- 0:00:50
      166500 -- (-977.878) (-974.673) (-978.119) [-975.310] * (-975.592) [-978.385] (-975.700) (-976.750) -- 0:00:50
      167000 -- (-974.263) (-980.451) (-976.555) [-975.904] * (-976.958) [-979.395] (-977.252) (-976.413) -- 0:00:49
      167500 -- (-975.006) (-978.381) [-975.253] (-976.473) * (-976.228) (-974.416) [-977.190] (-974.415) -- 0:00:49
      168000 -- (-974.994) (-977.052) [-973.939] (-976.225) * [-975.998] (-974.588) (-975.439) (-978.312) -- 0:00:49
      168500 -- (-974.806) (-974.657) (-975.705) [-976.468] * (-980.339) (-973.989) (-976.609) [-979.660] -- 0:00:49
      169000 -- [-975.122] (-976.015) (-975.179) (-977.361) * (-982.258) (-975.468) (-978.301) [-978.268] -- 0:00:49
      169500 -- (-977.088) (-977.521) (-975.539) [-975.802] * (-980.244) (-974.966) (-976.401) [-974.440] -- 0:00:48
      170000 -- [-976.151] (-974.912) (-974.160) (-975.433) * (-975.940) (-975.272) (-976.892) [-975.957] -- 0:00:48

      Average standard deviation of split frequencies: 0.019488

      170500 -- [-978.031] (-975.917) (-975.248) (-976.573) * (-974.261) (-975.539) (-977.408) [-975.009] -- 0:00:48
      171000 -- (-976.667) (-975.606) [-975.493] (-975.299) * (-977.158) [-976.220] (-976.156) (-976.473) -- 0:00:48
      171500 -- (-976.789) (-975.211) (-974.424) [-975.391] * (-974.853) [-975.133] (-975.281) (-979.704) -- 0:00:48
      172000 -- (-975.034) (-975.356) (-976.016) [-977.331] * [-974.797] (-975.844) (-974.192) (-977.411) -- 0:00:48
      172500 -- (-974.473) (-975.647) [-976.128] (-978.477) * (-974.040) (-975.589) [-975.047] (-974.670) -- 0:00:52
      173000 -- (-975.896) (-975.428) [-976.128] (-975.720) * [-974.022] (-975.758) (-979.368) (-976.027) -- 0:00:52
      173500 -- (-978.244) [-976.960] (-976.896) (-977.711) * [-974.985] (-975.984) (-980.260) (-975.097) -- 0:00:52
      174000 -- (-975.504) (-978.438) (-976.464) [-976.257] * (-977.844) (-974.693) (-978.090) [-976.827] -- 0:00:52
      174500 -- (-979.175) [-976.010] (-979.401) (-974.323) * (-975.008) (-975.192) (-977.623) [-976.086] -- 0:00:52
      175000 -- (-977.984) (-981.166) (-980.067) [-974.312] * (-975.699) (-974.785) (-978.148) [-974.718] -- 0:00:51

      Average standard deviation of split frequencies: 0.019222

      175500 -- (-974.756) [-976.374] (-975.232) (-977.919) * (-978.267) (-977.160) (-974.969) [-974.411] -- 0:00:51
      176000 -- (-975.094) [-978.377] (-974.940) (-980.664) * (-976.994) (-974.939) (-976.449) [-975.535] -- 0:00:51
      176500 -- (-975.832) (-977.149) [-975.474] (-976.768) * [-978.199] (-976.509) (-976.503) (-976.260) -- 0:00:51
      177000 -- (-974.244) [-974.216] (-979.195) (-975.313) * (-977.148) [-974.717] (-975.261) (-975.883) -- 0:00:51
      177500 -- (-975.347) [-976.602] (-979.191) (-975.336) * (-976.123) [-976.302] (-977.482) (-977.124) -- 0:00:50
      178000 -- (-976.367) (-975.479) (-974.475) [-975.366] * (-976.138) [-977.061] (-977.555) (-976.718) -- 0:00:50
      178500 -- (-975.399) (-975.279) (-975.747) [-976.469] * (-976.340) (-982.054) (-977.531) [-976.697] -- 0:00:50
      179000 -- (-977.201) [-979.534] (-977.408) (-977.776) * (-975.272) [-979.132] (-977.436) (-980.560) -- 0:00:50
      179500 -- (-974.452) (-975.469) (-980.152) [-978.392] * (-976.975) (-974.528) [-976.515] (-976.062) -- 0:00:50
      180000 -- (-974.296) [-979.043] (-974.711) (-979.697) * (-976.829) (-974.979) (-977.359) [-974.521] -- 0:00:50

      Average standard deviation of split frequencies: 0.019493

      180500 -- (-976.133) (-976.989) (-974.765) [-975.401] * (-980.511) (-975.076) (-977.544) [-973.983] -- 0:00:49
      181000 -- [-974.644] (-976.837) (-978.905) (-975.179) * (-977.646) [-974.550] (-980.098) (-974.202) -- 0:00:49
      181500 -- (-977.456) (-978.646) (-978.547) [-977.580] * (-975.190) [-975.247] (-976.177) (-974.991) -- 0:00:49
      182000 -- [-976.613] (-975.749) (-975.300) (-977.269) * [-978.265] (-980.211) (-977.449) (-973.984) -- 0:00:49
      182500 -- [-977.770] (-978.376) (-976.092) (-979.132) * (-977.507) (-975.662) (-975.498) [-975.381] -- 0:00:49
      183000 -- [-975.750] (-974.742) (-976.638) (-974.543) * (-975.355) (-976.689) (-974.716) [-974.693] -- 0:00:49
      183500 -- (-980.033) (-976.376) (-974.774) [-975.080] * (-974.876) [-976.283] (-974.772) (-975.163) -- 0:00:48
      184000 -- [-977.488] (-980.405) (-977.499) (-975.409) * [-975.206] (-975.080) (-976.744) (-975.727) -- 0:00:48
      184500 -- (-976.026) (-976.732) (-977.320) [-975.508] * (-975.647) (-974.939) (-976.179) [-976.047] -- 0:00:48
      185000 -- [-976.478] (-978.066) (-978.568) (-974.747) * (-974.947) (-979.554) [-977.329] (-980.609) -- 0:00:48

      Average standard deviation of split frequencies: 0.018882

      185500 -- (-978.129) [-977.175] (-977.109) (-976.171) * (-975.979) [-980.160] (-976.064) (-977.637) -- 0:00:48
      186000 -- (-975.858) (-976.296) [-974.778] (-978.165) * (-975.633) (-976.344) (-976.328) [-976.108] -- 0:00:48
      186500 -- [-976.113] (-978.006) (-976.650) (-978.803) * (-976.510) (-975.764) [-976.886] (-975.879) -- 0:00:47
      187000 -- (-974.051) (-978.935) [-975.403] (-977.114) * [-974.401] (-976.571) (-976.792) (-975.655) -- 0:00:47
      187500 -- (-976.037) [-977.559] (-974.686) (-976.087) * (-974.790) [-977.020] (-975.580) (-978.953) -- 0:00:47
      188000 -- (-980.128) (-980.887) (-976.236) [-974.955] * (-979.337) (-976.415) [-975.703] (-976.531) -- 0:00:47
      188500 -- [-977.296] (-979.010) (-975.844) (-977.770) * (-978.668) (-976.472) (-975.043) [-974.394] -- 0:00:47
      189000 -- [-974.561] (-975.655) (-981.277) (-975.852) * (-976.078) (-975.580) (-976.401) [-974.501] -- 0:00:51
      189500 -- (-976.976) [-974.086] (-976.058) (-980.704) * (-975.955) (-979.093) [-976.146] (-981.133) -- 0:00:51
      190000 -- (-978.127) [-975.701] (-975.159) (-978.741) * [-976.592] (-976.292) (-974.913) (-980.357) -- 0:00:51

      Average standard deviation of split frequencies: 0.019649

      190500 -- [-976.853] (-975.958) (-976.656) (-978.518) * (-976.954) [-976.873] (-976.214) (-977.399) -- 0:00:50
      191000 -- (-976.900) (-979.193) [-975.197] (-974.612) * [-975.131] (-975.607) (-974.826) (-980.175) -- 0:00:50
      191500 -- (-975.338) (-978.349) (-974.683) [-974.361] * [-976.649] (-977.100) (-976.781) (-979.520) -- 0:00:50
      192000 -- (-976.374) [-978.460] (-974.654) (-976.458) * [-977.767] (-974.276) (-974.925) (-976.576) -- 0:00:50
      192500 -- (-978.031) (-976.275) [-978.371] (-974.660) * (-979.080) (-974.579) [-975.028] (-978.271) -- 0:00:50
      193000 -- (-978.725) (-975.715) (-974.324) [-976.915] * [-975.214] (-975.926) (-974.372) (-977.127) -- 0:00:50
      193500 -- (-978.853) [-978.100] (-975.380) (-976.306) * (-975.571) (-975.136) [-975.873] (-976.833) -- 0:00:50
      194000 -- (-979.398) (-978.713) [-974.294] (-975.389) * [-976.466] (-979.207) (-975.638) (-977.688) -- 0:00:49
      194500 -- (-977.682) [-976.677] (-975.610) (-974.755) * (-977.080) (-976.917) (-975.682) [-976.023] -- 0:00:49
      195000 -- [-974.410] (-977.247) (-976.893) (-974.535) * [-979.419] (-980.248) (-977.569) (-976.096) -- 0:00:49

      Average standard deviation of split frequencies: 0.020310

      195500 -- [-979.759] (-975.436) (-975.969) (-974.408) * (-981.660) (-976.978) (-979.236) [-975.860] -- 0:00:49
      196000 -- (-978.596) (-983.727) [-976.742] (-976.218) * (-977.395) (-979.003) (-978.017) [-976.350] -- 0:00:49
      196500 -- (-978.449) (-977.228) (-978.780) [-975.000] * (-977.008) [-977.519] (-982.635) (-974.726) -- 0:00:49
      197000 -- (-982.896) [-976.573] (-976.650) (-975.902) * (-977.413) [-976.055] (-975.682) (-974.608) -- 0:00:48
      197500 -- (-980.511) (-979.906) (-977.122) [-976.943] * (-978.148) [-977.154] (-975.683) (-975.278) -- 0:00:48
      198000 -- [-977.404] (-978.074) (-976.772) (-978.229) * (-975.101) [-977.212] (-976.588) (-976.091) -- 0:00:48
      198500 -- (-975.432) (-975.535) [-975.527] (-982.963) * (-974.834) (-976.649) (-976.028) [-977.613] -- 0:00:48
      199000 -- (-975.760) [-976.807] (-975.268) (-976.633) * (-976.086) (-974.324) [-975.064] (-974.802) -- 0:00:48
      199500 -- (-974.580) [-975.512] (-974.619) (-977.861) * (-974.914) [-974.805] (-974.483) (-980.128) -- 0:00:48
      200000 -- [-977.636] (-975.895) (-976.407) (-978.310) * (-977.489) (-976.157) (-977.112) [-975.465] -- 0:00:48

      Average standard deviation of split frequencies: 0.019055

      200500 -- [-976.478] (-975.349) (-975.645) (-976.410) * (-976.991) (-975.791) [-974.907] (-974.524) -- 0:00:47
      201000 -- (-976.139) [-975.938] (-975.619) (-976.178) * (-974.829) (-975.785) (-976.763) [-975.762] -- 0:00:47
      201500 -- [-977.374] (-975.604) (-975.359) (-976.086) * (-976.718) (-974.882) [-979.598] (-974.837) -- 0:00:47
      202000 -- (-976.935) (-975.445) [-977.215] (-975.410) * (-976.997) (-974.901) [-975.612] (-976.911) -- 0:00:47
      202500 -- [-976.373] (-979.655) (-977.439) (-976.163) * (-975.571) [-974.368] (-975.566) (-975.823) -- 0:00:47
      203000 -- (-974.855) (-981.290) (-977.282) [-974.173] * (-976.326) (-975.143) [-976.919] (-980.095) -- 0:00:47
      203500 -- [-978.194] (-978.948) (-975.394) (-975.230) * (-976.224) [-974.556] (-976.339) (-980.747) -- 0:00:46
      204000 -- [-980.388] (-979.599) (-976.078) (-974.755) * [-975.544] (-974.272) (-977.972) (-974.190) -- 0:00:46
      204500 -- [-976.029] (-978.873) (-977.723) (-974.511) * [-975.233] (-978.253) (-978.535) (-973.989) -- 0:00:46
      205000 -- (-977.900) [-976.308] (-976.669) (-974.332) * (-976.282) (-975.748) [-975.749] (-974.403) -- 0:00:46

      Average standard deviation of split frequencies: 0.018180

      205500 -- (-978.918) (-974.018) (-974.169) [-975.414] * [-974.229] (-975.320) (-974.708) (-977.001) -- 0:00:50
      206000 -- (-976.081) [-974.408] (-978.731) (-974.295) * (-979.587) (-974.748) [-974.536] (-974.476) -- 0:00:50
      206500 -- [-977.317] (-977.168) (-977.591) (-974.275) * (-977.443) (-978.933) [-974.201] (-974.706) -- 0:00:49
      207000 -- (-976.596) (-976.184) (-978.255) [-974.327] * (-976.387) [-977.540] (-977.222) (-975.429) -- 0:00:49
      207500 -- (-975.545) (-975.223) (-975.919) [-977.790] * (-977.547) [-977.609] (-979.263) (-975.599) -- 0:00:49
      208000 -- (-974.119) [-978.327] (-978.392) (-977.780) * (-980.776) [-975.400] (-974.913) (-975.703) -- 0:00:49
      208500 -- [-974.909] (-976.945) (-983.842) (-977.153) * (-978.496) (-976.135) [-976.222] (-976.989) -- 0:00:49
      209000 -- (-975.233) (-975.364) [-975.730] (-974.499) * (-978.079) [-977.737] (-980.226) (-973.894) -- 0:00:49
      209500 -- (-976.649) (-974.633) (-976.306) [-975.620] * [-975.962] (-977.950) (-976.723) (-974.063) -- 0:00:49
      210000 -- (-976.453) (-975.075) [-974.711] (-975.354) * [-976.939] (-980.137) (-977.082) (-975.113) -- 0:00:48

      Average standard deviation of split frequencies: 0.019580

      210500 -- (-976.414) (-980.570) (-974.533) [-975.212] * (-975.742) (-979.803) (-978.731) [-975.652] -- 0:00:48
      211000 -- (-978.676) (-976.291) [-976.224] (-974.988) * (-975.449) (-974.335) [-974.673] (-977.150) -- 0:00:48
      211500 -- (-976.318) (-976.294) (-975.477) [-974.833] * (-975.249) (-977.247) [-975.496] (-975.910) -- 0:00:48
      212000 -- (-975.668) (-978.852) [-975.610] (-975.325) * (-975.298) (-977.071) (-976.104) [-977.860] -- 0:00:48
      212500 -- (-975.256) (-979.158) [-976.085] (-975.477) * (-974.146) [-975.403] (-975.899) (-978.182) -- 0:00:48
      213000 -- [-975.407] (-976.363) (-976.237) (-974.168) * (-975.111) [-974.625] (-974.359) (-976.168) -- 0:00:48
      213500 -- (-975.024) (-977.871) [-976.398] (-976.944) * [-976.486] (-975.938) (-977.661) (-974.189) -- 0:00:47
      214000 -- [-975.523] (-976.703) (-982.700) (-975.905) * (-975.365) [-975.194] (-974.854) (-977.857) -- 0:00:47
      214500 -- (-976.174) (-977.256) (-978.716) [-974.706] * [-975.064] (-982.047) (-974.809) (-976.088) -- 0:00:47
      215000 -- [-976.982] (-977.221) (-976.451) (-976.799) * [-974.852] (-977.978) (-976.368) (-983.147) -- 0:00:47

      Average standard deviation of split frequencies: 0.018914

      215500 -- (-974.074) [-979.120] (-975.110) (-975.314) * (-975.541) (-976.595) [-977.081] (-977.499) -- 0:00:47
      216000 -- (-974.934) (-977.151) [-974.751] (-976.026) * (-978.790) (-977.149) [-976.322] (-977.241) -- 0:00:47
      216500 -- [-974.337] (-976.118) (-976.282) (-976.414) * (-980.404) (-974.887) [-975.851] (-977.955) -- 0:00:47
      217000 -- (-981.129) (-977.681) [-974.363] (-977.524) * (-978.142) (-976.462) (-976.508) [-976.643] -- 0:00:46
      217500 -- (-976.541) [-975.412] (-977.304) (-979.179) * (-978.420) (-979.868) (-980.773) [-976.140] -- 0:00:46
      218000 -- (-977.569) [-975.627] (-977.010) (-977.757) * (-977.355) [-977.184] (-973.975) (-975.648) -- 0:00:46
      218500 -- [-974.258] (-976.514) (-973.946) (-978.243) * [-975.709] (-976.150) (-977.448) (-979.633) -- 0:00:46
      219000 -- (-975.744) (-976.093) [-974.127] (-978.403) * (-976.479) [-976.159] (-975.497) (-978.772) -- 0:00:46
      219500 -- (-975.804) (-980.344) [-974.559] (-978.515) * [-974.317] (-976.750) (-977.332) (-976.627) -- 0:00:46
      220000 -- (-974.342) [-984.119] (-975.898) (-973.905) * [-974.490] (-975.299) (-976.454) (-979.308) -- 0:00:46

      Average standard deviation of split frequencies: 0.019352

      220500 -- (-974.009) (-977.536) [-977.312] (-978.637) * (-975.231) (-976.721) [-975.145] (-975.904) -- 0:00:45
      221000 -- (-974.299) [-974.150] (-977.665) (-976.033) * (-975.291) [-977.424] (-976.604) (-975.503) -- 0:00:45
      221500 -- [-976.127] (-980.143) (-977.544) (-976.450) * (-977.951) [-975.304] (-984.891) (-976.668) -- 0:00:49
      222000 -- (-975.820) (-982.250) [-976.751] (-976.281) * (-976.900) (-978.252) [-978.227] (-975.816) -- 0:00:49
      222500 -- (-979.564) (-975.298) [-975.730] (-975.019) * (-976.914) (-978.434) (-975.407) [-975.277] -- 0:00:48
      223000 -- (-975.332) (-975.020) [-976.408] (-975.364) * (-974.463) (-980.212) (-977.452) [-974.159] -- 0:00:48
      223500 -- (-974.678) (-975.739) [-976.588] (-974.716) * (-975.445) [-978.774] (-977.802) (-977.363) -- 0:00:48
      224000 -- (-975.031) [-974.813] (-976.125) (-973.895) * (-975.757) (-976.486) [-976.158] (-975.607) -- 0:00:48
      224500 -- (-976.089) [-975.068] (-976.834) (-974.950) * (-976.058) (-975.454) (-976.216) [-976.766] -- 0:00:48
      225000 -- (-974.220) [-977.927] (-976.715) (-974.734) * [-974.372] (-976.010) (-976.069) (-978.007) -- 0:00:48

      Average standard deviation of split frequencies: 0.018992

      225500 -- (-974.745) [-975.173] (-975.514) (-977.340) * (-974.675) (-976.355) (-977.096) [-978.111] -- 0:00:48
      226000 -- (-976.936) (-975.772) [-974.384] (-979.414) * (-974.849) [-976.249] (-978.407) (-976.440) -- 0:00:47
      226500 -- (-976.275) [-974.993] (-976.477) (-977.596) * [-975.690] (-978.401) (-976.420) (-975.324) -- 0:00:47
      227000 -- (-978.048) (-975.233) [-975.740] (-975.702) * (-975.662) (-977.588) [-977.892] (-974.313) -- 0:00:47
      227500 -- (-975.163) (-975.835) [-974.129] (-975.996) * (-978.290) (-977.405) (-975.609) [-974.916] -- 0:00:47
      228000 -- (-974.822) [-976.541] (-974.178) (-976.796) * (-977.622) [-976.542] (-975.149) (-976.112) -- 0:00:47
      228500 -- (-976.445) (-975.873) (-974.170) [-978.494] * (-975.145) (-976.254) (-977.142) [-975.845] -- 0:00:47
      229000 -- (-976.263) (-974.786) [-973.990] (-976.379) * (-975.978) (-978.390) (-977.017) [-974.265] -- 0:00:47
      229500 -- (-975.968) [-974.405] (-976.358) (-975.561) * (-978.240) (-978.756) [-978.783] (-975.860) -- 0:00:47
      230000 -- [-974.897] (-975.991) (-975.488) (-978.762) * [-974.008] (-979.358) (-976.217) (-975.407) -- 0:00:46

      Average standard deviation of split frequencies: 0.017551

      230500 -- (-974.873) (-977.235) [-977.112] (-975.741) * (-975.501) (-978.274) (-974.487) [-975.517] -- 0:00:46
      231000 -- (-977.186) (-978.638) (-976.686) [-978.006] * (-975.260) [-979.429] (-977.752) (-976.353) -- 0:00:46
      231500 -- (-974.278) [-976.387] (-975.365) (-975.471) * (-974.736) [-975.832] (-976.007) (-975.045) -- 0:00:46
      232000 -- (-974.261) (-981.421) (-977.887) [-976.551] * (-976.816) (-975.738) [-977.301] (-976.896) -- 0:00:46
      232500 -- (-975.593) (-977.795) [-975.002] (-977.853) * (-976.067) (-977.251) [-977.043] (-981.027) -- 0:00:46
      233000 -- (-976.074) (-975.749) (-979.105) [-979.546] * (-976.959) [-976.370] (-976.630) (-978.574) -- 0:00:46
      233500 -- (-975.399) (-977.172) [-977.660] (-978.033) * (-975.163) [-975.052] (-975.016) (-975.912) -- 0:00:45
      234000 -- (-976.310) (-977.005) (-976.278) [-977.738] * (-976.789) [-975.022] (-975.472) (-975.684) -- 0:00:45
      234500 -- (-980.372) (-976.809) [-974.929] (-976.457) * (-975.307) (-977.833) (-978.576) [-974.965] -- 0:00:45
      235000 -- [-976.328] (-978.062) (-975.291) (-974.281) * (-976.118) [-974.247] (-977.465) (-976.191) -- 0:00:45

      Average standard deviation of split frequencies: 0.017155

      235500 -- [-975.028] (-978.011) (-976.081) (-975.268) * [-975.044] (-975.060) (-983.455) (-975.728) -- 0:00:45
      236000 -- (-975.099) (-978.410) (-976.184) [-976.014] * (-979.431) (-975.075) (-979.455) [-975.523] -- 0:00:45
      236500 -- (-976.917) (-974.638) (-977.018) [-977.817] * [-980.406] (-974.129) (-977.695) (-977.187) -- 0:00:45
      237000 -- [-976.445] (-975.586) (-975.424) (-976.301) * (-976.606) (-974.372) [-975.678] (-976.126) -- 0:00:45
      237500 -- (-975.147) (-975.586) (-977.493) [-975.773] * [-976.395] (-975.531) (-974.726) (-978.151) -- 0:00:44
      238000 -- (-977.641) (-975.907) (-982.754) [-974.486] * (-975.069) (-975.109) [-975.741] (-975.841) -- 0:00:48
      238500 -- (-980.645) [-974.626] (-979.428) (-975.345) * [-974.979] (-975.155) (-976.054) (-976.459) -- 0:00:47
      239000 -- (-978.170) (-976.649) (-978.780) [-975.349] * (-975.070) [-975.557] (-976.997) (-975.198) -- 0:00:47
      239500 -- (-976.571) [-976.972] (-974.980) (-975.112) * (-975.238) (-975.222) [-975.226] (-979.897) -- 0:00:47
      240000 -- (-976.718) (-975.934) (-977.062) [-974.660] * [-974.882] (-976.533) (-974.311) (-979.633) -- 0:00:47

      Average standard deviation of split frequencies: 0.017955

      240500 -- (-975.568) (-976.166) [-977.865] (-974.163) * (-974.414) (-975.197) (-975.037) [-976.845] -- 0:00:47
      241000 -- [-976.317] (-980.174) (-977.818) (-977.460) * (-975.647) [-977.592] (-978.025) (-976.598) -- 0:00:47
      241500 -- (-975.003) (-978.632) (-975.697) [-974.458] * (-976.252) (-978.167) (-976.285) [-977.195] -- 0:00:47
      242000 -- [-979.231] (-976.448) (-975.579) (-981.635) * [-975.283] (-975.306) (-978.228) (-974.548) -- 0:00:46
      242500 -- (-975.605) (-977.632) [-976.840] (-975.126) * (-977.167) (-978.042) (-979.038) [-974.537] -- 0:00:46
      243000 -- (-976.546) (-975.402) [-974.787] (-975.873) * (-975.324) (-976.561) [-974.497] (-974.179) -- 0:00:46
      243500 -- (-981.776) (-982.584) (-975.295) [-976.155] * (-974.334) (-975.918) [-975.218] (-974.167) -- 0:00:46
      244000 -- (-977.200) [-981.572] (-975.226) (-975.929) * (-976.289) (-974.989) [-976.946] (-974.218) -- 0:00:46
      244500 -- (-976.150) (-976.408) (-977.841) [-976.171] * [-978.596] (-973.892) (-978.753) (-975.324) -- 0:00:46
      245000 -- (-978.353) (-975.938) (-976.424) [-974.484] * (-976.826) [-974.445] (-977.230) (-973.868) -- 0:00:46

      Average standard deviation of split frequencies: 0.018098

      245500 -- (-977.282) (-977.510) (-975.504) [-974.563] * (-976.401) (-976.188) (-977.521) [-977.406] -- 0:00:46
      246000 -- (-977.060) (-979.855) (-976.291) [-975.581] * [-977.568] (-981.142) (-976.368) (-975.595) -- 0:00:45
      246500 -- (-974.858) (-976.935) [-977.575] (-974.795) * (-974.829) (-979.334) [-976.692] (-980.387) -- 0:00:45
      247000 -- (-977.007) [-976.029] (-977.844) (-976.201) * (-975.886) [-975.419] (-977.839) (-977.016) -- 0:00:45
      247500 -- (-976.363) (-981.454) (-977.506) [-975.813] * (-974.907) (-975.088) [-975.909] (-974.025) -- 0:00:45
      248000 -- (-979.940) [-976.857] (-975.971) (-975.693) * (-976.040) (-977.385) [-974.495] (-977.370) -- 0:00:45
      248500 -- (-975.829) (-976.375) (-977.145) [-977.658] * (-979.777) (-975.838) [-974.507] (-979.043) -- 0:00:45
      249000 -- (-978.249) (-980.476) (-976.053) [-978.038] * (-977.071) [-977.766] (-974.943) (-978.039) -- 0:00:45
      249500 -- [-976.131] (-976.836) (-977.526) (-974.209) * (-979.651) (-978.394) (-977.165) [-975.379] -- 0:00:45
      250000 -- [-976.267] (-975.584) (-974.631) (-976.158) * (-977.520) (-975.431) (-977.474) [-975.354] -- 0:00:45

      Average standard deviation of split frequencies: 0.018917

      250500 -- (-979.009) (-976.136) (-974.786) [-978.638] * (-976.547) (-976.406) [-979.021] (-975.171) -- 0:00:44
      251000 -- (-975.290) (-974.789) [-974.696] (-978.338) * (-976.380) (-978.118) [-976.688] (-974.328) -- 0:00:44
      251500 -- (-977.282) (-975.872) (-978.265) [-977.762] * (-976.738) (-974.907) (-977.289) [-974.229] -- 0:00:44
      252000 -- (-975.474) (-975.132) [-977.418] (-977.337) * (-977.120) (-975.494) (-977.900) [-973.955] -- 0:00:44
      252500 -- (-975.238) (-975.974) (-974.815) [-974.063] * (-982.637) [-975.424] (-976.121) (-975.259) -- 0:00:44
      253000 -- (-975.412) (-976.235) (-974.950) [-973.845] * [-980.056] (-975.739) (-976.198) (-979.270) -- 0:00:44
      253500 -- (-975.764) (-976.210) [-976.822] (-975.802) * (-979.843) (-975.680) [-975.280] (-975.490) -- 0:00:44
      254000 -- [-976.247] (-975.515) (-975.790) (-975.611) * (-978.865) [-975.854] (-974.993) (-979.361) -- 0:00:46
      254500 -- (-978.927) (-976.758) [-974.795] (-976.363) * (-978.327) (-975.586) (-976.332) [-976.622] -- 0:00:46
      255000 -- (-982.796) (-979.219) [-977.609] (-978.384) * (-975.505) [-976.293] (-975.918) (-976.798) -- 0:00:46

      Average standard deviation of split frequencies: 0.019172

      255500 -- (-974.929) [-975.805] (-975.886) (-980.966) * [-975.831] (-975.051) (-974.130) (-976.091) -- 0:00:46
      256000 -- (-977.075) (-978.450) [-976.346] (-974.418) * (-975.275) (-975.327) (-975.190) [-976.400] -- 0:00:46
      256500 -- [-980.819] (-975.494) (-981.337) (-974.727) * (-977.350) [-974.659] (-974.776) (-975.368) -- 0:00:46
      257000 -- (-975.579) (-976.818) [-974.855] (-975.031) * [-981.745] (-975.070) (-974.448) (-975.662) -- 0:00:46
      257500 -- (-977.991) (-976.380) (-974.521) [-975.772] * (-974.981) [-977.776] (-979.599) (-975.979) -- 0:00:46
      258000 -- [-975.754] (-976.859) (-976.861) (-979.020) * [-974.980] (-975.603) (-975.853) (-975.360) -- 0:00:46
      258500 -- (-975.412) (-977.206) (-976.473) [-977.099] * (-974.801) (-975.964) (-976.648) [-975.479] -- 0:00:45
      259000 -- (-974.753) (-979.774) (-976.949) [-976.053] * (-979.011) (-977.584) [-974.724] (-977.365) -- 0:00:45
      259500 -- (-978.763) (-976.711) (-976.567) [-980.128] * (-976.452) [-976.678] (-974.563) (-979.730) -- 0:00:45
      260000 -- (-976.034) (-976.229) [-976.311] (-978.399) * (-975.665) (-975.121) [-976.319] (-977.367) -- 0:00:45

      Average standard deviation of split frequencies: 0.018085

      260500 -- (-975.586) (-978.223) (-977.826) [-975.068] * [-974.432] (-975.979) (-977.498) (-973.814) -- 0:00:45
      261000 -- (-977.506) (-974.299) [-976.910] (-975.078) * (-974.678) (-975.621) [-976.077] (-974.209) -- 0:00:45
      261500 -- [-975.827] (-976.797) (-977.163) (-977.783) * (-975.254) (-976.708) [-974.730] (-978.950) -- 0:00:45
      262000 -- (-975.175) (-975.708) (-975.009) [-983.207] * (-978.101) (-976.102) [-975.347] (-979.172) -- 0:00:45
      262500 -- [-976.439] (-975.703) (-975.039) (-978.266) * (-976.435) (-977.305) [-975.126] (-979.322) -- 0:00:44
      263000 -- (-977.369) [-975.699] (-976.178) (-975.485) * (-978.772) (-979.342) [-976.202] (-977.158) -- 0:00:44
      263500 -- (-977.289) [-978.077] (-976.465) (-975.975) * [-975.285] (-979.888) (-975.110) (-975.243) -- 0:00:44
      264000 -- [-976.113] (-979.071) (-975.031) (-974.537) * (-975.277) (-977.149) [-978.470] (-977.007) -- 0:00:44
      264500 -- (-980.822) (-979.950) [-976.395] (-973.899) * (-976.635) (-975.458) (-976.310) [-976.131] -- 0:00:44
      265000 -- (-977.767) (-976.145) (-975.196) [-973.899] * (-975.232) [-977.245] (-975.683) (-977.003) -- 0:00:44

      Average standard deviation of split frequencies: 0.017305

      265500 -- (-974.849) (-976.161) [-975.078] (-976.888) * (-974.571) [-974.549] (-978.105) (-977.578) -- 0:00:44
      266000 -- [-974.734] (-975.292) (-975.768) (-976.281) * (-975.143) (-974.720) [-975.454] (-975.473) -- 0:00:44
      266500 -- (-976.705) (-978.805) (-979.012) [-975.696] * (-975.411) (-979.977) (-975.162) [-976.426] -- 0:00:44
      267000 -- (-975.859) [-974.861] (-975.163) (-978.822) * (-975.121) (-978.174) [-976.007] (-979.027) -- 0:00:43
      267500 -- (-974.119) [-975.296] (-979.045) (-975.354) * (-975.629) [-976.909] (-977.835) (-976.381) -- 0:00:43
      268000 -- [-974.123] (-977.701) (-983.871) (-976.704) * (-976.809) [-978.575] (-977.128) (-976.731) -- 0:00:43
      268500 -- [-976.842] (-977.982) (-979.956) (-976.055) * [-977.583] (-976.648) (-974.178) (-976.252) -- 0:00:43
      269000 -- (-976.516) (-974.514) (-978.073) [-975.706] * (-979.993) (-976.936) [-975.484] (-976.247) -- 0:00:43
      269500 -- (-978.558) (-976.878) [-978.072] (-975.176) * (-978.978) (-977.711) [-975.694] (-976.519) -- 0:00:43
      270000 -- [-978.148] (-975.965) (-977.307) (-975.511) * (-980.129) (-978.574) (-975.309) [-975.678] -- 0:00:43

      Average standard deviation of split frequencies: 0.015880

      270500 -- (-979.243) (-974.434) [-974.958] (-974.772) * (-978.805) (-977.500) [-975.252] (-976.686) -- 0:00:45
      271000 -- [-975.522] (-974.352) (-977.327) (-978.130) * (-976.203) [-975.034] (-975.812) (-975.854) -- 0:00:45
      271500 -- [-975.003] (-979.835) (-978.176) (-977.313) * (-984.207) (-974.085) (-978.439) [-975.097] -- 0:00:45
      272000 -- (-975.417) [-980.656] (-975.215) (-975.672) * (-975.989) (-978.724) [-975.813] (-977.825) -- 0:00:45
      272500 -- (-975.288) (-975.261) (-974.708) [-975.849] * [-975.297] (-975.437) (-980.033) (-975.517) -- 0:00:45
      273000 -- (-980.884) (-977.906) (-975.680) [-977.012] * [-975.505] (-978.837) (-974.597) (-976.557) -- 0:00:45
      273500 -- (-979.737) (-977.649) (-980.208) [-977.150] * (-977.296) (-976.072) [-974.154] (-980.280) -- 0:00:45
      274000 -- (-974.719) [-975.904] (-976.640) (-974.489) * (-975.669) (-975.956) (-975.950) [-974.846] -- 0:00:45
      274500 -- (-976.507) (-975.940) [-976.346] (-974.302) * (-975.092) (-976.890) (-975.631) [-977.009] -- 0:00:44
      275000 -- (-977.610) (-976.907) (-977.632) [-975.835] * (-974.568) (-975.013) [-975.068] (-976.536) -- 0:00:44

      Average standard deviation of split frequencies: 0.015874

      275500 -- (-975.490) (-977.328) (-978.752) [-976.333] * (-977.286) (-978.450) (-976.199) [-974.207] -- 0:00:44
      276000 -- [-977.485] (-977.772) (-976.715) (-978.538) * (-975.266) [-976.307] (-976.265) (-974.873) -- 0:00:44
      276500 -- (-977.546) (-976.247) [-976.506] (-976.220) * [-978.797] (-975.822) (-977.144) (-974.771) -- 0:00:44
      277000 -- [-976.194] (-976.407) (-980.573) (-975.995) * (-976.207) (-975.805) [-975.421] (-974.698) -- 0:00:44
      277500 -- (-976.574) (-977.464) (-975.427) [-976.063] * [-976.080] (-977.412) (-976.199) (-977.591) -- 0:00:44
      278000 -- (-978.289) (-974.897) (-975.228) [-977.658] * [-979.269] (-976.865) (-976.936) (-975.541) -- 0:00:44
      278500 -- [-974.953] (-974.128) (-974.530) (-977.001) * (-976.016) [-976.647] (-975.751) (-975.799) -- 0:00:44
      279000 -- (-979.000) [-977.462] (-975.115) (-977.057) * (-975.905) [-977.608] (-977.428) (-978.978) -- 0:00:43
      279500 -- (-978.461) (-974.798) [-976.160] (-978.082) * [-976.725] (-975.995) (-976.524) (-976.868) -- 0:00:43
      280000 -- (-976.231) (-974.465) (-978.071) [-977.998] * (-974.217) [-974.932] (-976.590) (-978.059) -- 0:00:43

      Average standard deviation of split frequencies: 0.014128

      280500 -- [-975.041] (-974.476) (-979.027) (-976.446) * [-975.992] (-975.131) (-974.333) (-974.780) -- 0:00:43
      281000 -- (-982.435) (-977.900) (-978.902) [-978.818] * (-974.821) (-978.557) [-974.404] (-976.686) -- 0:00:43
      281500 -- (-977.534) (-978.541) (-980.501) [-974.694] * (-974.604) [-976.161] (-976.628) (-975.179) -- 0:00:43
      282000 -- (-977.802) (-976.570) (-974.557) [-976.399] * (-976.981) [-974.503] (-975.839) (-976.924) -- 0:00:43
      282500 -- (-975.301) (-975.533) [-979.011] (-977.153) * (-977.455) (-975.210) [-976.308] (-973.946) -- 0:00:43
      283000 -- (-977.770) (-978.500) [-974.620] (-977.411) * (-974.663) [-977.362] (-977.270) (-974.896) -- 0:00:43
      283500 -- (-977.339) [-978.336] (-976.463) (-974.526) * (-978.885) (-976.102) (-977.516) [-975.169] -- 0:00:42
      284000 -- (-977.983) [-974.176] (-977.333) (-975.599) * (-978.041) [-974.846] (-975.466) (-974.584) -- 0:00:42
      284500 -- (-974.901) (-977.419) [-976.370] (-975.197) * (-976.543) [-975.005] (-975.860) (-974.906) -- 0:00:42
      285000 -- (-974.567) [-977.192] (-976.151) (-976.283) * (-973.953) [-976.986] (-983.851) (-975.552) -- 0:00:42

      Average standard deviation of split frequencies: 0.015319

      285500 -- (-974.640) (-978.936) (-975.829) [-976.821] * (-975.354) [-976.019] (-977.049) (-976.025) -- 0:00:42
      286000 -- (-974.125) [-975.615] (-978.344) (-975.909) * (-974.788) [-976.183] (-978.383) (-978.321) -- 0:00:42
      286500 -- [-974.988] (-979.062) (-978.479) (-975.180) * (-980.561) [-975.899] (-976.706) (-978.493) -- 0:00:42
      287000 -- (-975.401) (-978.263) [-975.415] (-978.144) * (-976.036) (-978.163) [-979.005] (-975.648) -- 0:00:44
      287500 -- (-974.332) (-976.723) (-975.445) [-975.757] * (-983.046) (-982.708) [-976.416] (-978.234) -- 0:00:44
      288000 -- (-974.895) (-974.055) [-974.480] (-978.144) * [-977.137] (-978.436) (-977.998) (-976.252) -- 0:00:44
      288500 -- [-974.786] (-974.692) (-974.437) (-976.757) * (-979.551) (-974.676) (-977.884) [-975.600] -- 0:00:44
      289000 -- (-975.024) (-976.474) (-978.282) [-978.418] * (-975.866) (-975.136) [-975.542] (-975.405) -- 0:00:44
      289500 -- [-978.044] (-974.617) (-974.311) (-977.693) * (-975.014) (-974.627) (-976.715) [-974.545] -- 0:00:44
      290000 -- (-977.253) (-976.276) (-975.356) [-977.678] * (-975.245) (-974.359) [-975.394] (-975.667) -- 0:00:44

      Average standard deviation of split frequencies: 0.014405

      290500 -- (-974.222) (-975.880) [-976.699] (-976.906) * [-975.675] (-975.607) (-975.801) (-974.862) -- 0:00:43
      291000 -- [-975.506] (-976.872) (-975.262) (-976.785) * (-978.218) (-975.625) [-975.748] (-975.772) -- 0:00:43
      291500 -- (-974.655) (-977.173) [-975.520] (-975.625) * (-976.381) [-974.678] (-974.550) (-975.772) -- 0:00:43
      292000 -- (-976.994) [-977.107] (-976.387) (-974.844) * (-978.222) (-975.487) (-974.498) [-976.644] -- 0:00:43
      292500 -- (-982.807) (-974.471) [-974.689] (-975.471) * (-974.335) (-977.480) [-975.567] (-976.315) -- 0:00:43
      293000 -- (-981.059) (-974.582) (-975.684) [-978.208] * (-975.934) [-975.156] (-977.997) (-974.805) -- 0:00:43
      293500 -- (-975.017) (-974.205) [-978.621] (-979.436) * (-974.994) (-975.490) [-978.456] (-976.189) -- 0:00:43
      294000 -- (-974.782) (-974.466) [-976.642] (-977.975) * (-976.439) (-974.386) [-979.489] (-978.050) -- 0:00:43
      294500 -- (-976.994) (-974.800) (-978.366) [-978.241] * [-975.336] (-981.047) (-974.816) (-981.466) -- 0:00:43
      295000 -- (-976.107) (-976.112) (-979.020) [-974.375] * [-974.388] (-978.633) (-977.718) (-976.621) -- 0:00:43

      Average standard deviation of split frequencies: 0.014333

      295500 -- (-974.828) [-975.614] (-974.886) (-976.266) * [-974.714] (-976.199) (-978.618) (-975.813) -- 0:00:42
      296000 -- (-976.750) (-977.057) (-974.743) [-976.114] * (-974.819) [-978.244] (-975.569) (-974.708) -- 0:00:42
      296500 -- (-979.920) (-976.402) [-974.932] (-977.244) * (-976.056) [-977.322] (-974.750) (-975.970) -- 0:00:42
      297000 -- (-977.294) (-978.300) [-975.392] (-975.110) * [-979.002] (-976.675) (-977.919) (-978.368) -- 0:00:42
      297500 -- (-975.271) [-975.026] (-975.844) (-974.833) * (-977.471) [-974.852] (-976.545) (-976.549) -- 0:00:42
      298000 -- (-974.770) (-976.779) (-979.867) [-975.364] * (-976.776) (-975.147) [-974.544] (-976.233) -- 0:00:42
      298500 -- (-979.353) (-974.469) [-977.381] (-975.648) * [-974.731] (-974.229) (-977.890) (-975.896) -- 0:00:42
      299000 -- (-976.982) [-974.947] (-975.472) (-974.784) * [-974.671] (-976.486) (-976.439) (-975.493) -- 0:00:42
      299500 -- [-974.652] (-974.948) (-974.242) (-974.867) * (-975.934) (-976.118) [-978.136] (-976.196) -- 0:00:42
      300000 -- [-974.510] (-974.655) (-976.231) (-976.844) * (-975.684) [-975.748] (-976.021) (-974.660) -- 0:00:42

      Average standard deviation of split frequencies: 0.013557

      300500 -- (-974.563) (-977.408) [-977.507] (-976.452) * (-975.760) [-975.751] (-977.785) (-974.968) -- 0:00:41
      301000 -- (-974.664) [-977.673] (-980.764) (-974.427) * (-976.152) (-976.682) [-975.571] (-975.770) -- 0:00:41
      301500 -- (-976.018) (-975.936) (-975.561) [-974.816] * (-976.210) [-975.777] (-976.528) (-977.960) -- 0:00:41
      302000 -- [-975.558] (-975.923) (-974.612) (-974.924) * (-977.072) [-974.580] (-977.341) (-978.677) -- 0:00:41
      302500 -- (-974.840) (-975.971) [-977.764] (-974.328) * [-975.559] (-975.104) (-975.237) (-975.830) -- 0:00:41
      303000 -- (-979.311) (-977.238) (-977.462) [-976.168] * (-973.862) (-976.045) [-974.367] (-976.297) -- 0:00:43
      303500 -- (-978.269) [-978.140] (-976.846) (-975.724) * [-976.159] (-977.102) (-974.514) (-975.019) -- 0:00:43
      304000 -- (-975.930) (-974.691) (-977.070) [-974.599] * (-975.556) (-979.023) [-974.137] (-976.998) -- 0:00:43
      304500 -- (-978.312) [-975.072] (-978.069) (-975.968) * (-976.119) (-974.780) (-976.358) [-979.122] -- 0:00:43
      305000 -- [-976.145] (-976.454) (-979.238) (-974.920) * [-974.673] (-978.262) (-976.225) (-975.636) -- 0:00:43

      Average standard deviation of split frequencies: 0.012777

      305500 -- (-974.652) [-976.175] (-974.948) (-975.525) * [-974.840] (-982.246) (-974.108) (-974.255) -- 0:00:43
      306000 -- (-974.896) (-974.684) (-975.031) [-976.319] * (-978.202) (-983.436) (-974.260) [-975.124] -- 0:00:43
      306500 -- (-973.972) [-975.361] (-976.528) (-974.253) * (-981.558) [-976.474] (-973.930) (-976.531) -- 0:00:42
      307000 -- (-974.638) (-975.574) [-977.324] (-981.768) * (-975.306) [-976.209] (-974.114) (-976.326) -- 0:00:42
      307500 -- [-977.421] (-974.680) (-980.669) (-978.705) * (-975.569) (-976.177) (-975.308) [-975.801] -- 0:00:42
      308000 -- (-974.303) [-979.614] (-982.763) (-976.433) * (-975.163) [-977.273] (-975.316) (-976.075) -- 0:00:42
      308500 -- [-974.170] (-975.413) (-974.445) (-976.125) * (-976.076) [-975.845] (-975.422) (-977.744) -- 0:00:42
      309000 -- (-974.081) [-975.059] (-977.848) (-978.255) * (-975.868) (-981.395) [-976.205] (-975.833) -- 0:00:42
      309500 -- (-975.068) [-977.579] (-975.574) (-984.608) * (-975.379) (-980.853) (-981.511) [-977.521] -- 0:00:42
      310000 -- (-974.804) (-975.360) [-979.409] (-982.270) * (-975.707) (-981.329) (-979.409) [-975.446] -- 0:00:42

      Average standard deviation of split frequencies: 0.011961

      310500 -- [-977.339] (-973.966) (-978.595) (-976.239) * [-975.867] (-976.661) (-977.538) (-974.982) -- 0:00:42
      311000 -- (-975.649) [-981.532] (-976.677) (-974.294) * [-975.699] (-976.690) (-978.113) (-976.644) -- 0:00:42
      311500 -- (-974.625) (-977.374) [-979.080] (-976.638) * (-979.948) [-978.192] (-978.150) (-979.378) -- 0:00:41
      312000 -- [-976.900] (-977.048) (-983.290) (-975.234) * (-979.841) [-978.074] (-978.256) (-976.326) -- 0:00:41
      312500 -- (-974.955) (-973.888) (-978.449) [-975.458] * (-975.963) (-980.143) [-976.550] (-977.379) -- 0:00:41
      313000 -- (-974.402) (-974.476) (-976.882) [-974.386] * (-974.606) (-974.509) [-977.492] (-975.966) -- 0:00:41
      313500 -- (-974.048) (-975.115) [-977.291] (-975.471) * (-979.175) [-974.839] (-978.038) (-974.962) -- 0:00:41
      314000 -- (-974.016) [-976.089] (-974.300) (-976.784) * (-978.517) (-977.382) [-975.721] (-975.859) -- 0:00:41
      314500 -- (-975.629) (-976.983) [-979.695] (-976.719) * (-976.431) (-975.073) [-975.122] (-978.870) -- 0:00:41
      315000 -- (-977.396) [-975.706] (-975.577) (-978.142) * [-975.323] (-975.850) (-975.121) (-980.087) -- 0:00:41

      Average standard deviation of split frequencies: 0.011145

      315500 -- (-974.324) (-978.190) [-976.695] (-976.019) * (-975.434) (-976.505) (-975.047) [-978.906] -- 0:00:41
      316000 -- (-975.298) [-977.995] (-976.046) (-975.715) * (-977.212) (-979.704) (-974.801) [-977.205] -- 0:00:41
      316500 -- (-975.813) [-974.674] (-976.681) (-977.072) * [-975.325] (-982.031) (-976.806) (-975.483) -- 0:00:41
      317000 -- (-975.869) (-975.066) [-974.665] (-977.264) * (-977.927) [-979.176] (-977.476) (-975.601) -- 0:00:40
      317500 -- [-974.763] (-977.599) (-975.781) (-977.258) * (-976.627) (-978.792) (-980.066) [-976.627] -- 0:00:40
      318000 -- (-978.773) (-976.855) (-975.380) [-976.389] * [-976.260] (-974.367) (-977.669) (-976.816) -- 0:00:40
      318500 -- (-978.073) (-976.837) [-974.440] (-978.571) * (-976.827) [-976.014] (-975.262) (-977.959) -- 0:00:40
      319000 -- (-975.627) (-976.117) (-973.871) [-974.896] * [-977.349] (-976.011) (-974.880) (-977.623) -- 0:00:40
      319500 -- (-977.928) [-975.930] (-974.518) (-974.664) * [-975.558] (-974.563) (-975.581) (-974.628) -- 0:00:40
      320000 -- (-981.645) [-974.842] (-975.499) (-976.348) * (-975.802) [-975.258] (-976.157) (-975.185) -- 0:00:42

      Average standard deviation of split frequencies: 0.011852

      320500 -- [-975.483] (-978.824) (-975.635) (-974.090) * (-978.703) (-977.851) [-975.476] (-976.218) -- 0:00:42
      321000 -- (-977.727) (-976.529) (-974.585) [-974.109] * [-976.334] (-977.468) (-980.910) (-975.332) -- 0:00:42
      321500 -- [-976.960] (-975.931) (-978.747) (-976.702) * [-978.680] (-980.295) (-979.789) (-976.408) -- 0:00:42
      322000 -- (-976.699) (-974.166) (-979.613) [-978.837] * (-974.902) (-975.776) [-977.920] (-974.360) -- 0:00:42
      322500 -- [-974.830] (-975.568) (-977.661) (-977.865) * (-976.705) (-974.504) (-975.088) [-974.217] -- 0:00:42
      323000 -- [-974.834] (-977.551) (-977.038) (-976.230) * (-976.091) [-976.260] (-975.594) (-974.433) -- 0:00:41
      323500 -- (-976.813) [-979.913] (-974.239) (-975.453) * (-976.610) [-976.277] (-978.289) (-977.864) -- 0:00:41
      324000 -- (-976.356) (-976.287) (-977.637) [-975.155] * (-974.852) [-976.134] (-974.880) (-979.323) -- 0:00:41
      324500 -- (-976.152) (-976.351) [-974.576] (-975.092) * (-976.482) [-975.999] (-976.067) (-979.939) -- 0:00:41
      325000 -- [-978.189] (-977.304) (-975.507) (-978.779) * (-976.157) (-974.840) [-976.130] (-976.392) -- 0:00:41

      Average standard deviation of split frequencies: 0.011297

      325500 -- (-977.777) [-975.734] (-975.071) (-979.894) * (-975.894) (-979.050) [-974.567] (-977.722) -- 0:00:41
      326000 -- (-974.902) (-975.441) [-975.879] (-978.111) * (-978.419) (-976.359) [-974.730] (-977.164) -- 0:00:41
      326500 -- [-974.820] (-975.435) (-976.021) (-975.792) * (-980.251) (-974.854) (-975.642) [-974.954] -- 0:00:41
      327000 -- (-980.867) (-978.558) [-975.717] (-978.468) * (-977.619) (-977.042) (-975.046) [-979.326] -- 0:00:41
      327500 -- [-977.491] (-976.134) (-979.699) (-977.352) * (-980.379) [-974.710] (-975.715) (-977.411) -- 0:00:41
      328000 -- [-975.053] (-977.708) (-979.980) (-975.381) * (-976.357) (-976.266) [-974.373] (-977.009) -- 0:00:40
      328500 -- (-978.605) (-975.066) (-976.920) [-977.319] * (-978.579) [-976.653] (-978.891) (-979.563) -- 0:00:40
      329000 -- (-977.681) (-976.550) [-977.833] (-979.699) * (-980.331) (-978.505) [-983.232] (-978.570) -- 0:00:40
      329500 -- (-976.524) (-978.478) [-977.835] (-976.728) * (-975.186) (-977.490) [-978.234] (-974.621) -- 0:00:40
      330000 -- (-976.623) (-976.691) [-977.040] (-975.563) * [-974.137] (-979.943) (-974.742) (-976.874) -- 0:00:40

      Average standard deviation of split frequencies: 0.010818

      330500 -- (-976.941) (-977.313) (-974.940) [-974.527] * (-975.917) (-976.801) [-974.744] (-976.723) -- 0:00:40
      331000 -- (-978.477) (-978.652) (-977.911) [-976.583] * [-975.464] (-975.615) (-974.485) (-977.725) -- 0:00:40
      331500 -- (-977.565) (-976.440) [-976.034] (-975.248) * (-975.030) (-981.039) [-973.831] (-977.156) -- 0:00:40
      332000 -- (-975.059) (-975.826) [-974.920] (-976.259) * (-979.393) [-977.368] (-978.510) (-974.888) -- 0:00:40
      332500 -- (-973.940) (-974.558) (-975.165) [-974.779] * (-976.148) (-978.746) [-976.905] (-974.562) -- 0:00:40
      333000 -- (-974.522) (-976.007) [-976.518] (-974.385) * (-975.600) (-978.811) [-976.204] (-974.682) -- 0:00:40
      333500 -- (-975.224) (-979.718) (-975.364) [-974.871] * (-975.602) [-974.665] (-975.518) (-974.586) -- 0:00:39
      334000 -- (-974.581) (-973.832) [-978.091] (-976.426) * [-976.523] (-976.371) (-977.369) (-974.788) -- 0:00:39
      334500 -- (-975.454) (-973.964) [-974.704] (-976.040) * (-975.430) (-980.087) [-977.403] (-975.031) -- 0:00:39
      335000 -- (-976.688) (-978.502) [-974.343] (-976.412) * (-974.987) (-977.340) [-980.804] (-974.069) -- 0:00:39

      Average standard deviation of split frequencies: 0.010729

      335500 -- (-975.712) [-978.303] (-975.109) (-977.055) * [-976.517] (-976.109) (-975.980) (-975.478) -- 0:00:39
      336000 -- (-975.168) (-978.399) [-976.678] (-979.277) * (-982.345) (-978.052) (-974.500) [-974.884] -- 0:00:41
      336500 -- (-976.938) (-976.219) [-980.548] (-976.819) * (-979.650) (-976.255) (-976.071) [-975.724] -- 0:00:41
      337000 -- [-979.337] (-976.231) (-979.064) (-976.484) * (-978.760) (-977.741) [-974.804] (-976.259) -- 0:00:41
      337500 -- [-974.941] (-978.990) (-981.208) (-978.806) * [-974.422] (-976.962) (-974.944) (-975.114) -- 0:00:41
      338000 -- (-974.662) [-977.160] (-975.203) (-976.812) * (-975.120) [-976.750] (-976.334) (-975.979) -- 0:00:41
      338500 -- (-974.635) (-974.775) [-974.818] (-976.868) * (-976.731) (-976.618) (-975.550) [-974.972] -- 0:00:41
      339000 -- (-974.433) [-975.759] (-979.962) (-977.570) * (-975.271) (-977.897) (-977.063) [-976.178] -- 0:00:40
      339500 -- (-975.876) [-974.865] (-978.319) (-978.852) * (-975.673) (-978.469) [-976.502] (-975.071) -- 0:00:40
      340000 -- (-979.130) (-975.546) [-975.510] (-976.660) * (-975.800) [-975.721] (-976.437) (-974.462) -- 0:00:40

      Average standard deviation of split frequencies: 0.011676

      340500 -- (-974.296) [-977.128] (-975.456) (-975.410) * (-975.635) (-976.942) (-978.414) [-977.660] -- 0:00:40
      341000 -- (-976.488) (-975.641) [-976.918] (-977.205) * (-975.082) (-977.032) (-978.129) [-977.818] -- 0:00:40
      341500 -- [-979.244] (-976.507) (-975.586) (-975.708) * (-976.093) (-974.354) [-976.085] (-976.943) -- 0:00:40
      342000 -- [-975.574] (-975.792) (-976.724) (-976.872) * (-975.907) (-974.197) (-981.033) [-975.743] -- 0:00:40
      342500 -- (-975.555) [-974.439] (-975.732) (-975.801) * (-977.664) (-975.430) (-975.484) [-975.671] -- 0:00:40
      343000 -- (-975.133) [-974.351] (-975.398) (-978.132) * (-976.231) (-974.537) (-975.681) [-974.858] -- 0:00:40
      343500 -- (-975.138) [-974.349] (-974.514) (-975.165) * (-976.171) (-976.801) (-976.015) [-976.177] -- 0:00:40
      344000 -- (-976.011) (-977.315) (-974.076) [-978.323] * (-975.086) (-975.390) (-975.658) [-975.976] -- 0:00:40
      344500 -- (-974.439) (-975.986) (-975.440) [-976.497] * (-974.396) [-977.937] (-978.584) (-976.748) -- 0:00:39
      345000 -- [-974.732] (-975.970) (-976.643) (-980.128) * (-978.409) (-975.468) (-976.595) [-974.008] -- 0:00:39

      Average standard deviation of split frequencies: 0.011941

      345500 -- (-977.238) (-976.514) [-974.539] (-976.443) * (-977.047) (-976.287) (-977.969) [-978.259] -- 0:00:39
      346000 -- (-977.200) (-974.958) [-974.735] (-980.976) * [-975.290] (-975.695) (-977.440) (-975.431) -- 0:00:39
      346500 -- (-977.054) [-978.571] (-975.179) (-975.450) * [-977.293] (-975.942) (-980.169) (-979.578) -- 0:00:39
      347000 -- (-975.064) [-979.516] (-978.902) (-975.224) * (-979.376) (-975.250) (-975.539) [-976.494] -- 0:00:39
      347500 -- (-975.663) (-976.209) [-975.171] (-977.701) * (-976.630) (-975.006) [-974.453] (-975.979) -- 0:00:39
      348000 -- (-975.025) [-974.760] (-976.868) (-976.204) * (-980.850) (-985.304) (-975.215) [-974.678] -- 0:00:39
      348500 -- (-974.388) (-974.591) (-975.769) [-977.052] * (-977.528) [-978.339] (-975.296) (-974.988) -- 0:00:39
      349000 -- (-975.275) [-977.152] (-977.358) (-977.730) * (-976.173) (-976.996) [-976.596] (-977.037) -- 0:00:39
      349500 -- [-974.801] (-976.570) (-976.864) (-975.192) * [-974.927] (-976.872) (-976.610) (-977.024) -- 0:00:39
      350000 -- (-977.587) (-976.875) (-975.753) [-975.276] * [-975.993] (-977.701) (-974.187) (-975.265) -- 0:00:39

      Average standard deviation of split frequencies: 0.012351

      350500 -- (-976.900) [-980.212] (-976.367) (-979.621) * (-977.844) (-978.862) [-974.103] (-975.815) -- 0:00:38
      351000 -- [-977.585] (-982.701) (-980.871) (-977.389) * (-975.813) (-977.704) (-974.322) [-974.635] -- 0:00:38
      351500 -- (-975.549) (-980.323) (-980.054) [-975.110] * (-977.967) (-976.967) [-975.304] (-976.655) -- 0:00:38
      352000 -- [-976.507] (-980.584) (-982.137) (-976.264) * (-977.967) (-978.526) (-976.435) [-977.339] -- 0:00:38
      352500 -- (-976.794) (-980.015) [-980.136] (-976.762) * (-976.051) (-976.067) (-974.346) [-975.647] -- 0:00:40
      353000 -- (-978.777) (-978.769) (-982.308) [-975.517] * (-978.055) (-976.184) (-976.381) [-976.391] -- 0:00:40
      353500 -- [-977.259] (-977.737) (-975.352) (-975.065) * (-975.508) (-978.637) [-975.121] (-976.565) -- 0:00:40
      354000 -- (-975.387) [-976.731] (-974.281) (-980.726) * (-975.457) (-976.909) (-978.517) [-976.907] -- 0:00:40
      354500 -- [-974.982] (-977.422) (-975.769) (-974.240) * (-975.309) (-974.856) (-979.182) [-977.387] -- 0:00:40
      355000 -- [-975.320] (-978.372) (-979.131) (-975.065) * (-975.424) (-974.992) (-977.597) [-978.415] -- 0:00:39

      Average standard deviation of split frequencies: 0.012166

      355500 -- [-976.840] (-978.162) (-978.537) (-975.059) * [-974.953] (-980.347) (-977.930) (-977.079) -- 0:00:39
      356000 -- (-976.319) [-975.693] (-977.053) (-977.344) * [-975.104] (-976.491) (-977.212) (-975.450) -- 0:00:39
      356500 -- [-974.812] (-975.324) (-977.743) (-975.939) * [-974.953] (-977.684) (-976.178) (-974.619) -- 0:00:39
      357000 -- (-975.327) (-974.619) [-976.185] (-974.238) * [-976.530] (-975.574) (-975.209) (-975.526) -- 0:00:39
      357500 -- [-975.353] (-974.257) (-979.165) (-974.528) * (-978.294) (-976.372) [-975.189] (-975.007) -- 0:00:39
      358000 -- (-977.738) (-977.882) (-978.062) [-981.499] * (-977.340) [-977.625] (-974.754) (-976.534) -- 0:00:39
      358500 -- (-975.134) (-976.403) [-978.739] (-981.758) * (-977.229) (-976.433) (-975.631) [-975.174] -- 0:00:39
      359000 -- (-975.754) [-977.226] (-979.140) (-976.926) * (-976.899) (-977.518) (-976.464) [-975.011] -- 0:00:39
      359500 -- [-977.279] (-976.897) (-976.249) (-977.693) * (-976.850) (-974.701) (-975.565) [-975.198] -- 0:00:39
      360000 -- [-975.512] (-974.280) (-981.838) (-977.516) * [-978.885] (-977.834) (-975.938) (-975.052) -- 0:00:39

      Average standard deviation of split frequencies: 0.012417

      360500 -- (-979.449) (-974.452) (-975.685) [-977.953] * (-979.939) (-977.154) (-975.965) [-974.822] -- 0:00:39
      361000 -- [-975.056] (-974.956) (-974.439) (-977.182) * (-976.922) (-978.946) [-976.170] (-976.349) -- 0:00:38
      361500 -- (-981.149) (-974.593) (-974.813) [-978.247] * [-977.531] (-982.017) (-976.199) (-980.054) -- 0:00:38
      362000 -- [-977.593] (-975.905) (-976.317) (-977.263) * [-978.948] (-976.551) (-974.689) (-977.225) -- 0:00:38
      362500 -- (-974.420) (-979.491) (-974.788) [-975.754] * [-975.720] (-978.838) (-974.694) (-974.476) -- 0:00:38
      363000 -- [-974.920] (-976.161) (-974.284) (-977.823) * [-974.905] (-976.570) (-974.526) (-976.883) -- 0:00:38
      363500 -- [-975.263] (-976.006) (-974.360) (-975.601) * [-975.052] (-974.152) (-975.205) (-978.048) -- 0:00:38
      364000 -- [-974.590] (-975.175) (-974.869) (-974.902) * (-977.739) (-974.405) [-976.256] (-979.234) -- 0:00:38
      364500 -- (-974.625) (-974.559) (-974.806) [-975.462] * (-975.943) [-975.726] (-977.935) (-977.247) -- 0:00:38
      365000 -- (-977.936) (-976.411) (-975.678) [-974.696] * [-974.538] (-974.164) (-978.089) (-976.892) -- 0:00:38

      Average standard deviation of split frequencies: 0.013041

      365500 -- (-976.073) (-974.709) (-975.459) [-975.218] * (-974.408) (-975.974) (-980.123) [-976.592] -- 0:00:38
      366000 -- [-975.987] (-974.418) (-981.121) (-974.237) * (-977.451) (-975.924) [-975.088] (-975.927) -- 0:00:38
      366500 -- (-977.024) (-974.366) (-977.620) [-974.961] * (-978.063) (-976.294) [-976.186] (-974.989) -- 0:00:38
      367000 -- (-975.118) [-974.548] (-978.969) (-977.971) * [-975.089] (-976.033) (-975.971) (-977.874) -- 0:00:37
      367500 -- (-979.303) [-974.115] (-981.448) (-976.295) * (-975.099) (-976.709) [-974.109] (-976.127) -- 0:00:37
      368000 -- (-979.699) (-974.748) (-981.335) [-976.371] * [-975.949] (-975.781) (-975.379) (-975.715) -- 0:00:37
      368500 -- (-975.581) (-975.390) (-981.608) [-976.635] * (-980.757) [-976.578] (-975.788) (-975.132) -- 0:00:37
      369000 -- (-974.891) (-976.296) [-977.620] (-977.208) * (-974.619) (-976.232) (-981.051) [-976.850] -- 0:00:39
      369500 -- [-978.002] (-976.648) (-975.592) (-978.397) * [-977.045] (-974.146) (-976.693) (-975.114) -- 0:00:39
      370000 -- [-977.517] (-974.580) (-977.398) (-977.319) * (-976.322) (-975.014) (-976.234) [-976.832] -- 0:00:39

      Average standard deviation of split frequencies: 0.013241

      370500 -- (-981.322) (-980.249) (-975.883) [-976.285] * (-976.918) (-974.234) [-976.595] (-979.694) -- 0:00:39
      371000 -- [-976.493] (-976.546) (-976.441) (-975.999) * [-974.926] (-978.329) (-974.652) (-976.133) -- 0:00:38
      371500 -- (-977.153) [-976.333] (-975.343) (-975.572) * (-976.641) [-974.031] (-974.992) (-976.736) -- 0:00:38
      372000 -- (-979.032) (-979.644) [-975.529] (-974.988) * (-978.282) (-977.183) (-973.992) [-975.070] -- 0:00:38
      372500 -- (-975.631) [-976.513] (-975.621) (-977.091) * (-976.532) (-977.378) (-976.730) [-974.774] -- 0:00:38
      373000 -- (-975.955) (-975.021) [-975.504] (-977.004) * (-975.001) [-977.171] (-974.898) (-982.264) -- 0:00:38
      373500 -- [-975.902] (-976.031) (-977.901) (-978.396) * (-974.856) [-977.551] (-974.637) (-980.006) -- 0:00:38
      374000 -- (-975.921) [-976.941] (-976.093) (-976.073) * (-976.683) [-977.434] (-975.910) (-978.605) -- 0:00:38
      374500 -- [-974.275] (-974.709) (-975.356) (-976.802) * [-975.449] (-976.900) (-979.703) (-974.293) -- 0:00:38
      375000 -- [-974.104] (-973.989) (-975.901) (-979.991) * [-979.046] (-974.182) (-979.006) (-976.571) -- 0:00:38

      Average standard deviation of split frequencies: 0.013634

      375500 -- (-975.954) [-974.854] (-977.868) (-978.054) * (-976.505) (-974.114) (-978.047) [-976.053] -- 0:00:38
      376000 -- (-977.859) (-974.929) (-974.664) [-978.334] * (-979.041) [-974.283] (-975.242) (-977.726) -- 0:00:38
      376500 -- (-980.382) (-975.153) (-975.509) [-975.274] * (-982.785) (-975.689) (-978.980) [-976.152] -- 0:00:38
      377000 -- (-975.750) (-974.408) (-975.123) [-974.808] * [-980.754] (-975.366) (-974.455) (-974.798) -- 0:00:38
      377500 -- (-976.428) (-973.944) [-977.009] (-974.554) * (-977.749) [-975.583] (-974.599) (-982.132) -- 0:00:37
      378000 -- (-974.979) [-975.092] (-979.094) (-974.767) * (-974.950) (-977.853) (-974.960) [-979.260] -- 0:00:37
      378500 -- [-976.082] (-975.490) (-976.608) (-978.831) * (-974.762) (-975.914) (-978.494) [-976.275] -- 0:00:37
      379000 -- (-975.703) [-975.301] (-976.603) (-978.887) * [-974.916] (-975.627) (-977.273) (-975.177) -- 0:00:37
      379500 -- [-974.894] (-975.221) (-977.669) (-975.612) * (-975.437) (-975.507) (-977.714) [-975.065] -- 0:00:37
      380000 -- (-980.506) (-975.062) (-977.840) [-974.738] * (-977.023) [-978.316] (-975.924) (-979.176) -- 0:00:37

      Average standard deviation of split frequencies: 0.013777

      380500 -- (-976.358) (-976.178) (-975.911) [-974.748] * (-976.998) [-977.411] (-975.624) (-980.384) -- 0:00:37
      381000 -- (-977.458) [-975.935] (-977.949) (-974.113) * [-976.653] (-975.348) (-976.220) (-983.427) -- 0:00:37
      381500 -- (-980.153) (-977.844) [-975.477] (-976.150) * (-976.093) (-979.088) [-974.614] (-978.184) -- 0:00:37
      382000 -- (-979.396) [-974.990] (-976.220) (-977.236) * (-980.446) (-975.797) (-974.005) [-974.684] -- 0:00:37
      382500 -- [-977.144] (-975.023) (-975.366) (-975.424) * (-974.581) (-979.324) [-974.289] (-979.399) -- 0:00:37
      383000 -- (-976.852) (-974.804) [-974.914] (-976.502) * (-975.606) (-975.993) (-974.992) [-974.480] -- 0:00:37
      383500 -- (-976.113) (-976.233) [-974.789] (-974.378) * (-979.352) (-976.932) (-975.485) [-974.484] -- 0:00:36
      384000 -- [-977.121] (-976.471) (-974.947) (-976.711) * (-978.883) (-981.593) [-975.823] (-975.017) -- 0:00:36
      384500 -- (-978.007) (-978.730) [-974.461] (-975.310) * (-978.619) (-976.886) (-984.806) [-973.939] -- 0:00:36
      385000 -- (-977.186) (-979.255) [-976.614] (-974.077) * [-975.893] (-976.005) (-979.771) (-976.678) -- 0:00:38

      Average standard deviation of split frequencies: 0.013052

      385500 -- (-980.854) [-976.235] (-975.484) (-977.174) * [-974.169] (-974.168) (-975.237) (-979.156) -- 0:00:38
      386000 -- (-983.370) (-983.347) (-974.636) [-979.676] * (-974.968) (-974.534) (-976.999) [-976.136] -- 0:00:38
      386500 -- (-975.971) (-979.501) (-976.500) [-974.015] * (-974.887) [-975.859] (-976.492) (-975.157) -- 0:00:38
      387000 -- (-977.365) (-975.664) (-977.023) [-977.572] * (-978.589) (-979.861) [-975.334] (-981.053) -- 0:00:38
      387500 -- (-974.636) (-974.882) (-977.582) [-974.475] * (-981.114) (-978.435) (-974.933) [-976.077] -- 0:00:37
      388000 -- (-974.339) (-974.603) [-975.932] (-975.015) * (-976.730) (-979.286) [-979.059] (-977.346) -- 0:00:37
      388500 -- [-976.964] (-975.224) (-975.598) (-978.348) * [-975.855] (-976.461) (-976.708) (-974.914) -- 0:00:37
      389000 -- (-974.506) (-975.412) (-975.482) [-977.225] * (-975.982) [-974.680] (-976.155) (-975.342) -- 0:00:37
      389500 -- (-974.056) [-974.652] (-975.606) (-975.668) * (-977.176) (-974.238) [-974.538] (-977.364) -- 0:00:37
      390000 -- (-975.031) (-974.488) (-977.324) [-978.912] * (-976.670) [-978.016] (-975.854) (-977.174) -- 0:00:37

      Average standard deviation of split frequencies: 0.012142

      390500 -- (-976.080) [-976.494] (-975.479) (-978.308) * (-975.014) [-975.000] (-975.342) (-980.505) -- 0:00:37
      391000 -- (-978.691) [-974.432] (-975.320) (-977.061) * [-976.901] (-979.570) (-977.760) (-980.423) -- 0:00:37
      391500 -- (-981.972) [-974.655] (-976.434) (-980.001) * (-977.525) (-976.060) (-977.483) [-979.432] -- 0:00:37
      392000 -- [-979.836] (-975.736) (-975.989) (-976.006) * (-975.901) (-974.472) (-977.119) [-975.266] -- 0:00:37
      392500 -- [-977.203] (-974.975) (-975.516) (-975.500) * [-977.418] (-974.888) (-977.600) (-977.517) -- 0:00:37
      393000 -- (-978.234) (-980.279) [-975.338] (-978.623) * (-977.844) [-974.682] (-977.299) (-975.239) -- 0:00:37
      393500 -- (-974.688) (-976.073) (-975.155) [-976.530] * (-979.763) [-977.164] (-977.625) (-976.097) -- 0:00:36
      394000 -- (-976.703) (-976.511) (-976.766) [-974.585] * (-976.316) (-976.773) (-975.578) [-975.303] -- 0:00:36
      394500 -- (-976.047) (-978.217) [-978.363] (-975.371) * [-975.379] (-977.103) (-975.333) (-975.628) -- 0:00:36
      395000 -- (-981.288) (-975.212) [-974.249] (-975.426) * (-977.356) (-974.715) (-974.567) [-975.043] -- 0:00:36

      Average standard deviation of split frequencies: 0.010863

      395500 -- (-977.466) [-976.568] (-975.640) (-975.770) * (-976.364) (-976.443) (-976.516) [-977.727] -- 0:00:36
      396000 -- (-975.796) (-976.700) [-974.296] (-977.857) * (-978.081) [-979.276] (-976.917) (-976.870) -- 0:00:36
      396500 -- (-975.479) (-981.627) [-974.868] (-980.393) * [-976.956] (-975.840) (-975.274) (-976.670) -- 0:00:36
      397000 -- [-976.303] (-975.700) (-979.750) (-977.866) * (-975.369) (-979.025) (-977.090) [-976.343] -- 0:00:36
      397500 -- (-975.632) (-975.860) (-977.982) [-975.297] * (-979.429) [-974.221] (-976.159) (-976.689) -- 0:00:36
      398000 -- (-976.860) (-975.528) (-978.342) [-974.563] * (-976.073) [-974.595] (-975.978) (-976.967) -- 0:00:36
      398500 -- [-975.175] (-978.812) (-976.554) (-976.943) * (-976.791) (-976.309) [-975.101] (-977.146) -- 0:00:36
      399000 -- (-974.691) (-977.636) (-974.501) [-976.160] * (-978.473) (-977.058) [-976.744] (-978.662) -- 0:00:36
      399500 -- [-975.109] (-974.666) (-977.073) (-977.101) * (-977.986) (-979.930) [-974.863] (-978.654) -- 0:00:37
      400000 -- (-979.742) (-976.227) [-977.778] (-975.606) * (-979.773) (-978.573) (-976.700) [-975.528] -- 0:00:37

      Average standard deviation of split frequencies: 0.011104

      400500 -- [-978.851] (-975.829) (-976.906) (-976.667) * [-974.511] (-974.583) (-976.543) (-974.937) -- 0:00:37
      401000 -- (-975.945) [-974.307] (-975.679) (-981.346) * (-974.328) [-975.468] (-975.877) (-975.504) -- 0:00:37
      401500 -- (-975.310) (-974.825) [-976.939] (-980.633) * (-975.207) (-974.663) [-974.503] (-975.925) -- 0:00:37
      402000 -- (-974.791) [-975.544] (-976.320) (-978.745) * [-974.947] (-974.649) (-975.709) (-976.829) -- 0:00:37
      402500 -- [-977.770] (-974.459) (-979.511) (-974.571) * (-974.426) (-977.562) (-974.877) [-976.789] -- 0:00:37
      403000 -- (-978.578) [-974.695] (-980.442) (-977.631) * [-974.844] (-978.816) (-974.277) (-976.328) -- 0:00:37
      403500 -- (-976.910) [-976.688] (-976.066) (-977.576) * (-976.307) (-975.285) [-975.791] (-976.748) -- 0:00:36
      404000 -- [-974.964] (-980.876) (-977.946) (-978.850) * (-976.047) (-976.075) [-979.598] (-976.661) -- 0:00:36
      404500 -- (-975.109) (-981.228) [-978.650] (-977.391) * (-974.271) [-975.064] (-977.083) (-975.136) -- 0:00:36
      405000 -- (-974.997) (-982.358) [-976.960] (-974.298) * [-976.073] (-984.284) (-977.041) (-977.764) -- 0:00:36

      Average standard deviation of split frequencies: 0.011248

      405500 -- (-978.003) [-975.355] (-978.710) (-975.904) * (-977.076) [-974.937] (-980.200) (-977.453) -- 0:00:36
      406000 -- (-977.851) [-975.530] (-976.087) (-975.573) * (-974.281) [-977.894] (-975.551) (-979.233) -- 0:00:36
      406500 -- (-977.074) (-976.290) [-975.663] (-977.436) * [-978.206] (-975.369) (-981.324) (-977.957) -- 0:00:36
      407000 -- (-977.980) (-976.810) [-974.966] (-977.142) * (-977.672) [-974.874] (-976.938) (-977.852) -- 0:00:36
      407500 -- [-974.899] (-975.593) (-975.319) (-976.701) * (-976.500) (-980.118) [-974.565] (-977.658) -- 0:00:36
      408000 -- (-974.234) (-980.027) (-978.077) [-977.080] * (-977.046) (-979.406) [-974.976] (-977.195) -- 0:00:36
      408500 -- (-975.351) (-975.600) (-975.072) [-976.358] * (-979.691) (-976.107) (-974.557) [-976.838] -- 0:00:36
      409000 -- (-975.541) [-974.221] (-975.599) (-976.505) * (-977.338) (-974.377) (-980.117) [-976.558] -- 0:00:36
      409500 -- (-974.211) (-976.356) (-978.586) [-976.248] * (-975.515) (-975.167) (-979.713) [-977.477] -- 0:00:36
      410000 -- (-975.239) (-982.028) [-975.228] (-979.305) * [-977.527] (-975.778) (-977.558) (-978.093) -- 0:00:35

      Average standard deviation of split frequencies: 0.010466

      410500 -- (-977.382) (-977.093) [-974.874] (-975.956) * (-978.927) (-977.232) (-977.493) [-975.573] -- 0:00:35
      411000 -- [-976.422] (-975.638) (-979.492) (-975.751) * (-977.706) (-974.947) [-977.404] (-976.198) -- 0:00:35
      411500 -- [-979.625] (-975.740) (-985.202) (-978.102) * [-977.077] (-976.618) (-976.959) (-974.966) -- 0:00:35
      412000 -- (-977.312) [-978.615] (-982.431) (-974.964) * (-973.869) [-977.105] (-976.667) (-975.739) -- 0:00:35
      412500 -- (-978.819) (-978.336) (-975.902) [-975.142] * [-976.209] (-975.761) (-975.783) (-978.531) -- 0:00:35
      413000 -- (-977.215) (-977.642) (-977.474) [-975.063] * (-975.194) [-979.155] (-978.990) (-977.024) -- 0:00:35
      413500 -- (-975.933) (-979.178) [-975.012] (-975.748) * [-979.141] (-976.233) (-974.852) (-976.939) -- 0:00:35
      414000 -- (-977.590) [-974.997] (-978.699) (-976.324) * (-977.467) (-974.488) (-974.316) [-976.485] -- 0:00:35
      414500 -- (-977.482) [-976.284] (-977.764) (-976.781) * (-977.012) (-979.296) [-974.916] (-975.262) -- 0:00:35
      415000 -- (-976.926) (-975.101) (-977.800) [-974.878] * (-977.868) (-976.568) [-976.093] (-976.702) -- 0:00:35

      Average standard deviation of split frequencies: 0.010865

      415500 -- (-974.786) (-975.523) [-976.847] (-976.562) * (-974.566) [-975.333] (-976.603) (-975.385) -- 0:00:36
      416000 -- [-974.806] (-975.379) (-977.789) (-975.633) * (-977.927) (-974.207) [-981.676] (-974.293) -- 0:00:36
      416500 -- (-975.500) (-976.760) (-979.484) [-976.154] * (-980.741) (-976.431) [-977.138] (-974.692) -- 0:00:36
      417000 -- (-976.223) (-977.722) (-980.371) [-977.428] * (-977.132) (-979.490) [-975.171] (-975.866) -- 0:00:36
      417500 -- (-975.883) (-976.075) [-978.192] (-981.568) * (-980.440) (-978.295) [-977.352] (-974.271) -- 0:00:36
      418000 -- (-974.819) (-976.438) (-973.962) [-977.308] * (-979.631) (-978.928) [-975.796] (-975.661) -- 0:00:36
      418500 -- (-975.513) (-978.403) [-974.542] (-975.102) * (-979.420) (-976.562) [-975.009] (-978.138) -- 0:00:36
      419000 -- (-976.502) (-975.805) (-977.897) [-975.784] * (-979.131) [-976.305] (-974.551) (-977.976) -- 0:00:36
      419500 -- (-975.485) (-975.328) (-980.729) [-974.600] * (-977.570) (-975.146) [-975.517] (-978.132) -- 0:00:35
      420000 -- (-974.375) (-976.061) [-975.855] (-975.233) * (-977.347) [-973.726] (-975.699) (-978.208) -- 0:00:35

      Average standard deviation of split frequencies: 0.010011

      420500 -- (-976.752) (-974.945) (-979.197) [-975.332] * (-978.338) (-976.582) (-976.862) [-977.261] -- 0:00:35
      421000 -- (-974.149) (-974.442) (-976.277) [-977.052] * (-974.550) [-977.957] (-976.941) (-978.229) -- 0:00:35
      421500 -- [-974.286] (-974.634) (-976.694) (-979.119) * (-976.361) (-975.546) [-974.633] (-976.329) -- 0:00:35
      422000 -- (-974.668) (-975.267) (-976.449) [-973.957] * (-976.562) (-974.181) [-975.427] (-976.185) -- 0:00:35
      422500 -- [-974.692] (-975.196) (-978.532) (-974.068) * (-975.118) (-974.553) (-974.871) [-975.015] -- 0:00:35
      423000 -- [-979.831] (-974.858) (-975.417) (-975.495) * (-974.638) (-974.747) (-977.140) [-975.269] -- 0:00:35
      423500 -- [-976.297] (-975.328) (-978.508) (-975.414) * (-975.346) (-975.742) [-976.174] (-976.087) -- 0:00:35
      424000 -- (-977.489) (-975.263) (-976.192) [-976.013] * (-975.914) [-976.898] (-976.669) (-977.384) -- 0:00:35
      424500 -- (-976.629) (-976.417) (-976.263) [-979.596] * [-974.051] (-975.486) (-975.532) (-977.062) -- 0:00:35
      425000 -- [-976.423] (-977.298) (-977.720) (-977.124) * (-979.285) (-977.496) [-975.231] (-978.126) -- 0:00:35

      Average standard deviation of split frequencies: 0.010697

      425500 -- (-977.275) [-975.024] (-976.013) (-979.601) * (-978.278) (-977.448) [-975.621] (-975.198) -- 0:00:35
      426000 -- (-976.780) (-976.092) [-974.758] (-979.345) * (-978.553) [-975.850] (-975.420) (-975.735) -- 0:00:35
      426500 -- (-975.436) (-975.185) [-974.969] (-974.890) * [-979.862] (-974.969) (-975.574) (-977.340) -- 0:00:34
      427000 -- (-981.296) (-974.592) [-976.320] (-975.948) * (-975.348) (-974.099) (-982.284) [-980.425] -- 0:00:34
      427500 -- (-979.205) (-975.655) (-975.385) [-975.059] * (-976.786) [-976.224] (-976.970) (-977.785) -- 0:00:34
      428000 -- (-977.435) (-978.362) (-976.821) [-977.219] * (-974.645) (-975.230) [-975.187] (-975.716) -- 0:00:34
      428500 -- (-979.778) (-975.345) [-976.642] (-974.051) * (-974.073) (-977.665) (-976.376) [-975.442] -- 0:00:34
      429000 -- (-982.378) (-974.953) [-977.207] (-976.726) * (-980.119) (-976.593) [-974.144] (-978.036) -- 0:00:34
      429500 -- (-978.449) (-974.560) (-978.644) [-977.372] * (-976.434) (-977.721) [-975.418] (-976.501) -- 0:00:34
      430000 -- (-975.323) (-974.615) [-977.729] (-977.437) * (-981.034) (-976.259) (-975.349) [-975.121] -- 0:00:34

      Average standard deviation of split frequencies: 0.009851

      430500 -- (-975.774) (-974.813) (-978.068) [-975.465] * [-976.220] (-975.970) (-974.869) (-974.450) -- 0:00:34
      431000 -- (-978.544) [-974.549] (-976.038) (-976.792) * [-978.093] (-977.677) (-975.193) (-976.380) -- 0:00:34
      431500 -- [-975.229] (-974.927) (-975.555) (-979.749) * [-979.097] (-979.175) (-977.665) (-974.426) -- 0:00:35
      432000 -- (-974.708) (-974.614) (-974.715) [-977.823] * (-979.261) (-976.586) [-977.347] (-974.454) -- 0:00:35
      432500 -- (-974.696) [-976.694] (-974.767) (-978.891) * (-982.957) (-974.096) [-974.941] (-975.519) -- 0:00:35
      433000 -- (-978.223) [-980.866] (-974.525) (-975.024) * (-978.278) (-977.191) [-974.936] (-979.333) -- 0:00:35
      433500 -- (-976.498) (-977.273) (-974.126) [-976.087] * [-975.111] (-977.635) (-976.705) (-982.177) -- 0:00:35
      434000 -- (-976.334) (-975.065) [-975.514] (-978.056) * (-975.764) (-974.550) (-980.832) [-975.262] -- 0:00:35
      434500 -- (-976.325) [-974.831] (-973.985) (-977.060) * [-977.575] (-974.156) (-976.217) (-977.764) -- 0:00:35
      435000 -- (-975.541) (-979.195) [-974.000] (-974.755) * (-975.953) [-975.961] (-976.236) (-976.136) -- 0:00:35

      Average standard deviation of split frequencies: 0.010163

      435500 -- (-975.729) (-982.681) [-976.866] (-977.311) * [-977.194] (-974.985) (-977.970) (-978.730) -- 0:00:34
      436000 -- (-976.043) (-978.141) [-976.876] (-976.448) * (-976.954) [-977.217] (-981.363) (-976.518) -- 0:00:34
      436500 -- [-977.701] (-977.235) (-976.450) (-976.609) * (-974.942) (-975.288) [-978.570] (-976.910) -- 0:00:34
      437000 -- [-974.308] (-975.785) (-979.173) (-976.465) * (-974.188) (-976.794) [-977.049] (-975.001) -- 0:00:34
      437500 -- [-975.105] (-975.292) (-978.371) (-975.178) * (-975.681) [-974.898] (-982.770) (-974.774) -- 0:00:34
      438000 -- (-974.580) (-979.179) (-977.551) [-974.410] * (-979.189) (-975.706) (-981.552) [-976.030] -- 0:00:34
      438500 -- (-974.202) [-976.139] (-974.459) (-975.239) * (-980.203) (-978.428) (-976.177) [-974.609] -- 0:00:34
      439000 -- (-980.293) (-977.937) (-976.977) [-975.836] * [-978.544] (-978.151) (-979.354) (-975.241) -- 0:00:34
      439500 -- [-978.428] (-975.336) (-974.895) (-975.856) * (-978.631) (-976.678) (-977.587) [-974.369] -- 0:00:34
      440000 -- (-977.060) (-976.524) (-975.304) [-975.059] * (-978.009) [-976.582] (-976.019) (-976.729) -- 0:00:34

      Average standard deviation of split frequencies: 0.009414

      440500 -- (-977.325) (-976.575) (-975.641) [-974.929] * (-977.250) (-977.591) [-977.389] (-976.471) -- 0:00:34
      441000 -- (-979.170) [-976.154] (-977.225) (-976.463) * (-981.567) [-975.235] (-977.640) (-974.913) -- 0:00:34
      441500 -- [-975.579] (-975.472) (-976.541) (-976.584) * (-978.747) [-975.936] (-977.799) (-978.769) -- 0:00:34
      442000 -- (-979.827) [-976.647] (-976.229) (-975.134) * [-979.689] (-977.895) (-975.212) (-976.432) -- 0:00:34
      442500 -- (-978.094) (-975.698) [-975.184] (-976.913) * [-977.207] (-980.385) (-976.044) (-974.827) -- 0:00:34
      443000 -- (-975.208) (-975.070) [-975.063] (-985.605) * (-979.440) (-982.154) (-978.366) [-975.038] -- 0:00:33
      443500 -- (-975.381) (-974.554) [-977.455] (-984.126) * (-978.371) [-974.111] (-981.050) (-974.164) -- 0:00:33
      444000 -- (-975.237) (-974.235) (-975.604) [-977.156] * (-976.590) [-976.340] (-981.813) (-973.954) -- 0:00:33
      444500 -- [-975.091] (-974.233) (-974.958) (-976.641) * (-981.309) (-979.121) (-979.606) [-976.860] -- 0:00:33
      445000 -- (-976.110) (-978.006) [-974.945] (-974.324) * (-978.667) (-976.695) (-974.688) [-977.439] -- 0:00:33

      Average standard deviation of split frequencies: 0.009050

      445500 -- (-976.355) [-976.287] (-975.881) (-977.266) * (-976.115) (-977.513) [-976.533] (-974.926) -- 0:00:33
      446000 -- (-974.776) (-983.041) [-974.315] (-978.450) * (-980.138) (-976.300) (-979.475) [-977.890] -- 0:00:33
      446500 -- (-977.935) [-981.792] (-976.481) (-977.898) * (-977.003) [-981.141] (-979.820) (-975.608) -- 0:00:33
      447000 -- [-974.661] (-975.715) (-975.966) (-978.951) * (-976.361) (-979.953) (-975.161) [-976.178] -- 0:00:33
      447500 -- (-979.328) [-976.488] (-978.329) (-977.036) * (-979.670) (-979.939) [-975.330] (-977.485) -- 0:00:33
      448000 -- [-974.902] (-975.219) (-975.119) (-975.425) * (-979.240) [-975.500] (-977.024) (-975.200) -- 0:00:34
      448500 -- (-974.707) (-975.311) [-976.172] (-976.837) * (-980.020) (-974.406) (-976.276) [-977.132] -- 0:00:34
      449000 -- [-976.108] (-976.468) (-979.575) (-980.647) * (-976.398) (-974.799) [-975.253] (-977.139) -- 0:00:34
      449500 -- (-976.783) (-977.727) [-982.190] (-974.586) * (-976.236) [-980.262] (-978.415) (-975.736) -- 0:00:34
      450000 -- (-975.252) (-976.237) (-982.734) [-977.084] * (-976.507) (-974.290) (-977.148) [-975.489] -- 0:00:34

      Average standard deviation of split frequencies: 0.010600

      450500 -- [-976.895] (-978.902) (-976.634) (-979.654) * [-974.889] (-974.209) (-976.563) (-975.861) -- 0:00:34
      451000 -- (-976.556) (-976.947) (-977.702) [-977.581] * [-978.542] (-974.381) (-975.195) (-977.321) -- 0:00:34
      451500 -- (-976.628) [-975.780] (-978.397) (-976.428) * (-980.317) (-976.497) [-975.641] (-974.624) -- 0:00:34
      452000 -- (-976.408) [-976.750] (-978.207) (-975.259) * (-976.842) [-976.142] (-977.149) (-976.910) -- 0:00:33
      452500 -- (-981.810) (-976.741) [-974.585] (-975.961) * [-979.232] (-977.038) (-977.530) (-975.351) -- 0:00:33
      453000 -- (-974.815) [-978.293] (-974.596) (-976.076) * (-974.494) (-976.956) [-977.437] (-975.558) -- 0:00:33
      453500 -- [-974.649] (-977.339) (-973.947) (-973.864) * (-977.474) (-977.258) [-975.119] (-975.505) -- 0:00:33
      454000 -- (-975.109) (-978.614) (-977.361) [-974.059] * [-979.340] (-978.313) (-978.848) (-975.930) -- 0:00:33
      454500 -- (-975.680) [-980.344] (-975.202) (-974.806) * (-981.356) (-977.238) (-980.372) [-976.288] -- 0:00:33
      455000 -- (-977.827) [-976.560] (-977.851) (-975.297) * (-976.624) [-975.948] (-983.741) (-978.693) -- 0:00:33

      Average standard deviation of split frequencies: 0.011441

      455500 -- (-977.046) (-977.304) [-978.294] (-975.289) * (-976.801) (-975.259) (-978.135) [-978.840] -- 0:00:33
      456000 -- (-976.154) (-977.600) [-974.943] (-984.209) * (-977.288) (-975.550) (-977.865) [-974.204] -- 0:00:33
      456500 -- [-976.037] (-978.666) (-977.870) (-978.570) * [-976.072] (-977.460) (-977.432) (-974.055) -- 0:00:33
      457000 -- (-974.967) (-976.752) (-974.557) [-976.654] * [-975.138] (-974.554) (-974.549) (-978.984) -- 0:00:33
      457500 -- (-978.419) (-981.774) (-975.204) [-975.063] * (-975.391) [-974.965] (-975.384) (-977.672) -- 0:00:33
      458000 -- [-976.892] (-976.164) (-981.068) (-975.973) * [-975.335] (-976.549) (-978.462) (-974.226) -- 0:00:33
      458500 -- (-976.204) [-976.102] (-975.932) (-977.408) * [-977.330] (-977.735) (-980.068) (-974.579) -- 0:00:33
      459000 -- (-977.179) [-975.210] (-974.842) (-976.393) * [-976.720] (-976.020) (-978.042) (-974.065) -- 0:00:33
      459500 -- (-978.425) [-976.191] (-976.236) (-976.651) * (-975.702) (-976.600) (-980.159) [-974.298] -- 0:00:32
      460000 -- (-979.141) (-977.134) [-975.771] (-976.196) * (-975.002) (-977.946) [-974.221] (-977.953) -- 0:00:32

      Average standard deviation of split frequencies: 0.009913

      460500 -- (-977.392) (-976.539) (-978.557) [-978.371] * (-974.139) (-979.377) [-974.822] (-976.046) -- 0:00:32
      461000 -- (-976.966) [-977.305] (-974.386) (-974.533) * (-974.509) (-976.539) [-975.339] (-975.614) -- 0:00:32
      461500 -- [-977.060] (-974.402) (-974.489) (-974.656) * (-975.200) [-977.779] (-975.146) (-976.987) -- 0:00:32
      462000 -- [-976.848] (-974.345) (-977.473) (-974.840) * (-974.914) [-978.510] (-975.446) (-978.090) -- 0:00:32
      462500 -- (-975.368) (-974.242) [-975.112] (-974.904) * [-976.498] (-975.137) (-980.147) (-976.943) -- 0:00:32
      463000 -- (-976.915) (-974.956) [-978.988] (-974.904) * (-977.763) [-974.901] (-976.680) (-976.291) -- 0:00:32
      463500 -- [-973.921] (-977.692) (-978.529) (-976.823) * [-974.337] (-974.137) (-977.181) (-975.707) -- 0:00:32
      464000 -- [-973.911] (-978.860) (-976.158) (-976.577) * (-979.333) (-976.265) (-975.686) [-978.762] -- 0:00:32
      464500 -- (-976.030) (-977.731) [-975.491] (-975.528) * (-981.797) (-975.025) (-975.387) [-976.128] -- 0:00:33
      465000 -- (-975.479) (-975.668) [-976.831] (-977.279) * (-974.488) (-974.632) [-976.150] (-974.903) -- 0:00:33

      Average standard deviation of split frequencies: 0.009737

      465500 -- (-977.234) (-974.487) (-974.729) [-975.651] * (-978.275) [-977.869] (-975.784) (-975.186) -- 0:00:33
      466000 -- (-979.129) (-974.764) (-975.224) [-973.933] * [-975.761] (-977.751) (-978.924) (-974.615) -- 0:00:33
      466500 -- [-976.081] (-979.502) (-976.508) (-975.614) * (-976.081) [-978.887] (-976.517) (-974.418) -- 0:00:33
      467000 -- [-975.764] (-975.794) (-976.843) (-978.203) * [-976.322] (-976.759) (-975.203) (-974.488) -- 0:00:33
      467500 -- (-977.140) [-975.644] (-976.910) (-975.093) * (-975.181) (-976.660) (-976.339) [-974.652] -- 0:00:33
      468000 -- (-977.381) (-974.899) (-977.631) [-974.893] * (-976.574) [-975.229] (-976.053) (-977.607) -- 0:00:32
      468500 -- (-978.314) (-976.320) [-974.265] (-975.089) * (-976.352) [-976.060] (-975.610) (-979.013) -- 0:00:32
      469000 -- [-976.114] (-976.127) (-976.085) (-975.870) * (-977.251) (-986.663) (-980.512) [-976.580] -- 0:00:32
      469500 -- (-978.381) (-979.780) (-976.920) [-977.352] * (-977.267) (-977.719) [-979.068] (-974.033) -- 0:00:32
      470000 -- (-978.246) (-977.601) [-977.711] (-979.483) * (-975.027) (-976.068) (-978.376) [-975.458] -- 0:00:32

      Average standard deviation of split frequencies: 0.010016

      470500 -- (-978.480) (-975.359) (-976.129) [-976.018] * (-976.577) (-976.390) [-975.790] (-977.422) -- 0:00:32
      471000 -- [-976.276] (-974.154) (-975.069) (-977.345) * (-975.276) (-975.081) [-974.266] (-978.807) -- 0:00:32
      471500 -- (-977.499) [-974.835] (-982.069) (-976.452) * [-976.397] (-975.826) (-976.652) (-978.667) -- 0:00:32
      472000 -- (-978.108) (-974.281) (-980.480) [-977.467] * (-983.216) (-979.514) (-976.300) [-976.696] -- 0:00:32
      472500 -- (-977.742) (-974.264) (-976.843) [-978.373] * (-977.445) [-977.004] (-975.676) (-973.901) -- 0:00:32
      473000 -- (-980.770) (-975.761) [-975.743] (-976.738) * (-974.926) (-975.761) [-976.663] (-975.765) -- 0:00:32
      473500 -- (-975.788) (-974.240) (-977.342) [-975.807] * (-975.060) (-976.924) (-981.565) [-974.982] -- 0:00:32
      474000 -- (-975.455) [-975.466] (-976.913) (-976.010) * [-977.139] (-978.257) (-981.250) (-974.894) -- 0:00:32
      474500 -- (-976.426) (-981.998) [-976.217] (-977.560) * [-978.969] (-976.134) (-978.362) (-975.802) -- 0:00:32
      475000 -- (-976.798) (-974.703) (-982.598) [-974.531] * (-976.371) (-975.660) [-978.548] (-975.808) -- 0:00:32

      Average standard deviation of split frequencies: 0.010089

      475500 -- (-975.697) (-978.253) [-979.523] (-976.194) * (-977.132) (-976.790) [-975.467] (-975.797) -- 0:00:31
      476000 -- [-978.638] (-976.869) (-980.267) (-976.457) * (-976.030) [-977.136] (-974.049) (-975.525) -- 0:00:31
      476500 -- (-975.636) [-980.482] (-977.482) (-977.330) * (-977.223) (-974.902) [-975.474] (-975.913) -- 0:00:31
      477000 -- (-975.233) (-975.836) [-977.482] (-974.984) * (-978.972) (-978.130) (-977.789) [-977.326] -- 0:00:31
      477500 -- (-975.632) (-977.173) (-978.751) [-979.006] * (-975.143) (-975.311) [-979.428] (-977.846) -- 0:00:31
      478000 -- (-974.640) (-982.712) [-975.225] (-975.083) * (-975.629) [-974.647] (-978.384) (-979.003) -- 0:00:31
      478500 -- (-977.003) (-977.704) [-975.545] (-978.365) * (-974.940) (-974.130) [-976.904] (-976.689) -- 0:00:31
      479000 -- (-976.114) (-977.748) (-974.646) [-975.073] * (-976.343) [-976.336] (-975.711) (-974.049) -- 0:00:31
      479500 -- (-974.381) [-975.807] (-974.143) (-976.690) * (-976.188) (-979.376) [-980.944] (-975.937) -- 0:00:31
      480000 -- [-974.373] (-977.674) (-976.195) (-978.437) * (-976.407) (-974.686) [-978.441] (-977.887) -- 0:00:31

      Average standard deviation of split frequencies: 0.009807

      480500 -- [-975.408] (-979.046) (-977.692) (-976.174) * [-977.049] (-974.482) (-977.098) (-976.810) -- 0:00:31
      481000 -- [-974.959] (-979.036) (-976.089) (-977.760) * (-977.178) (-975.926) (-973.754) [-977.376] -- 0:00:32
      481500 -- (-976.546) [-975.780] (-975.227) (-978.040) * (-982.132) [-973.790] (-975.499) (-974.771) -- 0:00:32
      482000 -- [-976.030] (-975.638) (-975.248) (-981.501) * (-976.303) (-976.780) [-975.824] (-975.852) -- 0:00:32
      482500 -- (-977.456) [-976.552] (-976.798) (-983.791) * (-974.642) [-974.767] (-977.285) (-975.028) -- 0:00:32
      483000 -- (-975.823) [-976.514] (-978.187) (-978.689) * (-977.975) (-975.322) (-978.045) [-975.110] -- 0:00:32
      483500 -- (-980.950) (-978.429) [-976.644] (-974.108) * (-975.671) (-974.574) (-978.913) [-975.951] -- 0:00:32
      484000 -- (-976.790) (-976.436) (-976.062) [-975.001] * [-977.346] (-974.058) (-975.652) (-978.194) -- 0:00:31
      484500 -- (-978.263) (-977.626) [-976.818] (-976.084) * (-974.105) (-977.060) (-975.081) [-975.954] -- 0:00:31
      485000 -- [-985.901] (-984.186) (-982.938) (-976.097) * (-976.095) [-974.797] (-974.954) (-978.564) -- 0:00:31

      Average standard deviation of split frequencies: 0.009928

      485500 -- (-976.144) (-974.661) [-974.904] (-974.807) * (-975.671) (-974.951) (-974.037) [-976.969] -- 0:00:31
      486000 -- [-978.496] (-975.605) (-974.265) (-977.583) * (-978.016) [-976.073] (-982.160) (-976.715) -- 0:00:31
      486500 -- (-977.289) (-977.828) (-974.990) [-976.730] * [-977.447] (-975.199) (-979.931) (-974.711) -- 0:00:31
      487000 -- (-975.942) (-977.129) [-975.762] (-975.400) * [-975.744] (-976.170) (-976.244) (-978.667) -- 0:00:31
      487500 -- [-977.708] (-975.293) (-975.136) (-974.076) * (-976.335) [-974.693] (-976.784) (-976.149) -- 0:00:31
      488000 -- (-977.347) (-976.179) (-978.613) [-975.854] * [-974.627] (-973.956) (-975.773) (-975.631) -- 0:00:31
      488500 -- (-976.210) (-978.685) (-976.871) [-974.593] * (-978.866) (-975.743) [-975.159] (-977.158) -- 0:00:31
      489000 -- (-975.491) (-977.142) [-977.969] (-975.858) * (-975.721) (-975.848) [-975.247] (-975.254) -- 0:00:31
      489500 -- [-974.722] (-977.598) (-980.527) (-976.243) * (-974.681) [-979.321] (-975.339) (-975.969) -- 0:00:31
      490000 -- [-979.204] (-978.698) (-984.976) (-976.569) * (-974.806) [-976.929] (-975.683) (-974.429) -- 0:00:31

      Average standard deviation of split frequencies: 0.009833

      490500 -- [-977.451] (-976.271) (-978.762) (-977.395) * (-974.034) [-975.318] (-976.682) (-974.622) -- 0:00:31
      491000 -- (-977.524) (-977.323) (-975.593) [-976.514] * (-977.119) [-975.324] (-976.516) (-974.579) -- 0:00:31
      491500 -- (-980.273) (-977.023) [-979.108] (-974.320) * (-976.393) (-975.701) [-975.305] (-978.345) -- 0:00:31
      492000 -- (-975.543) (-974.814) (-978.050) [-975.155] * [-974.907] (-974.786) (-977.776) (-975.677) -- 0:00:30
      492500 -- (-976.346) (-974.358) (-977.119) [-980.088] * (-980.617) (-974.749) [-975.882] (-979.839) -- 0:00:30
      493000 -- (-977.434) (-977.314) [-976.068] (-976.187) * (-976.519) [-981.098] (-975.515) (-974.726) -- 0:00:30
      493500 -- (-978.215) [-976.377] (-975.497) (-975.338) * (-977.749) (-982.176) [-976.368] (-976.384) -- 0:00:30
      494000 -- (-979.288) (-975.201) (-977.404) [-974.455] * (-980.084) [-977.213] (-977.797) (-977.534) -- 0:00:30
      494500 -- [-980.159] (-976.532) (-975.534) (-975.030) * [-974.736] (-980.043) (-977.565) (-976.904) -- 0:00:30
      495000 -- (-977.637) [-975.860] (-978.288) (-974.675) * [-980.904] (-977.910) (-976.259) (-976.245) -- 0:00:30

      Average standard deviation of split frequencies: 0.009682

      495500 -- (-979.869) (-975.660) [-977.343] (-976.361) * (-975.237) (-977.459) (-975.281) [-977.168] -- 0:00:30
      496000 -- (-982.628) (-975.031) (-977.515) [-978.833] * (-975.414) (-977.039) (-976.197) [-976.551] -- 0:00:31
      496500 -- (-981.144) [-975.321] (-975.522) (-979.187) * [-975.405] (-981.354) (-976.402) (-973.841) -- 0:00:31
      497000 -- (-979.424) [-977.818] (-977.721) (-975.783) * (-975.215) (-974.658) (-976.154) [-974.755] -- 0:00:31
      497500 -- (-975.348) (-977.882) [-975.186] (-976.420) * (-976.979) (-976.645) (-981.460) [-975.230] -- 0:00:31
      498000 -- (-976.093) (-978.122) [-974.772] (-976.176) * (-977.572) [-975.236] (-977.099) (-975.599) -- 0:00:31
      498500 -- [-975.135] (-978.469) (-974.278) (-974.781) * (-980.907) (-976.544) (-977.274) [-973.996] -- 0:00:31
      499000 -- (-975.782) (-975.471) [-975.873] (-978.181) * (-976.787) (-978.249) [-975.041] (-977.826) -- 0:00:31
      499500 -- (-974.537) (-975.096) [-975.998] (-984.468) * (-975.296) (-977.058) (-975.702) [-976.380] -- 0:00:31
      500000 -- (-974.919) (-977.987) [-975.138] (-974.739) * [-975.638] (-975.574) (-975.004) (-975.438) -- 0:00:31

      Average standard deviation of split frequencies: 0.009533

      500500 -- (-976.737) (-977.237) (-976.634) [-974.808] * (-978.935) [-977.941] (-974.869) (-975.390) -- 0:00:30
      501000 -- [-975.950] (-978.800) (-976.561) (-976.085) * (-980.901) (-976.121) (-974.575) [-976.080] -- 0:00:30
      501500 -- [-980.383] (-978.789) (-977.722) (-975.617) * (-975.101) [-975.918] (-975.252) (-981.006) -- 0:00:30
      502000 -- (-976.585) [-976.459] (-975.490) (-980.913) * [-975.679] (-976.752) (-976.539) (-976.603) -- 0:00:30
      502500 -- (-975.988) (-976.515) [-976.378] (-974.996) * (-975.202) (-977.934) [-976.185] (-978.553) -- 0:00:30
      503000 -- (-978.853) (-977.112) (-976.333) [-977.529] * (-980.279) (-975.483) (-976.371) [-976.834] -- 0:00:30
      503500 -- (-980.617) (-976.858) [-976.769] (-977.579) * (-974.063) (-976.292) [-974.317] (-980.917) -- 0:00:30
      504000 -- [-977.121] (-981.027) (-977.007) (-977.712) * (-975.423) (-976.787) [-976.036] (-980.877) -- 0:00:30
      504500 -- (-975.327) (-976.805) (-976.094) [-975.774] * (-980.423) [-974.706] (-977.748) (-978.574) -- 0:00:30
      505000 -- (-975.173) [-975.212] (-979.445) (-981.521) * (-976.137) [-977.295] (-975.537) (-977.119) -- 0:00:30

      Average standard deviation of split frequencies: 0.009549

      505500 -- (-975.701) [-974.964] (-978.059) (-975.671) * (-976.877) (-982.345) [-975.102] (-979.638) -- 0:00:30
      506000 -- (-975.807) [-976.773] (-977.447) (-975.671) * (-976.204) (-978.607) [-978.635] (-976.147) -- 0:00:30
      506500 -- (-975.084) (-974.599) [-979.655] (-975.834) * (-974.579) (-976.951) [-975.211] (-978.726) -- 0:00:30
      507000 -- (-974.402) (-976.962) (-978.551) [-975.726] * [-977.899] (-976.505) (-975.002) (-976.890) -- 0:00:30
      507500 -- (-975.227) (-975.611) [-975.982] (-975.541) * [-976.695] (-976.705) (-974.620) (-976.798) -- 0:00:30
      508000 -- (-975.839) (-976.138) [-977.977] (-975.525) * (-977.034) (-976.816) [-975.770] (-976.178) -- 0:00:30
      508500 -- (-978.063) [-976.073] (-978.471) (-976.647) * (-977.741) (-975.490) [-978.062] (-975.443) -- 0:00:29
      509000 -- (-984.218) (-975.369) (-974.884) [-974.565] * [-977.426] (-975.724) (-975.397) (-975.766) -- 0:00:29
      509500 -- (-979.160) (-976.120) [-975.717] (-974.556) * [-975.736] (-982.557) (-974.128) (-977.892) -- 0:00:30
      510000 -- (-978.399) (-974.275) (-974.709) [-975.447] * (-975.956) [-976.203] (-978.993) (-979.420) -- 0:00:30

      Average standard deviation of split frequencies: 0.010209

      510500 -- (-976.095) [-974.415] (-974.806) (-978.854) * [-976.266] (-974.894) (-974.349) (-975.485) -- 0:00:30
      511000 -- [-975.827] (-977.812) (-975.612) (-976.323) * (-976.582) (-983.530) (-975.796) [-975.834] -- 0:00:30
      511500 -- [-975.522] (-976.252) (-974.982) (-975.785) * (-978.499) (-977.758) [-977.671] (-976.394) -- 0:00:30
      512000 -- [-977.947] (-975.897) (-974.375) (-978.523) * (-975.564) [-975.611] (-975.810) (-975.216) -- 0:00:30
      512500 -- [-974.514] (-978.608) (-974.413) (-975.291) * (-976.763) (-976.990) (-974.832) [-977.162] -- 0:00:30
      513000 -- (-976.460) (-976.120) (-978.521) [-974.002] * (-975.082) (-973.921) (-976.823) [-975.495] -- 0:00:30
      513500 -- (-975.624) (-976.202) (-975.444) [-976.271] * (-974.575) (-976.473) (-975.478) [-976.368] -- 0:00:30
      514000 -- (-977.418) (-975.528) [-974.972] (-975.827) * [-974.567] (-975.766) (-975.662) (-974.081) -- 0:00:30
      514500 -- (-974.748) [-976.375] (-979.911) (-980.527) * [-975.246] (-977.315) (-977.729) (-976.983) -- 0:00:30
      515000 -- (-975.818) (-975.757) [-977.473] (-974.866) * [-974.281] (-977.098) (-975.985) (-977.443) -- 0:00:30

      Average standard deviation of split frequencies: 0.009707

      515500 -- (-975.309) (-976.130) [-975.579] (-976.113) * [-976.149] (-975.564) (-974.166) (-978.476) -- 0:00:30
      516000 -- (-975.321) (-974.374) (-976.575) [-974.236] * [-980.211] (-978.874) (-975.295) (-978.454) -- 0:00:30
      516500 -- (-974.294) [-976.506] (-976.594) (-974.445) * (-977.507) [-975.055] (-975.698) (-975.433) -- 0:00:29
      517000 -- [-974.143] (-979.991) (-974.873) (-974.671) * (-976.795) [-975.738] (-980.052) (-975.660) -- 0:00:29
      517500 -- [-974.420] (-980.422) (-974.511) (-977.542) * (-975.088) [-976.831] (-978.770) (-982.378) -- 0:00:29
      518000 -- (-976.035) (-976.311) (-974.126) [-976.468] * (-974.651) (-976.904) (-977.028) [-978.594] -- 0:00:29
      518500 -- [-973.930] (-976.060) (-976.072) (-975.750) * [-977.479] (-975.625) (-974.117) (-976.485) -- 0:00:29
      519000 -- (-975.702) [-974.624] (-975.111) (-976.706) * (-978.457) (-978.163) (-974.152) [-974.592] -- 0:00:29
      519500 -- [-975.813] (-977.118) (-974.881) (-976.973) * (-979.005) (-980.839) [-975.217] (-976.642) -- 0:00:29
      520000 -- [-974.779] (-977.097) (-976.301) (-978.883) * (-979.805) (-975.612) [-974.342] (-979.859) -- 0:00:29

      Average standard deviation of split frequencies: 0.009620

      520500 -- (-976.092) [-978.226] (-975.322) (-975.960) * (-976.935) [-974.534] (-976.562) (-974.668) -- 0:00:29
      521000 -- [-975.949] (-974.732) (-975.764) (-978.287) * (-977.254) [-975.143] (-977.389) (-975.181) -- 0:00:29
      521500 -- (-975.482) (-980.285) (-974.635) [-974.181] * [-975.660] (-976.134) (-974.089) (-976.654) -- 0:00:29
      522000 -- (-975.003) (-979.697) (-974.409) [-975.050] * (-975.915) [-978.569] (-974.801) (-976.270) -- 0:00:30
      522500 -- (-977.032) (-975.915) (-975.356) [-974.416] * (-977.216) [-976.579] (-975.834) (-976.073) -- 0:00:30
      523000 -- [-976.330] (-977.887) (-977.048) (-974.197) * (-974.170) (-976.055) (-976.127) [-977.738] -- 0:00:30
      523500 -- (-977.972) (-976.652) [-976.949] (-977.147) * (-976.833) (-974.319) [-973.994] (-977.510) -- 0:00:30
      524000 -- [-974.724] (-977.618) (-976.898) (-976.000) * (-976.659) (-974.075) [-977.360] (-976.412) -- 0:00:29
      524500 -- (-977.109) [-978.261] (-978.746) (-975.930) * (-977.570) [-980.481] (-977.050) (-975.775) -- 0:00:29
      525000 -- (-979.802) (-975.687) [-977.028] (-978.404) * (-976.416) [-976.477] (-978.591) (-977.050) -- 0:00:29

      Average standard deviation of split frequencies: 0.009226

      525500 -- (-978.470) (-977.457) (-974.949) [-976.531] * (-977.941) (-975.779) (-978.910) [-975.838] -- 0:00:29
      526000 -- (-976.089) (-976.731) (-974.660) [-974.927] * (-976.386) (-974.493) [-976.499] (-975.729) -- 0:00:29
      526500 -- [-974.671] (-976.806) (-974.198) (-977.621) * (-977.487) (-974.277) [-975.126] (-975.261) -- 0:00:29
      527000 -- (-975.917) (-980.800) (-975.231) [-974.402] * [-974.943] (-977.933) (-975.198) (-975.105) -- 0:00:29
      527500 -- [-978.195] (-975.231) (-974.698) (-980.041) * (-974.891) (-977.471) (-979.714) [-977.126] -- 0:00:29
      528000 -- [-978.932] (-976.164) (-974.857) (-980.495) * (-975.696) [-981.638] (-977.750) (-975.375) -- 0:00:29
      528500 -- (-976.731) [-981.456] (-975.777) (-979.754) * (-975.945) (-975.061) (-974.554) [-975.151] -- 0:00:29
      529000 -- (-978.104) (-982.753) (-975.772) [-975.810] * (-975.497) (-976.520) [-978.066] (-976.440) -- 0:00:29
      529500 -- [-975.213] (-976.297) (-976.025) (-981.073) * (-975.300) (-976.792) (-974.849) [-977.246] -- 0:00:29
      530000 -- (-975.339) [-975.728] (-976.479) (-974.752) * (-975.229) [-975.707] (-975.672) (-977.610) -- 0:00:29

      Average standard deviation of split frequencies: 0.009667

      530500 -- (-975.720) [-975.512] (-976.218) (-977.903) * (-977.579) (-980.465) [-974.413] (-974.957) -- 0:00:29
      531000 -- (-977.332) (-977.148) (-980.239) [-974.827] * (-977.864) (-978.360) [-974.362] (-976.654) -- 0:00:29
      531500 -- [-975.144] (-975.421) (-978.548) (-977.271) * (-977.910) (-978.969) (-977.493) [-978.323] -- 0:00:29
      532000 -- [-975.322] (-980.058) (-976.754) (-977.670) * [-974.740] (-977.787) (-976.662) (-980.311) -- 0:00:29
      532500 -- [-974.897] (-975.180) (-977.627) (-975.701) * (-974.144) (-978.832) [-975.730] (-976.029) -- 0:00:28
      533000 -- (-975.558) [-974.604] (-983.538) (-975.625) * (-979.059) (-977.615) (-975.854) [-976.909] -- 0:00:28
      533500 -- (-976.992) [-974.315] (-975.813) (-974.581) * (-985.316) [-976.404] (-973.927) (-977.656) -- 0:00:28
      534000 -- (-976.341) (-980.560) [-975.069] (-974.590) * [-976.160] (-977.585) (-974.885) (-974.327) -- 0:00:28
      534500 -- (-974.484) [-979.488] (-976.835) (-975.079) * (-978.853) (-976.908) [-975.627] (-977.246) -- 0:00:28
      535000 -- (-975.910) (-979.028) (-976.180) [-975.067] * [-974.894] (-979.132) (-976.470) (-976.006) -- 0:00:29

      Average standard deviation of split frequencies: 0.009312

      535500 -- (-977.930) [-981.884] (-974.591) (-977.283) * (-977.314) (-978.711) (-975.221) [-976.960] -- 0:00:29
      536000 -- (-975.349) [-974.283] (-975.025) (-973.993) * (-978.415) (-978.570) [-978.614] (-977.001) -- 0:00:29
      536500 -- (-974.605) (-974.974) (-975.722) [-978.793] * (-974.313) [-975.887] (-977.165) (-977.456) -- 0:00:29
      537000 -- (-974.909) (-976.319) [-975.551] (-978.502) * (-974.896) (-974.869) (-978.663) [-977.815] -- 0:00:29
      537500 -- (-975.741) [-974.684] (-977.754) (-981.783) * (-975.090) [-975.133] (-979.567) (-975.813) -- 0:00:29
      538000 -- (-979.945) [-974.225] (-976.467) (-978.140) * (-974.386) (-976.830) [-976.254] (-976.619) -- 0:00:29
      538500 -- [-977.980] (-978.848) (-974.428) (-976.626) * (-973.997) [-974.193] (-974.423) (-974.808) -- 0:00:29
      539000 -- [-975.947] (-977.345) (-974.403) (-980.873) * (-975.785) [-973.748] (-977.421) (-976.138) -- 0:00:29
      539500 -- (-974.455) (-975.142) (-975.759) [-975.575] * [-974.126] (-975.368) (-978.553) (-974.104) -- 0:00:29
      540000 -- [-978.660] (-974.316) (-975.469) (-977.520) * (-976.151) [-976.482] (-975.075) (-977.506) -- 0:00:28

      Average standard deviation of split frequencies: 0.008773

      540500 -- (-976.622) (-975.980) [-975.574] (-977.414) * (-979.720) (-975.773) [-975.398] (-978.086) -- 0:00:28
      541000 -- [-975.252] (-976.053) (-979.598) (-979.154) * (-979.617) (-975.050) [-975.490] (-977.079) -- 0:00:28
      541500 -- (-979.627) [-975.455] (-974.877) (-978.946) * (-977.701) (-974.677) [-976.239] (-976.875) -- 0:00:28
      542000 -- (-977.736) (-977.052) (-975.302) [-978.011] * [-980.176] (-975.295) (-976.149) (-979.362) -- 0:00:28
      542500 -- [-974.330] (-976.430) (-976.930) (-975.725) * (-976.945) (-975.599) [-977.015] (-975.588) -- 0:00:28
      543000 -- [-976.159] (-977.248) (-977.922) (-980.070) * (-974.673) (-977.963) (-976.761) [-975.605] -- 0:00:28
      543500 -- (-974.134) (-977.630) (-974.713) [-974.296] * (-981.841) [-978.556] (-974.683) (-976.136) -- 0:00:28
      544000 -- (-975.568) (-977.625) [-974.827] (-974.971) * (-976.667) (-980.587) [-974.737] (-976.168) -- 0:00:28
      544500 -- [-976.443] (-975.549) (-975.968) (-976.820) * (-976.959) [-975.920] (-975.018) (-976.089) -- 0:00:28
      545000 -- (-979.287) (-975.597) (-976.263) [-975.768] * (-975.042) [-974.029] (-977.805) (-974.880) -- 0:00:28

      Average standard deviation of split frequencies: 0.008481

      545500 -- (-975.441) [-977.006] (-976.435) (-974.345) * (-975.894) [-976.416] (-977.012) (-976.377) -- 0:00:28
      546000 -- [-979.298] (-979.468) (-977.537) (-976.476) * (-977.618) [-977.589] (-976.787) (-977.592) -- 0:00:28
      546500 -- (-977.831) (-978.569) [-976.881] (-974.442) * (-978.066) (-978.749) [-980.781] (-976.776) -- 0:00:28
      547000 -- [-979.800] (-981.166) (-978.302) (-975.424) * (-977.772) (-977.124) [-975.998] (-976.434) -- 0:00:28
      547500 -- (-978.719) (-981.233) [-976.059] (-974.763) * (-977.755) (-977.580) [-976.164] (-981.819) -- 0:00:28
      548000 -- (-975.744) (-980.964) (-975.577) [-977.465] * (-975.368) (-978.883) (-978.825) [-980.628] -- 0:00:28
      548500 -- (-980.264) [-976.909] (-974.434) (-977.999) * (-976.120) (-977.439) (-976.022) [-977.937] -- 0:00:27
      549000 -- [-975.345] (-974.682) (-977.959) (-976.683) * (-974.587) [-976.321] (-976.962) (-976.470) -- 0:00:27
      549500 -- (-976.087) (-977.011) (-974.276) [-978.002] * (-974.289) (-977.366) [-975.565] (-977.582) -- 0:00:27
      550000 -- [-975.307] (-979.915) (-975.825) (-978.680) * [-976.936] (-979.574) (-974.983) (-978.185) -- 0:00:28

      Average standard deviation of split frequencies: 0.008882

      550500 -- [-978.826] (-981.072) (-976.413) (-976.092) * (-978.134) (-975.225) [-974.312] (-975.713) -- 0:00:28
      551000 -- [-976.808] (-978.159) (-976.328) (-976.005) * [-975.880] (-975.780) (-975.363) (-977.180) -- 0:00:28
      551500 -- (-975.668) (-974.192) [-975.213] (-975.348) * (-973.834) (-978.413) [-977.150] (-974.544) -- 0:00:28
      552000 -- (-978.395) [-975.939] (-975.526) (-978.566) * (-976.330) (-976.851) [-980.519] (-975.574) -- 0:00:28
      552500 -- (-974.438) (-977.369) [-977.012] (-980.924) * (-977.710) (-975.105) (-977.200) [-976.895] -- 0:00:28
      553000 -- (-976.757) (-975.657) [-975.054] (-976.423) * [-980.520] (-978.571) (-985.864) (-976.818) -- 0:00:28
      553500 -- (-975.312) (-976.558) [-976.299] (-976.839) * (-974.695) (-975.624) (-978.278) [-977.551] -- 0:00:28
      554000 -- (-975.947) (-976.221) [-974.683] (-980.461) * [-974.403] (-976.202) (-974.726) (-977.506) -- 0:00:28
      554500 -- (-977.323) (-981.967) [-976.166] (-975.334) * [-974.248] (-976.142) (-978.618) (-976.124) -- 0:00:28
      555000 -- [-974.772] (-981.390) (-976.820) (-975.655) * (-975.727) (-976.224) (-981.824) [-975.677] -- 0:00:28

      Average standard deviation of split frequencies: 0.009044

      555500 -- (-974.326) (-979.785) (-975.908) [-976.239] * (-974.728) (-974.765) (-977.801) [-975.532] -- 0:00:28
      556000 -- (-975.956) (-976.193) [-976.091] (-975.730) * (-975.055) (-975.482) (-975.403) [-978.880] -- 0:00:27
      556500 -- [-975.868] (-976.047) (-975.019) (-974.986) * (-978.702) (-976.465) (-976.910) [-983.136] -- 0:00:27
      557000 -- (-975.468) (-976.548) (-974.933) [-976.277] * [-979.148] (-976.922) (-978.199) (-975.009) -- 0:00:27
      557500 -- (-977.263) [-975.346] (-977.411) (-978.255) * (-974.618) (-975.881) (-982.976) [-975.595] -- 0:00:27
      558000 -- [-976.500] (-975.942) (-975.556) (-975.561) * (-974.969) (-974.264) [-976.500] (-979.066) -- 0:00:27
      558500 -- (-976.753) (-976.201) (-974.957) [-975.899] * (-975.610) (-974.241) (-975.617) [-977.215] -- 0:00:27
      559000 -- (-976.027) [-974.392] (-977.588) (-975.965) * (-976.356) (-974.990) (-975.879) [-974.607] -- 0:00:27
      559500 -- [-975.532] (-975.012) (-976.174) (-977.204) * (-979.224) [-976.942] (-974.716) (-975.217) -- 0:00:27
      560000 -- (-977.935) (-974.471) [-975.805] (-977.379) * (-978.993) (-979.342) (-977.971) [-975.018] -- 0:00:27

      Average standard deviation of split frequencies: 0.009091

      560500 -- (-977.025) (-979.089) [-975.803] (-975.120) * (-976.164) (-974.782) (-974.857) [-974.820] -- 0:00:27
      561000 -- (-977.152) (-974.645) (-976.481) [-974.928] * (-976.126) (-976.174) [-976.286] (-976.077) -- 0:00:27
      561500 -- (-976.680) (-975.913) [-974.578] (-977.583) * (-975.432) (-981.790) [-974.466] (-977.898) -- 0:00:27
      562000 -- (-976.753) (-975.021) [-975.171] (-974.866) * (-979.591) (-976.364) [-976.769] (-976.029) -- 0:00:27
      562500 -- (-975.642) (-975.978) (-976.422) [-975.282] * (-977.609) (-977.990) [-974.537] (-978.985) -- 0:00:27
      563000 -- (-976.671) (-976.806) [-974.001] (-974.694) * (-975.376) (-975.476) (-975.202) [-975.510] -- 0:00:27
      563500 -- (-976.381) [-974.816] (-978.005) (-976.845) * (-977.897) (-975.352) (-975.317) [-975.004] -- 0:00:27
      564000 -- (-976.617) (-975.505) (-976.839) [-977.767] * (-978.087) (-976.391) [-974.846] (-974.483) -- 0:00:27
      564500 -- (-976.271) (-978.234) [-976.495] (-975.956) * (-978.741) [-975.787] (-974.752) (-973.949) -- 0:00:27
      565000 -- (-974.438) (-978.009) (-979.303) [-975.835] * (-974.288) (-980.017) [-978.689] (-975.912) -- 0:00:27

      Average standard deviation of split frequencies: 0.008277

      565500 -- (-974.662) (-974.814) (-980.077) [-975.318] * [-974.426] (-975.956) (-976.580) (-978.447) -- 0:00:27
      566000 -- (-978.210) (-975.373) [-975.250] (-974.873) * [-975.640] (-974.915) (-979.134) (-977.078) -- 0:00:27
      566500 -- [-975.782] (-978.963) (-976.657) (-974.934) * [-975.944] (-973.853) (-975.903) (-978.713) -- 0:00:27
      567000 -- [-976.270] (-979.604) (-977.803) (-977.221) * (-980.192) (-975.473) (-975.759) [-977.143] -- 0:00:27
      567500 -- (-978.782) (-976.629) (-980.422) [-974.633] * [-979.013] (-975.987) (-975.118) (-977.146) -- 0:00:27
      568000 -- (-974.447) (-974.748) [-978.604] (-977.168) * (-976.751) (-976.619) (-975.864) [-977.930] -- 0:00:27
      568500 -- (-974.813) (-975.059) (-976.873) [-974.361] * (-976.593) (-977.700) [-975.611] (-977.595) -- 0:00:27
      569000 -- (-980.149) [-976.057] (-976.789) (-976.371) * [-975.739] (-979.034) (-976.692) (-975.258) -- 0:00:27
      569500 -- [-977.479] (-975.704) (-978.344) (-974.987) * (-975.188) (-977.504) (-976.477) [-975.760] -- 0:00:27
      570000 -- (-974.696) [-974.690] (-979.259) (-975.585) * (-978.226) (-976.707) [-974.568] (-976.060) -- 0:00:27

      Average standard deviation of split frequencies: 0.007331

      570500 -- (-976.225) [-977.173] (-974.652) (-975.451) * (-977.083) (-976.485) [-974.937] (-977.527) -- 0:00:27
      571000 -- (-977.413) [-974.519] (-978.134) (-976.681) * (-977.738) [-976.955] (-974.695) (-975.225) -- 0:00:27
      571500 -- (-976.367) [-975.005] (-977.418) (-975.413) * (-976.330) (-976.584) (-974.714) [-974.951] -- 0:00:26
      572000 -- (-975.498) (-974.562) [-974.551] (-973.973) * (-976.552) (-978.000) [-975.710] (-976.355) -- 0:00:26
      572500 -- (-977.633) (-974.764) [-975.142] (-974.272) * [-974.628] (-975.529) (-974.562) (-980.028) -- 0:00:26
      573000 -- (-980.269) [-976.486] (-974.945) (-980.235) * [-975.180] (-975.210) (-976.307) (-981.083) -- 0:00:26
      573500 -- (-980.166) (-975.928) (-974.031) [-976.627] * (-976.187) (-975.651) (-975.706) [-976.067] -- 0:00:26
      574000 -- (-984.214) [-975.887] (-978.382) (-978.615) * (-978.026) (-975.904) (-976.998) [-976.065] -- 0:00:26
      574500 -- [-983.568] (-977.338) (-978.579) (-975.970) * (-975.242) [-975.256] (-974.061) (-975.937) -- 0:00:26
      575000 -- [-977.223] (-975.317) (-975.544) (-975.037) * (-977.059) [-975.017] (-977.122) (-976.736) -- 0:00:26

      Average standard deviation of split frequencies: 0.006766

      575500 -- (-977.192) [-979.542] (-978.180) (-974.928) * (-978.384) (-975.166) [-975.099] (-976.368) -- 0:00:26
      576000 -- [-976.241] (-974.386) (-976.459) (-974.918) * [-977.625] (-976.785) (-978.086) (-977.650) -- 0:00:26
      576500 -- (-979.677) (-976.612) [-977.545] (-977.019) * (-976.571) (-974.102) (-977.768) [-976.190] -- 0:00:26
      577000 -- (-979.749) (-975.127) [-976.841] (-977.182) * [-975.066] (-974.104) (-982.120) (-977.653) -- 0:00:26
      577500 -- (-974.548) (-976.114) [-973.896] (-979.752) * (-978.815) [-975.879] (-979.071) (-976.750) -- 0:00:26
      578000 -- (-976.756) (-975.111) (-974.490) [-976.686] * (-978.061) [-977.408] (-983.397) (-975.342) -- 0:00:26
      578500 -- (-975.201) [-974.324] (-974.675) (-977.309) * (-977.782) (-975.810) (-979.011) [-977.012] -- 0:00:26
      579000 -- [-977.321] (-975.180) (-978.079) (-976.299) * (-974.457) (-978.480) (-975.927) [-977.121] -- 0:00:26
      579500 -- (-975.352) (-976.190) (-975.102) [-974.833] * (-978.583) (-977.883) [-977.799] (-976.343) -- 0:00:26
      580000 -- [-975.324] (-977.046) (-976.866) (-976.004) * (-977.153) [-977.417] (-975.580) (-975.354) -- 0:00:26

      Average standard deviation of split frequencies: 0.007865

      580500 -- [-975.854] (-976.176) (-976.442) (-974.002) * (-975.957) (-976.248) [-976.257] (-974.020) -- 0:00:26
      581000 -- (-977.550) (-975.060) [-975.521] (-974.583) * (-980.859) (-979.058) (-974.755) [-974.870] -- 0:00:26
      581500 -- [-975.949] (-974.531) (-975.136) (-976.817) * [-977.350] (-978.198) (-977.583) (-974.290) -- 0:00:26
      582000 -- [-976.413] (-976.689) (-975.550) (-977.281) * [-976.140] (-975.743) (-974.940) (-975.499) -- 0:00:26
      582500 -- (-977.173) [-974.859] (-977.471) (-982.301) * (-979.737) [-974.597] (-974.535) (-975.975) -- 0:00:26
      583000 -- (-976.840) [-975.335] (-977.596) (-978.265) * (-975.786) [-978.531] (-974.490) (-976.604) -- 0:00:26
      583500 -- [-976.774] (-980.389) (-976.070) (-976.290) * (-974.675) [-975.046] (-974.125) (-975.083) -- 0:00:26
      584000 -- (-974.392) (-982.707) (-975.728) [-976.724] * (-975.215) (-977.380) (-977.507) [-977.284] -- 0:00:26
      584500 -- (-977.853) [-976.239] (-980.047) (-980.724) * (-975.629) (-975.362) (-976.943) [-975.525] -- 0:00:26
      585000 -- (-978.447) (-977.174) (-977.426) [-974.253] * (-976.208) [-975.476] (-975.385) (-977.356) -- 0:00:26

      Average standard deviation of split frequencies: 0.007994

      585500 -- (-976.397) (-977.864) [-974.794] (-974.349) * (-974.794) (-975.818) [-974.244] (-983.649) -- 0:00:26
      586000 -- (-974.501) (-977.034) (-976.958) [-978.048] * (-982.507) (-976.378) (-974.122) [-975.601] -- 0:00:26
      586500 -- [-974.818] (-976.104) (-975.044) (-978.744) * (-975.331) (-975.517) (-974.692) [-976.641] -- 0:00:26
      587000 -- (-977.985) (-976.883) [-975.135] (-975.211) * (-975.411) (-979.288) [-975.295] (-976.573) -- 0:00:26
      587500 -- [-977.289] (-980.007) (-975.892) (-976.159) * (-975.821) [-978.882] (-979.955) (-976.973) -- 0:00:25
      588000 -- [-981.421] (-980.816) (-977.743) (-978.276) * [-977.135] (-980.545) (-978.005) (-974.771) -- 0:00:25
      588500 -- [-976.449] (-978.559) (-974.548) (-977.608) * (-974.579) (-975.747) (-976.642) [-976.887] -- 0:00:25
      589000 -- [-975.385] (-974.722) (-975.094) (-974.797) * (-975.452) (-979.561) [-977.525] (-977.501) -- 0:00:25
      589500 -- (-975.766) [-974.185] (-976.967) (-977.281) * (-976.372) (-977.252) (-977.078) [-974.704] -- 0:00:25
      590000 -- (-977.495) [-974.557] (-977.822) (-974.578) * (-977.573) (-976.519) (-977.273) [-974.648] -- 0:00:25

      Average standard deviation of split frequencies: 0.007931

      590500 -- (-975.474) (-976.970) (-975.756) [-975.342] * [-975.557] (-975.188) (-975.526) (-975.746) -- 0:00:25
      591000 -- (-974.752) (-976.757) [-974.223] (-975.671) * (-979.102) (-974.999) [-975.913] (-977.786) -- 0:00:26
      591500 -- (-976.014) [-978.157] (-976.661) (-976.298) * (-974.970) [-977.272] (-976.059) (-978.351) -- 0:00:26
      592000 -- (-977.207) (-977.953) (-975.517) [-975.514] * (-976.238) (-975.998) (-977.133) [-975.229] -- 0:00:26
      592500 -- (-975.586) (-978.713) (-978.259) [-975.510] * [-976.675] (-976.025) (-980.211) (-975.149) -- 0:00:26
      593000 -- (-975.698) (-975.475) (-976.824) [-977.722] * (-977.080) (-976.117) (-980.035) [-974.372] -- 0:00:26
      593500 -- (-974.374) (-974.490) (-977.881) [-975.848] * (-976.661) (-976.167) [-976.374] (-978.090) -- 0:00:26
      594000 -- (-975.620) (-974.330) (-977.045) [-975.083] * [-975.349] (-977.154) (-977.163) (-975.401) -- 0:00:25
      594500 -- (-974.741) (-976.626) (-976.845) [-979.208] * (-980.846) [-976.216] (-980.763) (-976.761) -- 0:00:25
      595000 -- (-975.513) (-975.513) (-978.477) [-977.338] * (-975.653) (-975.721) (-977.049) [-974.457] -- 0:00:25

      Average standard deviation of split frequencies: 0.007491

      595500 -- (-975.721) (-978.798) [-978.367] (-974.496) * (-976.585) (-981.754) [-975.358] (-974.183) -- 0:00:25
      596000 -- (-977.830) (-976.898) (-981.648) [-974.641] * (-976.522) (-979.492) (-975.594) [-975.748] -- 0:00:25
      596500 -- [-976.189] (-975.993) (-975.348) (-975.829) * (-974.872) (-980.735) (-978.172) [-975.262] -- 0:00:25
      597000 -- (-976.442) (-975.441) (-978.280) [-976.503] * (-977.821) [-974.968] (-977.855) (-977.334) -- 0:00:25
      597500 -- [-976.515] (-974.994) (-978.950) (-974.805) * [-979.072] (-977.127) (-975.107) (-976.783) -- 0:00:25
      598000 -- (-975.171) (-974.695) [-976.609] (-976.256) * (-976.686) (-975.383) [-975.007] (-976.430) -- 0:00:25
      598500 -- (-974.480) (-976.435) (-976.367) [-975.427] * (-976.082) (-974.494) (-975.961) [-977.334] -- 0:00:25
      599000 -- (-974.842) (-976.058) (-977.049) [-975.874] * (-976.405) [-974.429] (-979.047) (-975.514) -- 0:00:25
      599500 -- [-974.881] (-975.651) (-976.178) (-975.702) * (-976.746) (-974.565) (-974.540) [-977.485] -- 0:00:25
      600000 -- [-974.747] (-978.815) (-975.274) (-974.039) * (-977.531) (-975.643) (-974.308) [-974.713] -- 0:00:25

      Average standard deviation of split frequencies: 0.007202

      600500 -- (-975.331) (-975.982) (-975.424) [-974.217] * (-981.399) [-974.797] (-974.551) (-977.496) -- 0:00:25
      601000 -- (-976.927) (-976.025) [-975.797] (-977.414) * (-979.097) (-974.161) (-974.229) [-977.373] -- 0:00:25
      601500 -- (-975.858) (-974.962) [-975.337] (-977.215) * [-975.300] (-975.731) (-974.648) (-974.472) -- 0:00:25
      602000 -- (-975.007) [-974.870] (-975.220) (-978.493) * [-974.516] (-982.396) (-974.114) (-974.639) -- 0:00:25
      602500 -- (-979.101) [-977.528] (-978.589) (-975.088) * (-977.682) (-976.076) (-974.490) [-981.278] -- 0:00:25
      603000 -- [-977.633] (-977.057) (-978.133) (-974.014) * (-981.483) (-975.093) [-973.916] (-974.712) -- 0:00:25
      603500 -- (-975.881) [-976.872] (-977.934) (-974.002) * (-979.495) (-977.385) (-974.088) [-974.690] -- 0:00:24
      604000 -- (-978.816) [-976.318] (-975.777) (-973.920) * (-974.911) [-975.200] (-978.315) (-975.577) -- 0:00:24
      604500 -- (-976.015) (-975.186) (-978.526) [-974.369] * (-978.152) [-976.249] (-974.966) (-976.456) -- 0:00:24
      605000 -- (-976.625) (-977.973) (-977.934) [-974.364] * [-978.562] (-976.018) (-975.827) (-978.430) -- 0:00:24

      Average standard deviation of split frequencies: 0.007504

      605500 -- (-980.104) (-975.291) [-974.876] (-977.291) * (-975.123) (-975.612) [-976.037] (-977.184) -- 0:00:24
      606000 -- (-975.940) (-977.988) (-976.757) [-974.119] * (-974.146) (-974.780) (-979.339) [-976.657] -- 0:00:24
      606500 -- [-976.083] (-979.512) (-973.880) (-977.438) * (-974.873) [-974.873] (-981.296) (-978.123) -- 0:00:25
      607000 -- [-977.591] (-979.392) (-974.623) (-976.739) * (-975.267) (-977.107) [-976.335] (-977.647) -- 0:00:25
      607500 -- (-975.063) [-978.097] (-975.734) (-974.432) * (-974.611) (-976.209) [-981.265] (-977.472) -- 0:00:25
      608000 -- (-975.983) [-979.352] (-978.056) (-974.877) * [-974.758] (-975.772) (-977.290) (-977.865) -- 0:00:25
      608500 -- (-975.106) (-975.958) (-974.900) [-975.554] * (-975.260) (-978.359) [-979.723] (-975.685) -- 0:00:25
      609000 -- (-978.560) [-975.774] (-974.938) (-977.544) * (-976.305) (-978.968) (-976.679) [-975.053] -- 0:00:25
      609500 -- [-976.687] (-977.678) (-976.116) (-974.001) * (-975.240) (-974.497) [-978.698] (-974.724) -- 0:00:24
      610000 -- (-979.270) (-976.187) (-977.170) [-974.001] * (-978.040) (-975.182) [-979.628] (-975.824) -- 0:00:24

      Average standard deviation of split frequencies: 0.007492

      610500 -- (-978.378) (-975.343) (-977.063) [-982.903] * (-976.598) [-976.013] (-976.243) (-974.884) -- 0:00:24
      611000 -- (-978.161) (-976.264) (-980.088) [-975.581] * (-977.424) (-975.797) (-977.617) [-973.925] -- 0:00:24
      611500 -- (-978.190) [-976.255] (-975.643) (-976.121) * (-980.231) (-982.278) (-976.358) [-973.976] -- 0:00:24
      612000 -- (-977.726) [-974.076] (-975.489) (-976.518) * (-975.426) (-979.352) (-976.450) [-975.427] -- 0:00:24
      612500 -- (-977.401) [-975.282] (-979.497) (-977.187) * [-975.912] (-978.064) (-976.512) (-974.309) -- 0:00:24
      613000 -- [-975.314] (-977.053) (-977.577) (-975.717) * (-977.591) [-975.794] (-974.395) (-976.122) -- 0:00:24
      613500 -- (-977.473) [-976.566] (-974.934) (-975.364) * (-981.547) (-976.303) [-977.878] (-976.959) -- 0:00:24
      614000 -- (-977.765) [-974.096] (-975.140) (-975.945) * (-977.543) (-976.136) (-976.374) [-978.065] -- 0:00:24
      614500 -- [-980.530] (-974.166) (-974.634) (-976.817) * [-975.484] (-977.466) (-977.065) (-976.952) -- 0:00:24
      615000 -- (-982.215) [-975.450] (-977.042) (-975.467) * (-976.893) [-975.827] (-978.231) (-974.839) -- 0:00:24

      Average standard deviation of split frequencies: 0.006932

      615500 -- (-974.578) (-974.781) (-979.573) [-974.493] * (-975.159) (-976.900) [-975.007] (-976.043) -- 0:00:24
      616000 -- (-975.762) (-978.391) (-975.680) [-979.178] * (-975.675) (-976.987) (-975.996) [-974.603] -- 0:00:24
      616500 -- [-974.908] (-979.503) (-977.498) (-977.604) * (-975.210) (-978.066) [-974.726] (-975.823) -- 0:00:24
      617000 -- (-975.938) (-978.338) (-978.229) [-977.991] * (-974.150) (-974.726) [-975.520] (-978.230) -- 0:00:24
      617500 -- (-975.991) (-978.802) [-974.917] (-977.102) * (-978.463) (-979.481) [-975.862] (-978.416) -- 0:00:24
      618000 -- (-974.687) (-976.842) (-974.789) [-975.692] * (-979.618) (-976.014) (-974.210) [-975.551] -- 0:00:24
      618500 -- (-974.417) [-978.381] (-975.180) (-981.797) * (-977.733) (-974.583) (-979.235) [-975.589] -- 0:00:24
      619000 -- (-974.821) (-975.576) (-977.095) [-976.658] * [-978.808] (-975.196) (-975.101) (-975.838) -- 0:00:24
      619500 -- (-975.425) [-976.314] (-974.655) (-976.625) * (-977.573) (-975.305) [-975.831] (-975.694) -- 0:00:23
      620000 -- [-977.512] (-977.507) (-975.297) (-975.343) * (-985.155) (-975.423) (-976.470) [-974.049] -- 0:00:23

      Average standard deviation of split frequencies: 0.006657

      620500 -- (-978.675) (-976.708) (-978.225) [-977.017] * (-975.662) (-975.773) (-974.779) [-976.667] -- 0:00:23
      621000 -- (-975.979) (-976.416) (-976.174) [-977.083] * (-976.625) (-978.790) [-976.456] (-973.921) -- 0:00:23
      621500 -- (-976.678) [-977.955] (-974.154) (-977.932) * (-977.558) (-980.896) (-975.324) [-975.774] -- 0:00:23
      622000 -- (-974.499) (-976.519) (-974.770) [-979.810] * (-982.859) (-976.385) [-974.611] (-974.399) -- 0:00:23
      622500 -- (-975.062) [-976.948] (-981.065) (-974.797) * (-977.685) (-979.209) [-975.141] (-976.014) -- 0:00:24
      623000 -- (-976.041) (-975.256) (-979.774) [-975.015] * [-974.438] (-980.704) (-979.751) (-977.338) -- 0:00:24
      623500 -- (-977.134) (-978.844) (-975.127) [-975.996] * (-978.418) [-982.856] (-976.142) (-975.380) -- 0:00:24
      624000 -- [-974.602] (-976.869) (-974.848) (-977.199) * (-976.521) (-976.920) [-980.220] (-975.722) -- 0:00:24
      624500 -- (-975.175) [-975.855] (-976.123) (-974.814) * (-975.415) (-977.608) [-976.320] (-976.316) -- 0:00:24
      625000 -- (-975.373) [-974.765] (-976.295) (-974.525) * (-975.740) (-978.635) (-974.365) [-976.954] -- 0:00:24

      Average standard deviation of split frequencies: 0.006910

      625500 -- [-974.631] (-977.481) (-979.095) (-975.787) * (-975.363) (-976.510) [-977.842] (-977.021) -- 0:00:23
      626000 -- [-974.566] (-977.638) (-976.314) (-976.156) * (-978.201) (-973.886) [-974.629] (-975.279) -- 0:00:23
      626500 -- (-975.121) [-976.719] (-978.914) (-975.952) * [-976.274] (-975.827) (-977.662) (-976.865) -- 0:00:23
      627000 -- (-976.520) (-975.930) (-979.733) [-976.400] * (-974.819) [-976.324] (-976.790) (-976.066) -- 0:00:23
      627500 -- (-977.128) [-978.045] (-978.414) (-976.700) * (-974.818) [-977.043] (-978.129) (-974.885) -- 0:00:23
      628000 -- (-975.606) (-974.762) (-975.116) [-975.867] * (-974.918) (-977.246) [-975.358] (-975.979) -- 0:00:23
      628500 -- (-979.277) (-979.061) [-974.381] (-976.227) * [-977.926] (-977.009) (-975.212) (-974.371) -- 0:00:23
      629000 -- (-976.411) (-975.351) [-975.784] (-975.569) * [-977.841] (-975.537) (-975.212) (-975.660) -- 0:00:23
      629500 -- (-974.996) [-974.106] (-975.328) (-977.285) * (-977.417) [-975.636] (-976.394) (-975.294) -- 0:00:23
      630000 -- [-975.651] (-976.683) (-974.509) (-976.135) * (-977.490) [-974.397] (-975.253) (-976.680) -- 0:00:23

      Average standard deviation of split frequencies: 0.007475

      630500 -- (-975.322) (-974.056) (-975.570) [-975.765] * [-976.281] (-974.754) (-977.120) (-976.125) -- 0:00:23
      631000 -- (-979.983) [-976.124] (-975.225) (-976.155) * (-974.412) (-974.834) [-976.260] (-977.242) -- 0:00:23
      631500 -- [-976.841] (-977.811) (-975.596) (-977.140) * [-978.095] (-976.361) (-978.968) (-975.598) -- 0:00:23
      632000 -- (-975.633) (-976.723) [-976.255] (-978.172) * [-976.769] (-975.954) (-974.437) (-976.670) -- 0:00:23
      632500 -- (-975.096) (-976.734) [-975.622] (-977.694) * (-977.087) (-975.540) [-980.424] (-975.596) -- 0:00:23
      633000 -- (-978.037) (-975.311) [-975.010] (-975.823) * (-978.396) (-976.110) [-980.065] (-974.725) -- 0:00:23
      633500 -- (-976.918) (-977.331) [-978.120] (-980.859) * (-974.001) [-976.228] (-977.885) (-977.094) -- 0:00:23
      634000 -- (-975.409) (-976.071) [-979.332] (-983.776) * (-974.147) (-975.040) (-976.932) [-977.942] -- 0:00:23
      634500 -- (-976.026) [-974.799] (-975.204) (-978.713) * [-975.845] (-973.922) (-978.771) (-976.988) -- 0:00:23
      635000 -- (-975.213) (-981.289) [-976.342] (-977.269) * (-979.336) (-973.934) (-978.036) [-975.741] -- 0:00:22

      Average standard deviation of split frequencies: 0.007456

      635500 -- (-983.171) (-978.020) (-976.429) [-974.882] * [-975.510] (-974.895) (-976.999) (-977.965) -- 0:00:22
      636000 -- (-975.270) (-976.399) (-976.468) [-978.912] * (-980.087) [-977.119] (-976.842) (-975.945) -- 0:00:22
      636500 -- (-978.103) (-978.540) [-976.030] (-974.732) * [-974.909] (-976.235) (-980.953) (-976.552) -- 0:00:22
      637000 -- (-978.524) (-975.975) [-974.058] (-974.278) * (-974.905) [-977.337] (-980.229) (-977.202) -- 0:00:22
      637500 -- (-976.496) [-974.587] (-977.904) (-976.319) * (-978.138) (-975.180) (-977.014) [-977.666] -- 0:00:22
      638000 -- (-975.149) [-976.212] (-976.031) (-975.549) * [-975.459] (-978.940) (-974.749) (-979.994) -- 0:00:22
      638500 -- [-975.872] (-976.893) (-977.470) (-975.075) * (-975.039) (-979.703) [-975.931] (-979.202) -- 0:00:22
      639000 -- (-977.769) [-977.932] (-975.342) (-976.443) * (-974.450) (-981.911) [-975.265] (-975.997) -- 0:00:22
      639500 -- (-974.030) (-977.459) [-977.416] (-980.370) * (-976.317) (-979.472) [-974.677] (-975.993) -- 0:00:23
      640000 -- (-974.130) (-975.707) (-978.167) [-979.180] * (-978.042) (-976.209) [-975.425] (-975.423) -- 0:00:23

      Average standard deviation of split frequencies: 0.007748

      640500 -- (-975.634) (-978.912) [-978.613] (-974.045) * (-976.530) (-976.240) (-977.014) [-976.066] -- 0:00:23
      641000 -- (-975.829) [-976.359] (-976.702) (-973.821) * (-974.239) (-977.183) (-974.774) [-976.762] -- 0:00:22
      641500 -- (-976.532) (-982.480) (-977.112) [-977.015] * (-977.216) [-974.380] (-979.169) (-975.557) -- 0:00:22
      642000 -- (-976.496) [-977.198] (-978.213) (-977.008) * (-976.092) [-979.349] (-980.756) (-975.557) -- 0:00:22
      642500 -- (-980.254) (-977.131) [-977.946] (-976.103) * [-974.958] (-976.819) (-976.789) (-979.220) -- 0:00:22
      643000 -- [-976.356] (-977.730) (-977.268) (-976.376) * (-974.895) (-976.779) [-977.555] (-974.918) -- 0:00:22
      643500 -- (-976.325) (-977.472) [-975.520] (-977.874) * (-975.292) [-976.681] (-975.092) (-977.972) -- 0:00:22
      644000 -- (-977.050) (-975.808) [-977.682] (-974.817) * (-977.254) (-975.677) [-978.072] (-978.732) -- 0:00:22
      644500 -- [-976.826] (-975.406) (-976.150) (-975.869) * (-978.143) (-975.797) [-973.971] (-976.853) -- 0:00:22
      645000 -- [-977.266] (-976.444) (-975.292) (-974.389) * (-980.911) (-974.560) (-975.238) [-977.874] -- 0:00:22

      Average standard deviation of split frequencies: 0.007469

      645500 -- [-974.654] (-976.262) (-976.399) (-976.498) * (-974.971) (-975.505) [-976.151] (-980.280) -- 0:00:22
      646000 -- (-976.707) (-977.313) [-976.953] (-979.013) * (-976.218) (-978.083) [-975.405] (-977.186) -- 0:00:22
      646500 -- [-977.254] (-976.197) (-981.195) (-977.626) * (-980.351) (-975.391) [-974.820] (-976.304) -- 0:00:22
      647000 -- (-977.901) [-977.792] (-974.790) (-975.362) * (-978.637) (-977.272) [-977.771] (-976.682) -- 0:00:22
      647500 -- (-984.202) (-975.164) [-975.688] (-974.337) * (-974.469) (-975.265) (-978.942) [-976.008] -- 0:00:22
      648000 -- (-980.431) (-974.944) (-977.817) [-974.224] * (-974.538) (-977.126) [-976.382] (-976.328) -- 0:00:22
      648500 -- (-977.418) [-979.391] (-978.729) (-974.641) * (-975.933) (-977.027) (-974.811) [-977.055] -- 0:00:22
      649000 -- (-976.383) (-975.401) (-976.774) [-977.852] * (-977.117) (-976.847) [-977.363] (-979.550) -- 0:00:22
      649500 -- (-977.578) (-974.750) (-975.632) [-975.882] * [-975.761] (-979.801) (-979.493) (-975.794) -- 0:00:22
      650000 -- (-976.612) (-976.006) (-981.291) [-975.680] * (-975.479) (-977.026) [-976.271] (-975.447) -- 0:00:22

      Average standard deviation of split frequencies: 0.007458

      650500 -- [-975.261] (-978.234) (-976.291) (-975.268) * (-977.011) [-978.317] (-978.662) (-975.219) -- 0:00:22
      651000 -- (-979.079) [-977.103] (-978.144) (-977.723) * (-977.834) (-976.098) (-976.827) [-974.211] -- 0:00:21
      651500 -- [-977.566] (-975.657) (-980.550) (-987.979) * (-980.448) (-975.836) [-977.963] (-975.828) -- 0:00:21
      652000 -- (-978.005) (-976.118) (-976.000) [-977.930] * (-975.759) [-976.127] (-978.098) (-974.901) -- 0:00:21
      652500 -- (-978.530) (-975.077) (-974.619) [-977.420] * [-974.709] (-975.796) (-975.957) (-974.780) -- 0:00:21
      653000 -- (-976.404) (-980.688) (-975.467) [-982.191] * (-975.066) (-976.239) [-979.218] (-974.676) -- 0:00:21
      653500 -- (-977.429) (-977.915) [-975.257] (-976.160) * (-974.112) (-978.936) (-977.553) [-977.440] -- 0:00:21
      654000 -- (-974.740) [-976.667] (-975.620) (-977.501) * [-975.470] (-975.904) (-976.825) (-976.837) -- 0:00:22
      654500 -- (-974.517) (-979.703) (-974.672) [-974.581] * (-975.892) (-975.099) [-975.463] (-977.202) -- 0:00:22
      655000 -- [-975.867] (-977.747) (-974.755) (-976.208) * (-975.318) [-978.410] (-976.694) (-975.462) -- 0:00:22

      Average standard deviation of split frequencies: 0.007397

      655500 -- (-975.563) [-975.116] (-976.734) (-977.718) * (-974.794) (-974.457) [-976.598] (-975.630) -- 0:00:22
      656000 -- (-974.735) (-974.233) (-974.344) [-974.452] * [-975.181] (-974.457) (-974.847) (-976.532) -- 0:00:22
      656500 -- [-974.132] (-974.370) (-979.229) (-976.019) * [-974.109] (-982.405) (-977.710) (-978.399) -- 0:00:21
      657000 -- [-976.515] (-974.628) (-978.148) (-976.142) * [-976.919] (-978.434) (-977.010) (-976.673) -- 0:00:21
      657500 -- (-976.747) (-975.383) [-974.714] (-975.550) * (-975.315) (-974.004) (-975.604) [-975.868] -- 0:00:21
      658000 -- (-980.298) [-975.472] (-974.843) (-976.936) * [-977.168] (-978.412) (-978.509) (-976.907) -- 0:00:21
      658500 -- (-979.781) [-974.076] (-975.331) (-974.205) * (-975.883) (-978.355) [-978.096] (-976.103) -- 0:00:21
      659000 -- (-974.423) (-975.050) (-977.980) [-974.421] * (-977.267) (-978.473) (-974.452) [-976.424] -- 0:00:21
      659500 -- (-975.416) (-974.343) (-978.096) [-977.535] * [-975.328] (-975.187) (-974.119) (-976.528) -- 0:00:21
      660000 -- (-974.173) (-976.796) [-978.473] (-974.477) * (-978.712) [-980.940] (-974.415) (-974.475) -- 0:00:21

      Average standard deviation of split frequencies: 0.007429

      660500 -- [-975.920] (-975.262) (-978.763) (-977.298) * (-977.542) [-977.364] (-974.279) (-974.215) -- 0:00:21
      661000 -- (-977.964) (-978.784) (-977.260) [-974.116] * [-979.283] (-977.231) (-976.376) (-976.630) -- 0:00:21
      661500 -- (-976.389) (-975.107) (-978.661) [-977.614] * (-979.825) (-977.570) (-974.619) [-975.687] -- 0:00:21
      662000 -- (-977.324) (-974.107) (-980.926) [-975.488] * (-975.932) (-976.283) [-976.638] (-975.066) -- 0:00:21
      662500 -- [-976.537] (-976.938) (-976.053) (-978.714) * (-975.973) [-975.195] (-976.842) (-976.629) -- 0:00:21
      663000 -- (-976.424) (-976.710) [-974.571] (-979.078) * (-974.372) (-976.655) [-975.382] (-975.246) -- 0:00:21
      663500 -- (-977.104) [-975.725] (-974.497) (-979.237) * (-978.323) (-975.310) [-975.968] (-976.774) -- 0:00:21
      664000 -- [-977.168] (-980.196) (-978.033) (-976.423) * [-976.880] (-975.567) (-977.039) (-974.732) -- 0:00:21
      664500 -- (-978.509) [-977.457] (-977.544) (-977.942) * (-977.849) (-978.684) (-977.643) [-974.119] -- 0:00:21
      665000 -- (-978.405) (-975.125) [-979.070] (-977.894) * (-976.575) [-978.860] (-978.085) (-974.756) -- 0:00:21

      Average standard deviation of split frequencies: 0.007245

      665500 -- (-975.884) (-976.212) [-974.602] (-975.343) * (-978.890) (-978.313) [-977.224] (-974.756) -- 0:00:21
      666000 -- (-975.335) (-979.299) [-978.073] (-975.784) * (-976.635) (-975.854) [-975.365] (-981.799) -- 0:00:21
      666500 -- (-975.255) (-977.921) (-974.352) [-977.837] * (-975.815) (-976.736) [-976.580] (-975.014) -- 0:00:21
      667000 -- (-977.264) [-973.820] (-975.293) (-976.343) * (-979.101) (-977.521) (-976.736) [-974.270] -- 0:00:20
      667500 -- [-979.251] (-977.866) (-978.368) (-979.514) * (-978.397) (-975.375) (-981.968) [-973.970] -- 0:00:20
      668000 -- [-977.534] (-975.311) (-975.234) (-975.452) * (-978.678) (-975.395) (-974.951) [-976.225] -- 0:00:20
      668500 -- (-975.553) (-975.295) (-977.595) [-974.131] * (-976.245) (-976.744) (-975.710) [-974.981] -- 0:00:20
      669000 -- (-975.207) (-976.934) (-975.077) [-974.100] * (-976.208) (-979.184) [-974.358] (-979.640) -- 0:00:20
      669500 -- (-980.671) (-975.593) [-978.207] (-974.579) * (-977.540) (-985.238) (-978.965) [-975.921] -- 0:00:20
      670000 -- (-983.298) (-976.741) [-979.114] (-974.700) * (-974.954) [-974.364] (-974.773) (-977.624) -- 0:00:20

      Average standard deviation of split frequencies: 0.006822

      670500 -- (-979.981) (-976.002) [-974.857] (-974.292) * [-978.138] (-975.064) (-976.505) (-979.920) -- 0:00:21
      671000 -- (-975.451) (-975.229) [-974.396] (-974.881) * (-975.643) [-974.259] (-975.495) (-975.975) -- 0:00:21
      671500 -- (-979.815) [-975.585] (-975.383) (-974.418) * (-976.211) (-974.362) [-979.082] (-974.589) -- 0:00:21
      672000 -- (-975.650) (-978.585) (-975.945) [-973.954] * [-975.046] (-976.697) (-977.445) (-975.525) -- 0:00:20
      672500 -- (-975.256) (-976.706) [-976.589] (-974.532) * (-975.556) [-977.965] (-977.147) (-974.963) -- 0:00:20
      673000 -- (-978.273) (-976.938) (-976.553) [-976.954] * (-975.781) [-975.309] (-976.772) (-975.424) -- 0:00:20
      673500 -- [-977.518] (-977.334) (-979.734) (-975.785) * (-976.227) (-975.882) (-975.058) [-974.977] -- 0:00:20
      674000 -- (-978.021) (-975.170) [-977.680] (-973.971) * (-976.498) (-975.922) (-978.301) [-975.294] -- 0:00:20
      674500 -- (-974.602) [-977.588] (-976.367) (-976.233) * (-981.573) (-975.555) [-979.873] (-975.996) -- 0:00:20
      675000 -- (-974.697) (-977.468) (-977.289) [-975.253] * (-977.102) (-975.476) [-975.633] (-977.340) -- 0:00:20

      Average standard deviation of split frequencies: 0.006358

      675500 -- [-977.752] (-978.452) (-976.352) (-977.634) * (-978.697) (-977.840) [-978.828] (-975.691) -- 0:00:20
      676000 -- (-974.840) (-977.935) (-976.798) [-976.216] * [-976.285] (-977.182) (-978.019) (-974.138) -- 0:00:20
      676500 -- (-974.832) [-977.938] (-977.817) (-978.537) * (-978.314) (-978.048) (-975.960) [-975.161] -- 0:00:20
      677000 -- [-975.577] (-975.702) (-976.483) (-975.700) * (-975.593) (-977.050) [-976.192] (-979.764) -- 0:00:20
      677500 -- [-974.463] (-979.423) (-975.536) (-974.859) * (-975.534) (-974.811) [-976.186] (-976.872) -- 0:00:20
      678000 -- (-975.881) [-978.866] (-976.542) (-975.124) * [-975.475] (-974.948) (-980.244) (-976.480) -- 0:00:20
      678500 -- (-976.955) (-976.676) [-974.212] (-975.040) * [-975.695] (-977.368) (-978.546) (-975.414) -- 0:00:20
      679000 -- (-976.850) (-974.025) [-974.043] (-975.342) * (-975.028) [-977.184] (-975.686) (-975.538) -- 0:00:20
      679500 -- (-976.678) (-975.160) [-975.659] (-975.335) * [-975.006] (-976.957) (-976.434) (-975.655) -- 0:00:20
      680000 -- (-974.562) [-977.044] (-975.714) (-976.579) * (-979.759) (-976.029) [-976.663] (-977.994) -- 0:00:20

      Average standard deviation of split frequencies: 0.006396

      680500 -- (-974.259) (-974.601) (-975.915) [-976.977] * (-982.708) [-977.272] (-975.253) (-976.945) -- 0:00:20
      681000 -- (-974.340) [-977.392] (-976.882) (-981.123) * (-981.113) (-978.307) (-974.749) [-976.411] -- 0:00:20
      681500 -- (-975.622) (-974.978) [-977.505] (-980.899) * (-978.532) (-980.709) [-976.710] (-977.248) -- 0:00:20
      682000 -- (-974.291) (-978.134) [-975.380] (-975.865) * (-979.377) (-975.873) [-975.846] (-977.758) -- 0:00:20
      682500 -- (-975.254) [-975.678] (-977.785) (-981.803) * (-977.025) [-979.578] (-977.214) (-976.953) -- 0:00:20
      683000 -- (-974.946) [-975.505] (-980.055) (-981.823) * (-975.697) [-978.405] (-976.990) (-977.678) -- 0:00:19
      683500 -- (-975.739) (-975.419) [-977.040] (-975.499) * (-976.811) [-976.429] (-977.173) (-976.747) -- 0:00:19
      684000 -- [-974.122] (-975.838) (-975.183) (-974.071) * (-976.195) [-978.375] (-974.963) (-976.312) -- 0:00:19
      684500 -- (-973.951) [-975.482] (-976.831) (-974.825) * (-976.469) (-974.399) [-975.400] (-976.377) -- 0:00:19
      685000 -- [-975.535] (-976.425) (-978.415) (-980.316) * [-976.065] (-980.534) (-976.242) (-978.895) -- 0:00:19

      Average standard deviation of split frequencies: 0.006387

      685500 -- (-976.781) (-975.660) [-977.112] (-977.332) * (-975.935) [-974.902] (-977.402) (-978.278) -- 0:00:19
      686000 -- [-979.334] (-976.619) (-979.270) (-982.141) * [-976.290] (-975.190) (-978.457) (-981.083) -- 0:00:19
      686500 -- [-976.449] (-978.808) (-976.687) (-978.063) * [-976.100] (-978.501) (-981.884) (-977.204) -- 0:00:20
      687000 -- (-975.247) (-976.574) [-975.005] (-977.706) * [-979.023] (-979.986) (-976.805) (-983.024) -- 0:00:20
      687500 -- [-975.098] (-975.178) (-975.861) (-977.423) * (-976.626) [-979.826] (-980.422) (-975.463) -- 0:00:20
      688000 -- (-975.592) [-976.320] (-976.004) (-979.333) * (-975.026) [-976.789] (-977.059) (-975.067) -- 0:00:19
      688500 -- (-975.563) [-976.128] (-979.058) (-974.799) * (-975.261) (-975.661) (-977.507) [-974.187] -- 0:00:19
      689000 -- (-977.916) (-976.844) (-977.904) [-973.964] * (-974.419) [-974.823] (-974.246) (-974.859) -- 0:00:19
      689500 -- [-974.314] (-975.716) (-974.562) (-974.761) * (-974.992) [-977.059] (-978.154) (-977.058) -- 0:00:19
      690000 -- [-979.391] (-975.694) (-974.443) (-975.974) * (-976.484) [-974.470] (-976.791) (-978.875) -- 0:00:19

      Average standard deviation of split frequencies: 0.006544

      690500 -- (-976.031) (-976.931) [-976.975] (-974.629) * (-977.022) (-976.977) [-975.633] (-974.996) -- 0:00:19
      691000 -- (-976.376) (-979.985) (-977.023) [-976.810] * (-982.812) (-975.472) (-974.484) [-976.197] -- 0:00:19
      691500 -- (-976.888) (-975.235) (-977.568) [-975.694] * (-976.941) (-979.164) (-975.403) [-975.144] -- 0:00:19
      692000 -- (-975.535) [-974.597] (-983.424) (-980.552) * [-974.849] (-978.215) (-975.787) (-975.694) -- 0:00:19
      692500 -- (-974.931) (-982.606) [-978.230] (-978.397) * (-977.163) (-980.461) [-978.829] (-978.856) -- 0:00:19
      693000 -- (-974.727) (-980.720) (-974.466) [-978.049] * (-977.557) (-975.609) (-975.011) [-975.391] -- 0:00:19
      693500 -- (-974.919) [-975.368] (-975.394) (-977.094) * [-977.132] (-975.616) (-976.653) (-975.203) -- 0:00:19
      694000 -- (-976.398) (-974.401) (-975.458) [-974.820] * (-976.802) (-979.472) (-975.699) [-975.958] -- 0:00:19
      694500 -- (-976.079) (-979.865) [-976.076] (-977.290) * [-975.954] (-978.984) (-977.974) (-977.497) -- 0:00:19
      695000 -- (-975.276) (-978.995) (-976.414) [-976.199] * (-978.223) (-974.811) [-977.020] (-981.791) -- 0:00:19

      Average standard deviation of split frequencies: 0.006733

      695500 -- (-974.663) [-978.152] (-974.382) (-976.448) * [-974.934] (-981.514) (-975.860) (-977.473) -- 0:00:19
      696000 -- (-974.785) (-979.169) [-974.323] (-976.265) * [-975.772] (-974.971) (-974.249) (-976.266) -- 0:00:19
      696500 -- (-976.176) [-977.928] (-979.918) (-977.222) * (-977.268) (-978.725) [-974.996] (-976.056) -- 0:00:19
      697000 -- (-977.483) (-974.534) [-976.318] (-977.031) * (-977.545) [-976.476] (-974.717) (-975.837) -- 0:00:19
      697500 -- (-976.707) (-975.506) [-975.765] (-980.258) * (-978.922) [-974.609] (-975.327) (-974.733) -- 0:00:19
      698000 -- (-975.367) (-975.477) (-977.593) [-975.413] * [-975.713] (-977.113) (-975.820) (-975.048) -- 0:00:19
      698500 -- [-975.845] (-975.011) (-978.102) (-977.061) * (-976.719) [-976.523] (-975.363) (-979.557) -- 0:00:18
      699000 -- (-983.899) (-976.699) (-978.351) [-976.033] * [-976.515] (-976.252) (-979.191) (-975.188) -- 0:00:18
      699500 -- (-975.345) [-976.274] (-975.250) (-974.330) * (-976.428) [-974.512] (-975.381) (-977.875) -- 0:00:18
      700000 -- (-978.542) [-975.716] (-975.699) (-978.077) * (-974.892) (-976.552) [-975.275] (-974.912) -- 0:00:18

      Average standard deviation of split frequencies: 0.006570

      700500 -- (-976.731) (-977.158) (-976.126) [-976.536] * (-976.255) (-974.540) (-979.176) [-974.705] -- 0:00:18
      701000 -- (-976.764) [-977.906] (-976.600) (-976.173) * [-976.607] (-976.873) (-975.325) (-975.029) -- 0:00:18
      701500 -- (-977.469) [-976.869] (-976.538) (-974.555) * (-976.993) (-976.184) (-978