--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:21:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/ispD/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -975.43 -979.31
2 -975.48 -979.03
--------------------------------------
TOTAL -975.46 -979.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896100 0.091966 0.378443 1.495609 0.862402 1311.24 1375.78 1.000
r(A<->C){all} 0.169628 0.020811 0.000102 0.459708 0.134936 88.14 168.37 1.000
r(A<->G){all} 0.168587 0.019693 0.000033 0.445014 0.133978 303.28 330.89 1.000
r(A<->T){all} 0.167250 0.018532 0.000022 0.440501 0.132336 173.70 202.96 1.000
r(C<->G){all} 0.152619 0.016326 0.000191 0.406673 0.120580 183.70 283.58 1.000
r(C<->T){all} 0.171185 0.023075 0.000111 0.472217 0.126519 153.36 176.61 1.000
r(G<->T){all} 0.170730 0.020194 0.000078 0.451599 0.134247 214.25 262.20 1.000
pi(A){all} 0.152386 0.000177 0.127938 0.179020 0.152255 1237.35 1271.65 1.000
pi(C){all} 0.288959 0.000264 0.259240 0.322369 0.288615 1275.00 1371.76 1.000
pi(G){all} 0.334150 0.000305 0.299972 0.369283 0.333776 1072.46 1286.73 1.000
pi(T){all} 0.224506 0.000247 0.192267 0.252944 0.224455 946.42 1058.33 1.000
alpha{1,2} 0.429031 0.246419 0.000208 1.386995 0.258346 1067.90 1208.24 1.000
alpha{3} 0.462271 0.245375 0.000284 1.470481 0.296265 1164.94 1236.36 1.000
pinvar{all} 0.997767 0.000007 0.992777 0.999995 0.998560 1016.24 1097.42 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -934.30311
Model 2: PositiveSelection -934.303111
Model 0: one-ratio -934.303111
Model 7: beta -934.30311
Model 8: beta&w>1 -934.303111
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 1.9999999949504854E-6
>C1
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C2
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C3
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C4
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C5
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C6
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=241
C1 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C2 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C3 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C4 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C5 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C6 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
**************************************************
C1 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C2 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C3 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C4 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C5 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C6 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
**************************************************
C1 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C2 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C3 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C4 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C5 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C6 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
**************************************************
C1 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C2 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C3 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C4 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C5 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C6 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
**************************************************
C1 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C2 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C3 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C4 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C5 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C6 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
*****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 241 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 241 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7230]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7230]--->[7230]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.491 Mb, Max= 30.792 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C2 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C3 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C4 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C5 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
C6 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
**************************************************
C1 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C2 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C3 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C4 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C5 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
C6 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
**************************************************
C1 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C2 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C3 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C4 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C5 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
C6 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
**************************************************
C1 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C2 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C3 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C4 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C5 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
C6 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
**************************************************
C1 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C2 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C3 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C4 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C5 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
C6 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
*****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C2 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C3 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C4 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C5 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
C6 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
**************************************************
C1 GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C2 GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C3 GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C4 GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C5 GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
C6 GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
**************************************************
C1 GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C2 GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C3 GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C4 GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C5 GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
C6 GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
**************************************************
C1 GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C2 GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C3 GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C4 GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C5 GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
C6 GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
**************************************************
C1 GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C2 GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C3 GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C4 GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C5 GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
C6 GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
**************************************************
C1 TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C2 TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C3 TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C4 TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C5 TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
C6 TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
**************************************************
C1 ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C2 ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C3 ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C4 ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C5 ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
C6 ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
**************************************************
C1 TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C2 TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C3 TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C4 TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C5 TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
C6 TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
**************************************************
C1 ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C2 ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C3 ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C4 ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C5 ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
C6 ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
**************************************************
C1 GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C2 GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C3 GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C4 GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C5 GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
C6 GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
**************************************************
C1 GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C2 GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C3 GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C4 GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C5 GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
C6 GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
**************************************************
C1 TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C2 TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C3 TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C4 TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C5 TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
C6 TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
**************************************************
C1 ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C2 ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C3 ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C4 ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C5 ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
C6 ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
**************************************************
C1 CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C2 CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C3 CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C4 CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C5 CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
C6 CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
**************************************************
C1 TGGCGAAGAAGATTCTGCGCCGG
C2 TGGCGAAGAAGATTCTGCGCCGG
C3 TGGCGAAGAAGATTCTGCGCCGG
C4 TGGCGAAGAAGATTCTGCGCCGG
C5 TGGCGAAGAAGATTCTGCGCCGG
C6 TGGCGAAGAAGATTCTGCGCCGG
***********************
>C1
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C2
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C3
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C4
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C5
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C6
ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC
GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG
GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT
GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA
GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG
TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG
ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA
TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG
ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT
GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC
GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC
TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC
ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT
CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC
TGGCGAAGAAGATTCTGCGCCGG
>C1
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C2
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C3
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C4
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C5
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
>C6
MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 723 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792790
Setting output file names to "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1984031375
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0305485028
Seed = 289688997
Swapseed = 1579792790
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1618.108563 -- -24.965149
Chain 2 -- -1618.108656 -- -24.965149
Chain 3 -- -1618.108563 -- -24.965149
Chain 4 -- -1618.108563 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1618.108563 -- -24.965149
Chain 2 -- -1618.108656 -- -24.965149
Chain 3 -- -1618.108563 -- -24.965149
Chain 4 -- -1618.108656 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1618.109] (-1618.109) (-1618.109) (-1618.109) * [-1618.109] (-1618.109) (-1618.109) (-1618.109)
500 -- (-990.169) [-1000.098] (-988.274) (-988.404) * [-998.406] (-990.034) (-981.601) (-982.232) -- 0:00:00
1000 -- (-982.775) (-1006.951) [-985.138] (-989.227) * [-981.653] (-981.259) (-990.017) (-988.087) -- 0:00:00
1500 -- (-987.261) (-992.697) (-982.378) [-986.389] * (-987.104) (-986.219) (-986.143) [-982.396] -- 0:00:00
2000 -- (-991.522) (-985.436) (-982.697) [-982.856] * (-983.652) [-981.667] (-987.990) (-984.192) -- 0:00:00
2500 -- (-988.697) [-978.797] (-978.232) (-996.532) * (-981.036) (-988.387) (-981.673) [-982.289] -- 0:00:00
3000 -- [-982.695] (-986.245) (-982.016) (-985.288) * (-988.264) (-993.803) [-980.780] (-980.493) -- 0:00:00
3500 -- (-986.127) [-979.389] (-988.603) (-995.271) * (-986.531) (-984.650) (-988.585) [-984.989] -- 0:00:00
4000 -- (-983.746) [-982.256] (-983.683) (-986.058) * (-983.836) (-990.173) [-983.024] (-979.237) -- 0:00:00
4500 -- [-991.273] (-986.867) (-989.166) (-983.134) * (-982.635) (-994.273) (-982.559) [-986.209] -- 0:00:00
5000 -- (-994.460) [-982.218] (-983.326) (-983.699) * (-982.723) [-982.920] (-977.807) (-982.239) -- 0:00:00
Average standard deviation of split frequencies: 0.095647
5500 -- (-986.135) (-986.416) (-979.835) [-984.544] * (-987.946) (-980.906) (-994.208) [-984.848] -- 0:00:00
6000 -- (-993.617) (-980.107) [-979.412] (-982.560) * (-990.742) [-983.507] (-984.178) (-980.987) -- 0:00:00
6500 -- (-984.836) [-986.414] (-979.220) (-986.089) * (-982.293) (-980.218) (-987.864) [-984.292] -- 0:00:00
7000 -- (-1002.374) (-993.046) (-975.890) [-984.744] * [-982.801] (-987.204) (-984.827) (-984.274) -- 0:00:00
7500 -- (-982.712) (-982.539) (-974.894) [-987.161] * [-985.893] (-981.963) (-983.799) (-987.124) -- 0:00:00
8000 -- (-988.467) [-983.913] (-977.164) (-987.857) * (-991.372) [-991.634] (-984.238) (-974.633) -- 0:00:00
8500 -- [-981.014] (-985.656) (-978.502) (-988.375) * (-988.191) (-987.831) (-985.296) [-976.404] -- 0:00:00
9000 -- (-984.293) [-985.659] (-974.934) (-982.101) * (-988.661) (-984.579) [-979.190] (-976.263) -- 0:00:00
9500 -- (-987.876) [-980.735] (-974.741) (-989.105) * (-991.849) (-984.067) (-981.412) [-978.465] -- 0:00:00
10000 -- (-984.508) [-979.806] (-974.967) (-985.390) * (-982.019) (-989.588) (-988.378) [-977.746] -- 0:00:00
Average standard deviation of split frequencies: 0.077866
10500 -- [-985.465] (-981.012) (-974.804) (-984.070) * (-980.556) [-978.439] (-981.164) (-977.487) -- 0:00:00
11000 -- (-980.387) [-981.520] (-974.825) (-988.184) * (-992.182) [-984.361] (-984.973) (-975.594) -- 0:00:00
11500 -- (-989.781) (-979.878) [-974.522] (-990.637) * (-989.087) (-983.985) [-989.816] (-977.199) -- 0:00:00
12000 -- (-988.134) [-980.328] (-974.946) (-985.893) * (-988.202) (-985.728) (-984.647) [-976.987] -- 0:00:00
12500 -- (-990.209) [-981.934] (-975.914) (-986.848) * (-996.447) (-988.791) (-987.038) [-977.795] -- 0:00:00
13000 -- [-981.818] (-988.889) (-974.659) (-987.727) * (-986.605) (-989.302) (-985.397) [-977.172] -- 0:01:15
13500 -- (-990.570) [-987.579] (-978.374) (-993.184) * [-984.652] (-982.274) (-983.080) (-976.811) -- 0:01:13
14000 -- (-994.792) (-983.380) [-978.078] (-985.351) * (-985.744) (-992.075) (-982.353) [-976.499] -- 0:01:10
14500 -- (-992.065) (-985.683) [-974.923] (-981.828) * (-993.307) (-984.363) (-985.603) [-974.051] -- 0:01:07
15000 -- [-982.217] (-1000.068) (-974.998) (-990.289) * [-987.844] (-980.170) (-989.031) (-979.497) -- 0:01:05
Average standard deviation of split frequencies: 0.076859
15500 -- (-986.395) (-986.486) [-975.684] (-997.905) * [-983.780] (-987.705) (-987.763) (-977.479) -- 0:01:03
16000 -- [-986.867] (-983.539) (-975.767) (-976.271) * (-988.543) (-983.072) (-987.868) [-975.631] -- 0:01:01
16500 -- (-991.278) (-992.697) [-975.492] (-977.366) * (-981.857) (-982.902) (-984.730) [-974.980] -- 0:00:59
17000 -- [-986.335] (-983.321) (-977.583) (-976.711) * (-987.930) [-983.612] (-983.166) (-975.003) -- 0:00:57
17500 -- (-989.343) [-988.760] (-975.558) (-977.601) * (-985.829) (-985.122) [-982.846] (-975.321) -- 0:00:56
18000 -- (-981.474) (-981.207) (-976.782) [-976.872] * (-994.240) (-988.975) [-982.609] (-975.052) -- 0:00:54
18500 -- [-980.306] (-987.477) (-978.262) (-975.906) * (-993.059) [-986.286] (-984.080) (-974.863) -- 0:00:53
19000 -- (-989.148) (-977.378) (-974.737) [-975.345] * [-980.991] (-983.472) (-985.127) (-976.639) -- 0:00:51
19500 -- (-989.148) (-983.064) (-976.585) [-977.106] * (-978.503) [-984.017] (-989.074) (-975.544) -- 0:00:50
20000 -- [-985.120] (-978.365) (-977.259) (-978.045) * (-987.220) (-988.437) [-979.429] (-978.860) -- 0:00:49
Average standard deviation of split frequencies: 0.041818
20500 -- [-981.398] (-979.279) (-977.201) (-976.294) * [-982.655] (-984.531) (-988.534) (-975.412) -- 0:00:47
21000 -- (-988.009) (-977.511) [-975.119] (-980.019) * (-987.696) [-985.208] (-982.768) (-974.741) -- 0:00:46
21500 -- (-984.277) (-975.707) [-974.659] (-975.435) * (-994.483) (-987.828) (-989.476) [-974.951] -- 0:00:45
22000 -- (-982.705) (-976.333) [-974.688] (-975.357) * (-983.829) [-986.032] (-984.923) (-976.918) -- 0:00:44
22500 -- (-993.202) (-975.085) [-977.229] (-975.203) * [-981.297] (-981.280) (-989.488) (-975.827) -- 0:00:43
23000 -- [-982.109] (-975.731) (-977.075) (-975.653) * (-990.475) [-978.981] (-986.030) (-976.202) -- 0:00:42
23500 -- (-988.878) [-974.674] (-974.044) (-976.669) * [-996.489] (-985.144) (-984.322) (-976.536) -- 0:00:41
24000 -- (-989.148) (-974.395) (-975.979) [-976.131] * [-986.273] (-986.464) (-983.181) (-975.975) -- 0:00:40
24500 -- (-987.976) (-975.389) (-975.420) [-982.559] * (-982.046) (-986.093) [-984.877] (-974.468) -- 0:00:39
25000 -- [-982.047] (-975.338) (-977.972) (-980.381) * (-988.562) [-988.509] (-987.685) (-975.455) -- 0:00:39
Average standard deviation of split frequencies: 0.037125
25500 -- (-989.112) [-974.133] (-975.495) (-977.681) * (-999.246) (-988.237) (-979.251) [-977.525] -- 0:00:38
26000 -- (-975.236) [-975.516] (-974.584) (-975.048) * (-984.063) (-991.036) [-975.742] (-975.847) -- 0:00:37
26500 -- [-975.508] (-976.003) (-975.614) (-976.893) * (-989.657) (-983.547) [-976.523] (-976.660) -- 0:00:36
27000 -- [-976.903] (-975.022) (-974.588) (-977.274) * (-985.521) [-985.751] (-978.916) (-976.609) -- 0:00:36
27500 -- (-974.687) (-977.745) [-975.465] (-975.773) * (-983.317) [-988.453] (-979.045) (-976.705) -- 0:00:35
28000 -- (-976.059) (-975.168) (-974.227) [-976.738] * [-986.590] (-981.469) (-978.618) (-975.316) -- 0:01:09
28500 -- [-976.862] (-976.345) (-974.640) (-975.746) * (-982.910) [-986.003] (-977.089) (-975.769) -- 0:01:08
29000 -- (-975.955) (-976.017) (-975.011) [-974.763] * [-980.215] (-984.757) (-975.118) (-975.312) -- 0:01:06
29500 -- [-975.849] (-976.426) (-975.648) (-977.174) * (-978.478) (-982.335) [-975.055] (-974.922) -- 0:01:05
30000 -- [-976.116] (-975.894) (-976.197) (-977.606) * [-985.648] (-991.123) (-974.658) (-976.632) -- 0:01:04
Average standard deviation of split frequencies: 0.042879
30500 -- (-974.796) (-976.379) (-974.601) [-977.482] * (-985.755) (-979.073) [-975.862] (-975.254) -- 0:01:03
31000 -- [-976.255] (-976.200) (-974.121) (-976.186) * (-992.531) [-981.176] (-974.296) (-976.512) -- 0:01:02
31500 -- (-979.349) [-976.571] (-976.866) (-980.542) * (-993.990) (-985.890) (-975.736) [-976.091] -- 0:01:01
32000 -- (-980.305) (-976.287) (-977.044) [-980.683] * [-984.100] (-989.026) (-974.082) (-976.058) -- 0:01:00
32500 -- [-979.305] (-979.322) (-975.222) (-987.776) * [-981.508] (-986.506) (-974.484) (-975.938) -- 0:00:59
33000 -- [-975.519] (-974.616) (-976.754) (-987.132) * (-981.269) (-990.539) (-976.594) [-976.960] -- 0:00:58
33500 -- [-977.283] (-982.076) (-977.346) (-981.709) * (-993.360) (-982.517) [-975.228] (-979.144) -- 0:00:57
34000 -- (-974.733) (-976.653) (-977.100) [-979.918] * (-983.414) (-986.182) [-974.672] (-976.988) -- 0:00:56
34500 -- (-976.200) [-979.006] (-976.819) (-976.697) * (-981.740) (-985.476) [-975.339] (-975.915) -- 0:00:55
35000 -- (-975.275) (-982.402) (-977.163) [-975.900] * (-985.270) (-991.942) [-974.316] (-979.190) -- 0:00:55
Average standard deviation of split frequencies: 0.029635
35500 -- [-975.233] (-975.542) (-977.873) (-974.219) * (-985.063) (-993.437) [-977.313] (-976.046) -- 0:00:54
36000 -- (-975.941) (-974.303) [-977.877] (-975.556) * (-990.471) (-985.582) (-978.068) [-977.962] -- 0:00:53
36500 -- (-974.912) (-976.745) [-977.206] (-979.097) * (-980.581) [-985.814] (-978.587) (-981.016) -- 0:00:52
37000 -- (-978.066) (-978.361) (-977.397) [-978.618] * [-990.303] (-986.233) (-976.272) (-977.437) -- 0:00:52
37500 -- (-975.035) [-975.810] (-981.073) (-977.132) * (-988.685) (-986.240) (-975.545) [-976.802] -- 0:00:51
38000 -- [-977.059] (-977.092) (-979.720) (-977.011) * [-983.271] (-988.436) (-976.695) (-976.205) -- 0:00:50
38500 -- (-976.225) (-977.919) (-981.563) [-975.010] * (-990.966) (-988.229) (-975.832) [-975.314] -- 0:00:49
39000 -- [-976.855] (-977.606) (-976.379) (-976.416) * (-983.992) (-991.973) [-976.903] (-976.709) -- 0:00:49
39500 -- (-976.952) (-976.044) [-976.211] (-976.512) * [-980.878] (-988.007) (-975.632) (-976.630) -- 0:00:48
40000 -- (-976.059) [-975.606] (-977.666) (-977.683) * [-984.708] (-989.747) (-978.555) (-977.190) -- 0:00:48
Average standard deviation of split frequencies: 0.027692
40500 -- [-974.418] (-978.136) (-975.991) (-975.982) * (-986.203) (-991.065) [-977.406] (-974.655) -- 0:00:47
41000 -- (-974.915) [-975.605] (-978.282) (-975.702) * (-988.685) (-989.859) [-976.775] (-975.019) -- 0:00:46
41500 -- (-974.944) (-975.463) (-976.360) [-975.482] * (-994.032) (-988.515) (-976.995) [-975.069] -- 0:00:46
42000 -- [-975.015] (-975.054) (-981.130) (-976.115) * (-985.007) (-994.561) (-974.420) [-983.550] -- 0:00:45
42500 -- [-975.274] (-975.563) (-976.718) (-975.990) * (-985.124) (-988.467) [-974.449] (-976.494) -- 0:00:45
43000 -- (-975.679) [-975.264] (-974.550) (-975.947) * (-990.627) (-989.799) (-974.207) [-976.192] -- 0:00:44
43500 -- (-979.768) (-978.422) [-975.495] (-976.210) * [-984.427] (-987.400) (-974.671) (-975.679) -- 0:01:05
44000 -- (-976.220) (-976.761) [-976.267] (-975.206) * (-986.271) [-983.974] (-974.671) (-976.948) -- 0:01:05
44500 -- (-974.919) [-975.554] (-975.780) (-975.274) * (-989.912) (-992.644) [-976.193] (-975.064) -- 0:01:04
45000 -- (-975.742) [-975.161] (-974.957) (-976.202) * (-984.955) (-986.880) (-978.423) [-975.896] -- 0:01:03
Average standard deviation of split frequencies: 0.029768
45500 -- (-977.639) (-988.353) (-977.780) [-975.129] * [-985.102] (-987.800) (-994.739) (-978.429) -- 0:01:02
46000 -- (-978.456) (-979.122) (-974.570) [-980.058] * (-986.793) (-993.415) (-980.556) [-975.697] -- 0:01:02
46500 -- (-977.314) (-976.781) [-974.931] (-976.735) * (-987.692) [-986.609] (-975.985) (-974.298) -- 0:01:01
47000 -- (-976.471) (-974.323) [-976.883] (-983.950) * (-997.452) [-986.877] (-975.741) (-974.667) -- 0:01:00
47500 -- (-978.352) [-975.228] (-977.325) (-979.274) * (-987.715) [-982.455] (-975.582) (-980.399) -- 0:01:00
48000 -- (-976.070) [-974.735] (-979.360) (-976.201) * (-988.497) (-979.095) [-973.932] (-975.433) -- 0:00:59
48500 -- [-974.432] (-976.246) (-980.352) (-975.874) * (-986.311) (-982.692) [-975.118] (-974.890) -- 0:00:58
49000 -- (-976.307) (-974.627) (-975.483) [-975.131] * (-988.562) (-984.614) [-975.444] (-976.879) -- 0:00:58
49500 -- (-977.019) (-975.119) (-980.404) [-976.779] * [-976.200] (-981.418) (-974.718) (-977.427) -- 0:00:57
50000 -- (-979.984) (-975.442) (-977.370) [-974.539] * (-976.681) (-991.459) (-974.849) [-979.872] -- 0:00:57
Average standard deviation of split frequencies: 0.028843
50500 -- (-979.781) [-977.364] (-980.104) (-979.695) * [-975.710] (-983.306) (-974.214) (-976.059) -- 0:00:56
51000 -- (-978.763) (-976.660) [-977.130] (-975.934) * (-978.646) (-989.006) [-976.963] (-979.020) -- 0:00:55
51500 -- [-976.009] (-980.866) (-977.221) (-980.321) * (-976.844) (-982.452) (-976.047) [-978.173] -- 0:00:55
52000 -- (-976.634) [-977.583] (-975.227) (-974.425) * (-977.019) (-982.933) [-974.701] (-975.973) -- 0:00:54
52500 -- (-977.196) (-979.836) (-976.364) [-976.228] * [-973.997] (-984.642) (-976.879) (-977.126) -- 0:00:54
53000 -- (-977.372) [-976.220] (-975.955) (-976.083) * (-975.587) (-983.095) (-976.035) [-980.791] -- 0:00:53
53500 -- (-978.948) (-976.684) (-974.925) [-975.119] * (-975.445) (-995.640) (-979.814) [-979.086] -- 0:00:53
54000 -- (-975.517) [-979.793] (-975.873) (-974.696) * (-974.039) [-982.723] (-979.544) (-977.192) -- 0:00:52
54500 -- (-978.363) (-974.321) (-981.490) [-975.913] * [-978.498] (-980.721) (-975.525) (-979.452) -- 0:00:52
55000 -- (-974.975) (-975.032) (-978.163) [-975.742] * (-978.513) [-983.258] (-977.716) (-981.131) -- 0:00:51
Average standard deviation of split frequencies: 0.030570
55500 -- (-974.552) (-980.955) [-977.600] (-977.730) * (-975.327) (-995.184) (-974.680) [-975.342] -- 0:00:51
56000 -- (-978.051) (-975.217) [-974.843] (-976.456) * (-974.650) (-989.558) [-976.425] (-973.967) -- 0:00:50
56500 -- (-975.875) (-977.142) [-976.307] (-980.116) * (-977.597) (-975.534) [-977.163] (-974.345) -- 0:00:50
57000 -- (-975.460) (-977.325) [-975.095] (-974.523) * (-981.074) (-976.635) [-977.401] (-977.718) -- 0:00:49
57500 -- [-976.395] (-975.241) (-975.106) (-974.606) * [-975.688] (-976.341) (-978.847) (-976.612) -- 0:00:49
58000 -- (-975.902) [-976.696] (-977.964) (-974.564) * (-977.488) [-979.664] (-975.392) (-978.712) -- 0:01:04
58500 -- (-976.540) [-977.183] (-977.499) (-975.280) * (-977.189) [-975.331] (-975.662) (-979.448) -- 0:01:04
59000 -- [-975.307] (-983.455) (-981.217) (-976.054) * (-975.767) (-975.919) (-976.910) [-976.991] -- 0:01:03
59500 -- (-976.770) (-980.719) [-976.071] (-974.997) * [-978.459] (-975.381) (-975.120) (-978.953) -- 0:01:03
60000 -- (-980.689) [-974.147] (-976.059) (-982.334) * (-976.596) (-975.282) [-975.263] (-976.512) -- 0:01:02
Average standard deviation of split frequencies: 0.027585
60500 -- (-976.929) (-973.926) (-976.047) [-979.791] * (-976.759) [-976.074] (-974.683) (-983.878) -- 0:01:02
61000 -- (-976.430) (-975.538) (-979.012) [-975.515] * (-974.836) [-978.891] (-975.296) (-980.705) -- 0:01:01
61500 -- (-975.174) (-974.462) (-977.015) [-974.951] * (-974.608) (-976.817) (-976.206) [-977.944] -- 0:01:01
62000 -- [-975.292] (-974.900) (-978.289) (-975.087) * (-975.995) [-975.913] (-974.823) (-977.951) -- 0:01:00
62500 -- (-976.833) [-975.310] (-976.249) (-975.007) * [-973.796] (-977.704) (-974.444) (-975.163) -- 0:01:00
63000 -- [-974.857] (-974.689) (-978.657) (-975.091) * (-977.630) (-975.778) [-975.025] (-977.128) -- 0:00:59
63500 -- (-974.352) (-979.406) [-975.570] (-974.984) * (-977.661) (-977.860) [-975.914] (-977.855) -- 0:00:58
64000 -- [-975.107] (-974.804) (-974.183) (-977.138) * (-975.108) (-978.635) (-975.408) [-977.948] -- 0:00:58
64500 -- (-977.382) (-974.823) [-975.839] (-975.249) * [-975.115] (-974.418) (-979.050) (-976.988) -- 0:00:58
65000 -- (-976.105) [-975.113] (-978.486) (-975.432) * (-975.605) (-976.455) (-976.570) [-975.926] -- 0:00:57
Average standard deviation of split frequencies: 0.030611
65500 -- (-976.036) (-974.901) (-980.202) [-974.447] * (-976.069) (-975.882) (-976.157) [-976.833] -- 0:00:57
66000 -- [-974.907] (-977.439) (-977.076) (-974.959) * [-974.484] (-976.959) (-976.089) (-982.460) -- 0:00:56
66500 -- (-975.808) [-974.767] (-976.482) (-976.106) * (-975.699) (-982.133) [-976.072] (-976.231) -- 0:00:56
67000 -- (-974.756) (-976.610) (-978.728) [-976.322] * (-976.102) (-981.149) (-975.377) [-975.260] -- 0:00:55
67500 -- (-974.604) (-974.599) (-976.661) [-977.494] * (-975.359) (-975.397) [-974.808] (-975.647) -- 0:00:55
68000 -- (-976.572) (-979.861) (-976.188) [-979.302] * (-979.370) (-982.271) [-973.920] (-980.631) -- 0:00:54
68500 -- [-975.626] (-975.523) (-977.171) (-975.594) * (-974.378) (-976.986) [-975.016] (-977.685) -- 0:00:54
69000 -- (-976.300) [-974.849] (-975.944) (-978.431) * (-976.289) [-974.266] (-975.908) (-979.605) -- 0:00:53
69500 -- [-976.893] (-974.510) (-974.890) (-975.678) * (-977.397) [-974.317] (-976.189) (-975.190) -- 0:00:53
70000 -- (-975.967) (-978.323) (-974.277) [-976.591] * (-981.723) (-974.823) (-975.348) [-976.189] -- 0:00:53
Average standard deviation of split frequencies: 0.026048
70500 -- (-977.233) [-976.726] (-976.313) (-974.649) * (-980.907) (-979.038) (-976.595) [-974.536] -- 0:00:52
71000 -- (-981.124) (-975.826) (-975.854) [-975.154] * (-977.232) (-980.014) (-974.885) [-974.571] -- 0:00:52
71500 -- (-979.387) [-975.420] (-978.090) (-974.660) * (-977.983) (-976.486) [-975.508] (-975.167) -- 0:00:51
72000 -- [-975.083] (-976.249) (-977.089) (-975.532) * [-975.821] (-974.343) (-975.491) (-975.196) -- 0:00:51
72500 -- [-974.949] (-976.694) (-975.941) (-974.707) * (-975.465) [-975.597] (-975.491) (-975.815) -- 0:00:51
73000 -- [-976.356] (-977.529) (-977.692) (-978.007) * (-975.450) [-977.466] (-977.389) (-976.059) -- 0:00:50
73500 -- (-981.205) (-976.121) [-978.145] (-976.202) * [-975.117] (-975.728) (-977.616) (-977.532) -- 0:00:50
74000 -- (-978.819) (-979.255) [-977.232] (-976.173) * (-976.155) [-975.970] (-977.720) (-974.914) -- 0:01:02
74500 -- (-977.533) (-979.994) (-975.449) [-974.466] * (-975.112) (-979.344) (-976.626) [-977.499] -- 0:01:02
75000 -- (-976.238) (-984.735) [-981.154] (-976.525) * (-975.140) (-975.182) [-975.119] (-976.277) -- 0:01:01
Average standard deviation of split frequencies: 0.022399
75500 -- (-974.423) [-974.667] (-977.594) (-977.663) * (-974.354) [-975.100] (-977.370) (-976.954) -- 0:01:01
76000 -- (-976.382) [-974.608] (-975.539) (-976.147) * [-979.695] (-977.701) (-974.946) (-976.380) -- 0:01:00
76500 -- (-979.295) (-974.534) (-979.340) [-977.808] * (-975.634) (-976.038) [-974.572] (-977.905) -- 0:01:00
77000 -- (-976.640) (-976.529) (-976.728) [-977.022] * (-974.929) (-975.267) (-975.516) [-975.178] -- 0:00:59
77500 -- (-977.777) (-978.292) [-976.729] (-978.358) * (-974.487) (-978.102) [-975.049] (-975.968) -- 0:00:59
78000 -- [-976.953] (-978.858) (-978.982) (-976.028) * [-974.509] (-975.708) (-977.277) (-977.951) -- 0:00:59
78500 -- [-976.890] (-975.415) (-978.842) (-978.858) * [-974.900] (-974.426) (-975.794) (-976.476) -- 0:00:58
79000 -- (-976.344) (-976.052) (-978.769) [-979.867] * [-974.572] (-979.215) (-975.735) (-980.035) -- 0:00:58
79500 -- (-974.262) [-978.468] (-975.146) (-978.783) * (-977.487) (-978.820) (-974.131) [-974.890] -- 0:00:57
80000 -- [-977.446] (-976.819) (-975.122) (-976.523) * (-978.611) (-976.565) (-978.089) [-974.564] -- 0:00:57
Average standard deviation of split frequencies: 0.025528
80500 -- (-975.971) (-977.721) (-976.940) [-978.228] * (-977.877) (-978.634) (-975.256) [-977.465] -- 0:00:57
81000 -- (-978.647) (-978.354) (-974.953) [-974.439] * [-976.271] (-975.204) (-977.216) (-974.072) -- 0:00:56
81500 -- (-979.080) (-976.694) (-974.570) [-976.384] * (-978.466) (-975.846) (-974.901) [-974.285] -- 0:00:56
82000 -- (-978.125) [-974.245] (-977.612) (-976.690) * (-978.909) (-976.396) (-976.180) [-974.711] -- 0:00:55
82500 -- (-976.149) [-974.247] (-976.336) (-978.274) * [-975.724] (-977.428) (-976.791) (-974.705) -- 0:00:55
83000 -- [-976.369] (-976.782) (-975.980) (-975.225) * [-977.460] (-975.299) (-976.320) (-975.824) -- 0:00:55
83500 -- (-976.186) (-980.362) (-977.852) [-973.885] * [-985.064] (-977.994) (-975.740) (-973.984) -- 0:00:54
84000 -- [-975.801] (-980.435) (-977.391) (-978.361) * [-975.472] (-979.816) (-977.781) (-978.607) -- 0:00:54
84500 -- [-974.493] (-977.644) (-978.511) (-977.101) * (-978.319) (-977.342) [-974.852] (-976.376) -- 0:00:54
85000 -- (-980.225) (-976.676) (-980.123) [-975.099] * (-974.114) (-976.942) [-975.805] (-975.793) -- 0:00:53
Average standard deviation of split frequencies: 0.023657
85500 -- (-977.562) (-974.943) [-977.130] (-978.638) * (-976.359) [-975.473] (-975.561) (-977.044) -- 0:00:53
86000 -- (-976.761) (-978.330) (-979.939) [-976.842] * (-975.771) (-975.602) [-976.048] (-976.866) -- 0:00:53
86500 -- (-978.022) [-977.530] (-976.923) (-976.493) * (-975.048) (-976.272) [-974.394] (-974.881) -- 0:00:52
87000 -- (-975.586) [-974.943] (-976.058) (-976.750) * [-974.953] (-979.644) (-974.716) (-979.924) -- 0:00:52
87500 -- (-979.177) (-976.281) [-976.414] (-976.510) * [-976.596] (-975.917) (-974.553) (-975.321) -- 0:00:52
88000 -- (-975.878) (-974.444) (-978.009) [-976.582] * (-977.069) (-977.266) [-976.929] (-975.792) -- 0:00:51
88500 -- (-974.105) (-974.889) [-974.755] (-977.497) * (-974.710) [-975.971] (-976.706) (-975.577) -- 0:00:51
89000 -- [-974.136] (-976.083) (-974.929) (-977.927) * (-974.753) [-977.280] (-974.878) (-977.900) -- 0:00:51
89500 -- (-974.503) (-976.800) [-977.038] (-976.548) * (-974.075) [-980.172] (-978.840) (-974.539) -- 0:00:50
90000 -- (-976.096) (-978.272) (-977.053) [-976.100] * (-975.395) (-981.817) [-980.223] (-976.750) -- 0:00:50
Average standard deviation of split frequencies: 0.023397
90500 -- (-977.698) (-976.607) (-979.638) [-975.105] * (-974.784) (-976.414) (-977.629) [-975.971] -- 0:01:00
91000 -- (-981.005) [-975.390] (-979.472) (-975.817) * (-974.841) (-977.427) [-977.299] (-975.133) -- 0:00:59
91500 -- (-977.958) (-975.308) [-979.750] (-976.745) * [-976.024] (-974.354) (-978.384) (-975.528) -- 0:00:59
92000 -- [-975.570] (-977.247) (-976.386) (-975.341) * (-974.557) (-978.534) (-979.238) [-974.886] -- 0:00:59
92500 -- (-974.594) (-976.035) (-977.389) [-976.193] * (-976.683) (-975.974) (-976.763) [-976.520] -- 0:00:58
93000 -- [-974.446] (-977.024) (-979.159) (-975.560) * (-976.467) [-976.782] (-977.724) (-975.872) -- 0:00:58
93500 -- (-974.890) [-977.858] (-980.493) (-975.190) * [-979.049] (-981.656) (-977.219) (-975.687) -- 0:00:58
94000 -- (-974.518) (-976.898) (-978.001) [-975.033] * (-976.793) (-977.537) (-976.203) [-978.155] -- 0:00:57
94500 -- (-974.575) [-977.227] (-976.995) (-975.069) * (-975.631) (-977.372) [-974.197] (-977.585) -- 0:00:57
95000 -- [-974.914] (-976.360) (-975.925) (-976.851) * (-974.728) [-975.638] (-974.390) (-976.136) -- 0:00:57
Average standard deviation of split frequencies: 0.023777
95500 -- [-976.808] (-976.701) (-975.718) (-978.764) * (-979.664) (-979.782) [-973.875] (-975.594) -- 0:00:56
96000 -- (-973.997) [-974.643] (-976.023) (-975.765) * (-976.736) (-977.423) (-974.293) [-975.672] -- 0:00:56
96500 -- (-974.311) (-976.318) [-976.546] (-975.674) * (-974.705) (-975.568) (-974.324) [-976.364] -- 0:00:56
97000 -- (-974.932) (-974.290) [-976.097] (-976.429) * (-976.497) (-976.507) [-974.354] (-976.452) -- 0:00:55
97500 -- (-975.764) (-975.777) [-976.543] (-975.216) * (-980.068) (-975.834) [-974.216] (-975.581) -- 0:00:55
98000 -- (-977.021) (-976.924) [-976.113] (-976.279) * (-975.934) [-976.177] (-975.070) (-975.716) -- 0:00:55
98500 -- (-977.559) [-975.848] (-977.472) (-976.530) * (-976.031) [-975.141] (-974.959) (-977.795) -- 0:00:54
99000 -- (-976.543) [-977.306] (-979.035) (-976.968) * [-975.407] (-975.216) (-974.707) (-979.530) -- 0:00:54
99500 -- (-974.740) (-975.026) (-979.608) [-973.903] * (-974.724) (-976.184) (-977.065) [-976.565] -- 0:00:54
100000 -- (-975.317) [-976.750] (-976.157) (-974.428) * (-976.492) (-978.198) (-978.228) [-975.147] -- 0:00:54
Average standard deviation of split frequencies: 0.025618
100500 -- [-979.962] (-978.008) (-976.062) (-974.186) * (-975.047) (-976.027) (-974.299) [-976.961] -- 0:00:53
101000 -- (-982.453) [-976.045] (-978.180) (-975.175) * (-975.747) [-976.389] (-975.761) (-974.843) -- 0:00:53
101500 -- [-977.047] (-977.488) (-976.349) (-976.664) * [-976.428] (-978.149) (-975.117) (-977.772) -- 0:00:53
102000 -- [-977.432] (-977.403) (-977.346) (-976.226) * [-981.430] (-975.634) (-975.247) (-976.405) -- 0:00:52
102500 -- [-976.553] (-976.878) (-975.587) (-974.623) * (-976.338) (-975.392) (-976.229) [-977.012] -- 0:00:52
103000 -- (-980.382) [-977.591] (-976.281) (-975.189) * (-978.110) [-979.931] (-975.180) (-979.208) -- 0:00:52
103500 -- [-975.047] (-977.858) (-976.898) (-975.828) * (-977.734) (-975.525) (-979.258) [-975.030] -- 0:00:51
104000 -- (-980.855) [-979.052] (-974.956) (-975.970) * (-977.220) (-980.579) [-974.285] (-977.144) -- 0:00:51
104500 -- (-975.812) (-979.622) [-976.479] (-974.565) * [-976.604] (-977.634) (-976.205) (-976.367) -- 0:00:51
105000 -- (-976.215) (-980.518) [-975.415] (-974.496) * (-981.149) (-975.921) [-975.316] (-977.685) -- 0:00:51
Average standard deviation of split frequencies: 0.024354
105500 -- (-974.098) [-976.857] (-974.169) (-974.101) * (-975.430) (-974.445) (-975.179) [-974.465] -- 0:00:50
106000 -- (-974.343) (-974.964) [-974.374] (-981.863) * (-975.766) (-976.654) (-976.545) [-974.612] -- 0:00:50
106500 -- [-975.190] (-977.162) (-975.537) (-974.861) * (-977.914) (-976.834) [-976.944] (-976.535) -- 0:00:58
107000 -- (-978.498) (-981.821) [-975.282] (-974.254) * (-976.056) (-974.633) (-975.446) [-974.913] -- 0:00:58
107500 -- (-974.568) [-977.783] (-975.311) (-974.980) * (-976.945) [-975.586] (-975.793) (-974.858) -- 0:00:58
108000 -- (-979.043) (-979.124) [-975.705] (-976.898) * (-980.086) [-975.961] (-976.409) (-975.455) -- 0:00:57
108500 -- (-975.849) [-977.492] (-975.748) (-974.684) * (-981.011) (-977.588) (-974.851) [-976.039] -- 0:00:57
109000 -- (-977.167) (-975.324) (-978.651) [-975.898] * (-974.360) (-978.916) [-975.753] (-976.185) -- 0:00:57
109500 -- [-975.952] (-975.094) (-975.182) (-977.046) * (-975.494) (-978.171) (-975.748) [-976.697] -- 0:00:56
110000 -- (-977.349) [-974.457] (-974.985) (-975.324) * (-976.038) (-975.272) (-974.837) [-978.548] -- 0:00:56
Average standard deviation of split frequencies: 0.021298
110500 -- (-980.449) [-974.305] (-980.651) (-974.103) * (-974.860) (-973.986) [-974.711] (-979.132) -- 0:00:56
111000 -- [-980.635] (-976.971) (-980.531) (-975.631) * [-976.549] (-974.628) (-976.739) (-980.594) -- 0:00:56
111500 -- (-974.598) (-975.656) (-977.825) [-975.592] * (-974.128) [-976.390] (-976.913) (-974.674) -- 0:00:55
112000 -- (-976.582) (-978.525) [-976.953] (-980.639) * (-978.748) (-974.273) [-976.709] (-976.219) -- 0:00:55
112500 -- [-976.660] (-978.379) (-977.789) (-976.337) * (-976.928) (-977.448) [-976.098] (-976.084) -- 0:00:55
113000 -- (-977.104) (-978.532) (-978.156) [-975.878] * (-975.245) (-974.637) [-978.203] (-977.191) -- 0:00:54
113500 -- (-975.416) (-978.383) [-977.462] (-974.203) * (-975.423) (-975.643) [-978.682] (-977.361) -- 0:00:54
114000 -- (-975.340) [-977.106] (-977.611) (-983.496) * (-984.293) (-975.299) [-975.149] (-977.125) -- 0:00:54
114500 -- (-975.504) (-976.514) (-975.968) [-976.348] * (-977.349) (-976.821) [-977.518] (-978.750) -- 0:00:54
115000 -- (-976.291) (-978.307) (-976.101) [-975.283] * (-974.816) (-978.338) (-976.900) [-978.392] -- 0:00:53
Average standard deviation of split frequencies: 0.022030
115500 -- (-976.655) [-976.594] (-979.744) (-975.755) * [-975.109] (-977.927) (-976.405) (-976.826) -- 0:00:53
116000 -- (-980.518) (-975.219) [-976.558] (-975.748) * (-974.477) (-982.271) [-975.293] (-978.467) -- 0:00:53
116500 -- (-977.434) [-977.330] (-975.774) (-976.601) * (-974.497) [-974.902] (-982.294) (-979.621) -- 0:00:53
117000 -- [-981.439] (-976.920) (-979.930) (-976.450) * (-974.500) (-978.169) (-974.487) [-977.641] -- 0:00:52
117500 -- (-978.592) (-977.403) [-978.413] (-977.483) * (-976.448) (-977.795) (-974.806) [-974.880] -- 0:00:52
118000 -- (-976.215) (-975.837) (-978.636) [-978.389] * (-987.234) [-974.822] (-974.543) (-980.079) -- 0:00:52
118500 -- (-976.215) (-975.198) (-978.329) [-977.591] * (-977.050) (-978.361) (-975.930) [-980.466] -- 0:00:52
119000 -- (-978.696) (-974.719) (-983.059) [-974.999] * (-981.553) (-978.301) [-976.459] (-978.979) -- 0:00:51
119500 -- (-979.706) [-978.793] (-977.133) (-974.813) * (-977.052) (-974.880) [-976.681] (-975.573) -- 0:00:51
120000 -- (-976.384) (-974.669) (-976.543) [-976.158] * [-977.645] (-974.814) (-975.726) (-975.861) -- 0:00:51
Average standard deviation of split frequencies: 0.024129
120500 -- (-977.869) (-978.020) (-975.309) [-973.882] * (-975.211) (-977.635) [-976.890] (-975.132) -- 0:00:51
121000 -- (-978.311) (-978.953) (-975.533) [-975.703] * (-977.590) [-974.656] (-976.249) (-977.879) -- 0:00:50
121500 -- (-975.676) (-977.297) (-975.014) [-979.890] * (-977.569) (-975.188) [-975.380] (-978.352) -- 0:00:50
122000 -- (-975.139) [-975.749] (-974.993) (-979.728) * (-978.009) (-978.015) [-974.996] (-978.499) -- 0:00:50
122500 -- [-975.008] (-975.880) (-974.784) (-977.017) * (-976.825) (-976.921) [-976.843] (-975.725) -- 0:00:50
123000 -- (-975.698) (-985.856) [-976.636] (-973.948) * (-975.227) (-977.849) [-977.925] (-976.060) -- 0:00:57
123500 -- (-974.956) (-984.783) (-976.240) [-974.968] * (-975.953) [-978.000] (-980.563) (-976.510) -- 0:00:56
124000 -- (-976.261) (-980.688) (-976.345) [-976.490] * (-976.776) (-976.014) [-976.682] (-977.842) -- 0:00:56
124500 -- (-977.004) (-975.035) (-974.846) [-975.848] * (-983.737) (-974.118) (-976.740) [-976.023] -- 0:00:56
125000 -- (-975.151) (-977.332) [-976.684] (-974.522) * (-979.925) (-975.907) (-976.243) [-974.010] -- 0:00:56
Average standard deviation of split frequencies: 0.023196
125500 -- (-974.558) (-975.097) (-979.685) [-974.777] * [-974.615] (-977.178) (-975.295) (-973.972) -- 0:00:55
126000 -- (-975.648) (-977.440) (-977.136) [-974.538] * (-976.324) (-975.052) [-975.388] (-976.455) -- 0:00:55
126500 -- (-975.165) [-974.482] (-977.804) (-977.249) * (-975.033) (-974.799) [-976.310] (-974.942) -- 0:00:55
127000 -- (-974.107) (-975.431) [-976.055] (-974.450) * (-976.528) (-975.861) [-974.866] (-975.482) -- 0:00:54
127500 -- (-975.209) (-975.806) (-974.170) [-979.367] * (-980.528) (-976.139) [-976.076] (-974.107) -- 0:00:54
128000 -- (-981.184) (-974.614) [-974.838] (-975.504) * [-974.445] (-974.987) (-975.116) (-976.400) -- 0:00:54
128500 -- (-974.431) [-977.755] (-976.640) (-988.685) * (-975.804) (-974.993) [-974.961] (-975.830) -- 0:00:54
129000 -- (-978.959) [-976.751] (-975.492) (-976.974) * [-976.840] (-975.031) (-978.367) (-975.321) -- 0:00:54
129500 -- [-980.075] (-975.886) (-974.746) (-979.192) * (-982.366) (-974.264) (-977.843) [-976.248] -- 0:00:53
130000 -- [-978.448] (-976.981) (-975.214) (-976.954) * (-982.741) [-975.564] (-977.325) (-975.046) -- 0:00:53
Average standard deviation of split frequencies: 0.023049
130500 -- [-977.838] (-977.112) (-974.723) (-977.469) * (-978.437) (-975.358) [-977.208] (-975.679) -- 0:00:53
131000 -- (-977.653) (-979.985) [-976.233] (-975.165) * (-976.037) (-976.469) (-976.248) [-975.834] -- 0:00:53
131500 -- (-976.246) (-979.232) [-976.426] (-974.236) * (-975.604) (-976.934) (-976.005) [-976.624] -- 0:00:52
132000 -- [-975.124] (-974.929) (-976.380) (-974.355) * [-974.916] (-978.612) (-974.921) (-982.340) -- 0:00:52
132500 -- [-975.099] (-974.263) (-975.507) (-978.958) * [-976.354] (-974.366) (-975.063) (-975.216) -- 0:00:52
133000 -- [-976.622] (-979.574) (-975.517) (-974.536) * (-976.310) (-975.804) (-974.373) [-974.837] -- 0:00:52
133500 -- [-977.030] (-975.826) (-975.885) (-976.294) * (-975.584) (-975.507) [-974.137] (-975.118) -- 0:00:51
134000 -- [-976.681] (-978.136) (-975.130) (-975.898) * (-974.667) (-974.019) (-978.346) [-977.564] -- 0:00:51
134500 -- [-976.470] (-978.008) (-978.744) (-976.102) * [-974.733] (-975.301) (-977.552) (-975.765) -- 0:00:51
135000 -- (-980.616) (-980.306) (-979.000) [-975.006] * (-974.762) (-975.362) (-981.049) [-974.692] -- 0:00:51
Average standard deviation of split frequencies: 0.021491
135500 -- (-981.794) (-977.980) [-977.375] (-975.985) * [-976.830] (-974.830) (-975.660) (-980.080) -- 0:00:51
136000 -- (-982.963) (-977.027) (-979.080) [-974.924] * [-975.574] (-982.038) (-977.669) (-976.188) -- 0:00:50
136500 -- (-985.110) (-974.421) (-978.802) [-975.635] * (-975.236) [-976.613] (-975.918) (-974.769) -- 0:00:50
137000 -- (-980.006) (-976.433) (-976.690) [-974.559] * (-976.722) (-975.004) (-976.119) [-974.932] -- 0:00:50
137500 -- (-975.151) (-976.048) [-977.377] (-976.532) * [-976.626] (-976.597) (-977.800) (-974.972) -- 0:00:50
138000 -- (-975.595) (-974.293) [-976.642] (-976.390) * [-974.820] (-975.719) (-979.066) (-978.324) -- 0:00:49
138500 -- [-975.665] (-974.950) (-979.316) (-975.265) * (-974.589) [-977.735] (-978.219) (-976.669) -- 0:00:49
139000 -- (-980.914) (-980.409) [-977.353] (-976.233) * [-975.533] (-976.570) (-976.042) (-976.309) -- 0:00:49
139500 -- (-976.046) [-975.956] (-975.653) (-977.805) * [-976.294] (-975.201) (-975.952) (-978.471) -- 0:00:55
140000 -- (-978.453) (-975.915) (-974.732) [-974.592] * (-977.816) (-976.988) [-975.745] (-978.607) -- 0:00:55
Average standard deviation of split frequencies: 0.021290
140500 -- (-979.791) (-981.114) [-974.595] (-976.577) * (-975.960) [-975.080] (-977.447) (-978.082) -- 0:00:55
141000 -- [-974.791] (-977.424) (-974.863) (-980.235) * (-976.638) (-976.854) [-977.940] (-977.920) -- 0:00:54
141500 -- (-974.106) [-978.047] (-976.836) (-983.026) * (-976.844) (-977.887) (-982.417) [-978.920] -- 0:00:54
142000 -- (-975.610) (-976.117) [-977.414] (-979.148) * (-976.797) (-974.579) [-975.227] (-975.591) -- 0:00:54
142500 -- (-974.153) (-979.002) (-976.129) [-977.520] * (-978.976) [-974.521] (-977.371) (-974.615) -- 0:00:54
143000 -- [-974.637] (-975.706) (-974.951) (-977.322) * (-976.582) [-974.915] (-974.816) (-976.188) -- 0:00:53
143500 -- (-975.808) [-976.820] (-975.884) (-975.290) * (-978.798) (-981.627) (-974.277) [-977.581] -- 0:00:53
144000 -- (-975.384) [-976.608] (-975.451) (-977.325) * (-977.947) (-978.459) [-976.808] (-977.065) -- 0:00:53
144500 -- [-974.390] (-977.461) (-977.391) (-980.217) * (-976.002) [-976.745] (-978.429) (-977.536) -- 0:00:53
145000 -- (-975.022) (-979.071) (-975.987) [-977.240] * (-975.933) (-978.800) [-974.092] (-976.234) -- 0:00:53
Average standard deviation of split frequencies: 0.020987
145500 -- (-974.456) (-977.576) (-976.437) [-973.945] * (-976.083) (-974.828) [-976.701] (-977.356) -- 0:00:52
146000 -- (-973.885) (-975.945) [-977.618] (-975.776) * (-978.755) (-976.723) (-981.728) [-975.168] -- 0:00:52
146500 -- (-978.700) (-976.894) (-976.824) [-975.012] * (-977.775) (-975.925) [-976.629] (-978.380) -- 0:00:52
147000 -- (-974.736) [-975.620] (-977.624) (-977.994) * (-978.357) [-976.830] (-978.238) (-982.199) -- 0:00:52
147500 -- (-978.727) [-976.619] (-978.903) (-977.084) * (-981.369) (-975.789) (-980.203) [-977.135] -- 0:00:52
148000 -- (-979.647) [-977.726] (-977.273) (-977.412) * (-977.477) (-979.535) [-982.904] (-974.727) -- 0:00:51
148500 -- (-976.610) [-974.327] (-979.258) (-975.353) * (-977.665) (-976.399) [-979.852] (-977.025) -- 0:00:51
149000 -- (-974.456) [-975.832] (-978.116) (-975.730) * (-978.493) (-976.751) (-980.349) [-974.660] -- 0:00:51
149500 -- (-974.120) (-975.606) [-975.000] (-978.261) * (-978.574) (-977.385) (-977.144) [-974.605] -- 0:00:51
150000 -- (-975.700) (-979.223) (-977.539) [-974.225] * [-978.088] (-977.580) (-978.092) (-975.555) -- 0:00:51
Average standard deviation of split frequencies: 0.020337
150500 -- (-976.172) [-980.392] (-974.771) (-976.649) * (-976.168) (-975.218) (-977.754) [-977.035] -- 0:00:50
151000 -- (-977.246) [-977.942] (-974.702) (-974.828) * (-974.966) [-975.639] (-975.299) (-977.491) -- 0:00:50
151500 -- [-979.429] (-975.931) (-975.816) (-976.191) * (-975.841) (-974.654) (-977.121) [-974.754] -- 0:00:50
152000 -- (-978.415) (-978.013) (-976.010) [-974.927] * (-979.975) (-975.873) [-974.489] (-974.649) -- 0:00:50
152500 -- [-980.123] (-977.512) (-976.330) (-974.593) * (-975.180) (-975.606) (-974.810) [-974.549] -- 0:00:50
153000 -- (-975.502) (-977.588) (-975.427) [-978.523] * (-978.413) (-975.182) (-975.159) [-974.453] -- 0:00:49
153500 -- (-976.197) [-976.152] (-976.327) (-984.519) * [-975.061] (-974.801) (-975.571) (-974.429) -- 0:00:49
154000 -- [-977.354] (-974.329) (-977.256) (-979.166) * [-973.726] (-974.862) (-975.068) (-974.324) -- 0:00:49
154500 -- (-977.355) [-975.525] (-974.456) (-976.941) * (-982.451) [-975.405] (-975.541) (-973.892) -- 0:00:49
155000 -- [-977.289] (-980.089) (-977.637) (-981.552) * (-975.708) [-976.280] (-975.545) (-974.347) -- 0:00:49
Average standard deviation of split frequencies: 0.019642
155500 -- (-977.912) (-976.714) (-979.340) [-978.887] * [-975.661] (-975.500) (-974.017) (-975.912) -- 0:00:48
156000 -- (-977.693) [-980.876] (-976.699) (-981.715) * [-976.592] (-974.932) (-975.106) (-974.670) -- 0:00:54
156500 -- [-975.219] (-980.127) (-975.497) (-977.203) * (-975.447) (-976.239) [-976.624] (-974.799) -- 0:00:53
157000 -- (-976.341) [-980.340] (-974.709) (-977.647) * (-976.262) (-974.685) [-975.691] (-975.086) -- 0:00:53
157500 -- (-974.197) [-978.267] (-974.817) (-975.902) * (-976.637) [-974.471] (-977.502) (-977.795) -- 0:00:53
158000 -- (-974.958) (-977.468) (-975.042) [-975.667] * [-976.694] (-975.291) (-977.426) (-975.573) -- 0:00:53
158500 -- (-975.286) (-980.766) [-974.447] (-977.879) * [-976.178] (-978.487) (-975.534) (-977.984) -- 0:00:53
159000 -- [-975.697] (-976.014) (-981.289) (-977.497) * (-976.772) [-979.764] (-974.715) (-975.185) -- 0:00:52
159500 -- (-975.670) (-977.698) (-975.194) [-976.126] * [-975.733] (-980.970) (-978.439) (-974.995) -- 0:00:52
160000 -- (-976.431) (-975.999) [-974.982] (-979.342) * (-978.544) (-987.972) [-977.732] (-975.706) -- 0:00:52
Average standard deviation of split frequencies: 0.020021
160500 -- (-978.213) [-975.140] (-976.088) (-978.197) * (-975.197) (-981.614) (-974.961) [-975.388] -- 0:00:52
161000 -- (-980.043) (-974.276) (-976.541) [-975.530] * (-977.605) (-974.408) [-976.180] (-975.787) -- 0:00:52
161500 -- (-976.091) (-977.609) (-976.478) [-976.740] * (-977.988) (-974.555) (-975.371) [-977.014] -- 0:00:51
162000 -- (-977.538) [-974.418] (-978.063) (-975.659) * [-975.834] (-977.064) (-975.806) (-974.488) -- 0:00:51
162500 -- (-976.369) (-977.636) [-977.940] (-975.788) * (-975.780) [-975.599] (-975.887) (-974.602) -- 0:00:51
163000 -- (-975.751) [-976.622] (-977.654) (-976.031) * [-978.163] (-976.412) (-975.154) (-977.472) -- 0:00:51
163500 -- (-976.175) (-975.033) (-975.655) [-977.325] * (-975.996) [-975.797] (-976.213) (-975.257) -- 0:00:51
164000 -- (-976.118) [-975.289] (-976.633) (-975.791) * (-976.676) (-974.855) [-975.155] (-975.612) -- 0:00:50
164500 -- (-977.140) (-977.258) (-984.670) [-974.797] * [-977.444] (-974.855) (-974.954) (-975.055) -- 0:00:50
165000 -- (-978.387) (-976.317) [-978.623] (-976.329) * (-975.819) (-975.372) [-975.993] (-975.060) -- 0:00:50
Average standard deviation of split frequencies: 0.020046
165500 -- (-978.909) (-976.415) (-976.968) [-977.906] * (-980.161) [-975.106] (-974.367) (-976.862) -- 0:00:50
166000 -- [-976.336] (-975.556) (-977.541) (-977.274) * (-975.028) (-974.941) (-975.958) [-976.053] -- 0:00:50
166500 -- (-977.878) (-974.673) (-978.119) [-975.310] * (-975.592) [-978.385] (-975.700) (-976.750) -- 0:00:50
167000 -- (-974.263) (-980.451) (-976.555) [-975.904] * (-976.958) [-979.395] (-977.252) (-976.413) -- 0:00:49
167500 -- (-975.006) (-978.381) [-975.253] (-976.473) * (-976.228) (-974.416) [-977.190] (-974.415) -- 0:00:49
168000 -- (-974.994) (-977.052) [-973.939] (-976.225) * [-975.998] (-974.588) (-975.439) (-978.312) -- 0:00:49
168500 -- (-974.806) (-974.657) (-975.705) [-976.468] * (-980.339) (-973.989) (-976.609) [-979.660] -- 0:00:49
169000 -- [-975.122] (-976.015) (-975.179) (-977.361) * (-982.258) (-975.468) (-978.301) [-978.268] -- 0:00:49
169500 -- (-977.088) (-977.521) (-975.539) [-975.802] * (-980.244) (-974.966) (-976.401) [-974.440] -- 0:00:48
170000 -- [-976.151] (-974.912) (-974.160) (-975.433) * (-975.940) (-975.272) (-976.892) [-975.957] -- 0:00:48
Average standard deviation of split frequencies: 0.019488
170500 -- [-978.031] (-975.917) (-975.248) (-976.573) * (-974.261) (-975.539) (-977.408) [-975.009] -- 0:00:48
171000 -- (-976.667) (-975.606) [-975.493] (-975.299) * (-977.158) [-976.220] (-976.156) (-976.473) -- 0:00:48
171500 -- (-976.789) (-975.211) (-974.424) [-975.391] * (-974.853) [-975.133] (-975.281) (-979.704) -- 0:00:48
172000 -- (-975.034) (-975.356) (-976.016) [-977.331] * [-974.797] (-975.844) (-974.192) (-977.411) -- 0:00:48
172500 -- (-974.473) (-975.647) [-976.128] (-978.477) * (-974.040) (-975.589) [-975.047] (-974.670) -- 0:00:52
173000 -- (-975.896) (-975.428) [-976.128] (-975.720) * [-974.022] (-975.758) (-979.368) (-976.027) -- 0:00:52
173500 -- (-978.244) [-976.960] (-976.896) (-977.711) * [-974.985] (-975.984) (-980.260) (-975.097) -- 0:00:52
174000 -- (-975.504) (-978.438) (-976.464) [-976.257] * (-977.844) (-974.693) (-978.090) [-976.827] -- 0:00:52
174500 -- (-979.175) [-976.010] (-979.401) (-974.323) * (-975.008) (-975.192) (-977.623) [-976.086] -- 0:00:52
175000 -- (-977.984) (-981.166) (-980.067) [-974.312] * (-975.699) (-974.785) (-978.148) [-974.718] -- 0:00:51
Average standard deviation of split frequencies: 0.019222
175500 -- (-974.756) [-976.374] (-975.232) (-977.919) * (-978.267) (-977.160) (-974.969) [-974.411] -- 0:00:51
176000 -- (-975.094) [-978.377] (-974.940) (-980.664) * (-976.994) (-974.939) (-976.449) [-975.535] -- 0:00:51
176500 -- (-975.832) (-977.149) [-975.474] (-976.768) * [-978.199] (-976.509) (-976.503) (-976.260) -- 0:00:51
177000 -- (-974.244) [-974.216] (-979.195) (-975.313) * (-977.148) [-974.717] (-975.261) (-975.883) -- 0:00:51
177500 -- (-975.347) [-976.602] (-979.191) (-975.336) * (-976.123) [-976.302] (-977.482) (-977.124) -- 0:00:50
178000 -- (-976.367) (-975.479) (-974.475) [-975.366] * (-976.138) [-977.061] (-977.555) (-976.718) -- 0:00:50
178500 -- (-975.399) (-975.279) (-975.747) [-976.469] * (-976.340) (-982.054) (-977.531) [-976.697] -- 0:00:50
179000 -- (-977.201) [-979.534] (-977.408) (-977.776) * (-975.272) [-979.132] (-977.436) (-980.560) -- 0:00:50
179500 -- (-974.452) (-975.469) (-980.152) [-978.392] * (-976.975) (-974.528) [-976.515] (-976.062) -- 0:00:50
180000 -- (-974.296) [-979.043] (-974.711) (-979.697) * (-976.829) (-974.979) (-977.359) [-974.521] -- 0:00:50
Average standard deviation of split frequencies: 0.019493
180500 -- (-976.133) (-976.989) (-974.765) [-975.401] * (-980.511) (-975.076) (-977.544) [-973.983] -- 0:00:49
181000 -- [-974.644] (-976.837) (-978.905) (-975.179) * (-977.646) [-974.550] (-980.098) (-974.202) -- 0:00:49
181500 -- (-977.456) (-978.646) (-978.547) [-977.580] * (-975.190) [-975.247] (-976.177) (-974.991) -- 0:00:49
182000 -- [-976.613] (-975.749) (-975.300) (-977.269) * [-978.265] (-980.211) (-977.449) (-973.984) -- 0:00:49
182500 -- [-977.770] (-978.376) (-976.092) (-979.132) * (-977.507) (-975.662) (-975.498) [-975.381] -- 0:00:49
183000 -- [-975.750] (-974.742) (-976.638) (-974.543) * (-975.355) (-976.689) (-974.716) [-974.693] -- 0:00:49
183500 -- (-980.033) (-976.376) (-974.774) [-975.080] * (-974.876) [-976.283] (-974.772) (-975.163) -- 0:00:48
184000 -- [-977.488] (-980.405) (-977.499) (-975.409) * [-975.206] (-975.080) (-976.744) (-975.727) -- 0:00:48
184500 -- (-976.026) (-976.732) (-977.320) [-975.508] * (-975.647) (-974.939) (-976.179) [-976.047] -- 0:00:48
185000 -- [-976.478] (-978.066) (-978.568) (-974.747) * (-974.947) (-979.554) [-977.329] (-980.609) -- 0:00:48
Average standard deviation of split frequencies: 0.018882
185500 -- (-978.129) [-977.175] (-977.109) (-976.171) * (-975.979) [-980.160] (-976.064) (-977.637) -- 0:00:48
186000 -- (-975.858) (-976.296) [-974.778] (-978.165) * (-975.633) (-976.344) (-976.328) [-976.108] -- 0:00:48
186500 -- [-976.113] (-978.006) (-976.650) (-978.803) * (-976.510) (-975.764) [-976.886] (-975.879) -- 0:00:47
187000 -- (-974.051) (-978.935) [-975.403] (-977.114) * [-974.401] (-976.571) (-976.792) (-975.655) -- 0:00:47
187500 -- (-976.037) [-977.559] (-974.686) (-976.087) * (-974.790) [-977.020] (-975.580) (-978.953) -- 0:00:47
188000 -- (-980.128) (-980.887) (-976.236) [-974.955] * (-979.337) (-976.415) [-975.703] (-976.531) -- 0:00:47
188500 -- [-977.296] (-979.010) (-975.844) (-977.770) * (-978.668) (-976.472) (-975.043) [-974.394] -- 0:00:47
189000 -- [-974.561] (-975.655) (-981.277) (-975.852) * (-976.078) (-975.580) (-976.401) [-974.501] -- 0:00:51
189500 -- (-976.976) [-974.086] (-976.058) (-980.704) * (-975.955) (-979.093) [-976.146] (-981.133) -- 0:00:51
190000 -- (-978.127) [-975.701] (-975.159) (-978.741) * [-976.592] (-976.292) (-974.913) (-980.357) -- 0:00:51
Average standard deviation of split frequencies: 0.019649
190500 -- [-976.853] (-975.958) (-976.656) (-978.518) * (-976.954) [-976.873] (-976.214) (-977.399) -- 0:00:50
191000 -- (-976.900) (-979.193) [-975.197] (-974.612) * [-975.131] (-975.607) (-974.826) (-980.175) -- 0:00:50
191500 -- (-975.338) (-978.349) (-974.683) [-974.361] * [-976.649] (-977.100) (-976.781) (-979.520) -- 0:00:50
192000 -- (-976.374) [-978.460] (-974.654) (-976.458) * [-977.767] (-974.276) (-974.925) (-976.576) -- 0:00:50
192500 -- (-978.031) (-976.275) [-978.371] (-974.660) * (-979.080) (-974.579) [-975.028] (-978.271) -- 0:00:50
193000 -- (-978.725) (-975.715) (-974.324) [-976.915] * [-975.214] (-975.926) (-974.372) (-977.127) -- 0:00:50
193500 -- (-978.853) [-978.100] (-975.380) (-976.306) * (-975.571) (-975.136) [-975.873] (-976.833) -- 0:00:50
194000 -- (-979.398) (-978.713) [-974.294] (-975.389) * [-976.466] (-979.207) (-975.638) (-977.688) -- 0:00:49
194500 -- (-977.682) [-976.677] (-975.610) (-974.755) * (-977.080) (-976.917) (-975.682) [-976.023] -- 0:00:49
195000 -- [-974.410] (-977.247) (-976.893) (-974.535) * [-979.419] (-980.248) (-977.569) (-976.096) -- 0:00:49
Average standard deviation of split frequencies: 0.020310
195500 -- [-979.759] (-975.436) (-975.969) (-974.408) * (-981.660) (-976.978) (-979.236) [-975.860] -- 0:00:49
196000 -- (-978.596) (-983.727) [-976.742] (-976.218) * (-977.395) (-979.003) (-978.017) [-976.350] -- 0:00:49
196500 -- (-978.449) (-977.228) (-978.780) [-975.000] * (-977.008) [-977.519] (-982.635) (-974.726) -- 0:00:49
197000 -- (-982.896) [-976.573] (-976.650) (-975.902) * (-977.413) [-976.055] (-975.682) (-974.608) -- 0:00:48
197500 -- (-980.511) (-979.906) (-977.122) [-976.943] * (-978.148) [-977.154] (-975.683) (-975.278) -- 0:00:48
198000 -- [-977.404] (-978.074) (-976.772) (-978.229) * (-975.101) [-977.212] (-976.588) (-976.091) -- 0:00:48
198500 -- (-975.432) (-975.535) [-975.527] (-982.963) * (-974.834) (-976.649) (-976.028) [-977.613] -- 0:00:48
199000 -- (-975.760) [-976.807] (-975.268) (-976.633) * (-976.086) (-974.324) [-975.064] (-974.802) -- 0:00:48
199500 -- (-974.580) [-975.512] (-974.619) (-977.861) * (-974.914) [-974.805] (-974.483) (-980.128) -- 0:00:48
200000 -- [-977.636] (-975.895) (-976.407) (-978.310) * (-977.489) (-976.157) (-977.112) [-975.465] -- 0:00:48
Average standard deviation of split frequencies: 0.019055
200500 -- [-976.478] (-975.349) (-975.645) (-976.410) * (-976.991) (-975.791) [-974.907] (-974.524) -- 0:00:47
201000 -- (-976.139) [-975.938] (-975.619) (-976.178) * (-974.829) (-975.785) (-976.763) [-975.762] -- 0:00:47
201500 -- [-977.374] (-975.604) (-975.359) (-976.086) * (-976.718) (-974.882) [-979.598] (-974.837) -- 0:00:47
202000 -- (-976.935) (-975.445) [-977.215] (-975.410) * (-976.997) (-974.901) [-975.612] (-976.911) -- 0:00:47
202500 -- [-976.373] (-979.655) (-977.439) (-976.163) * (-975.571) [-974.368] (-975.566) (-975.823) -- 0:00:47
203000 -- (-974.855) (-981.290) (-977.282) [-974.173] * (-976.326) (-975.143) [-976.919] (-980.095) -- 0:00:47
203500 -- [-978.194] (-978.948) (-975.394) (-975.230) * (-976.224) [-974.556] (-976.339) (-980.747) -- 0:00:46
204000 -- [-980.388] (-979.599) (-976.078) (-974.755) * [-975.544] (-974.272) (-977.972) (-974.190) -- 0:00:46
204500 -- [-976.029] (-978.873) (-977.723) (-974.511) * [-975.233] (-978.253) (-978.535) (-973.989) -- 0:00:46
205000 -- (-977.900) [-976.308] (-976.669) (-974.332) * (-976.282) (-975.748) [-975.749] (-974.403) -- 0:00:46
Average standard deviation of split frequencies: 0.018180
205500 -- (-978.918) (-974.018) (-974.169) [-975.414] * [-974.229] (-975.320) (-974.708) (-977.001) -- 0:00:50
206000 -- (-976.081) [-974.408] (-978.731) (-974.295) * (-979.587) (-974.748) [-974.536] (-974.476) -- 0:00:50
206500 -- [-977.317] (-977.168) (-977.591) (-974.275) * (-977.443) (-978.933) [-974.201] (-974.706) -- 0:00:49
207000 -- (-976.596) (-976.184) (-978.255) [-974.327] * (-976.387) [-977.540] (-977.222) (-975.429) -- 0:00:49
207500 -- (-975.545) (-975.223) (-975.919) [-977.790] * (-977.547) [-977.609] (-979.263) (-975.599) -- 0:00:49
208000 -- (-974.119) [-978.327] (-978.392) (-977.780) * (-980.776) [-975.400] (-974.913) (-975.703) -- 0:00:49
208500 -- [-974.909] (-976.945) (-983.842) (-977.153) * (-978.496) (-976.135) [-976.222] (-976.989) -- 0:00:49
209000 -- (-975.233) (-975.364) [-975.730] (-974.499) * (-978.079) [-977.737] (-980.226) (-973.894) -- 0:00:49
209500 -- (-976.649) (-974.633) (-976.306) [-975.620] * [-975.962] (-977.950) (-976.723) (-974.063) -- 0:00:49
210000 -- (-976.453) (-975.075) [-974.711] (-975.354) * [-976.939] (-980.137) (-977.082) (-975.113) -- 0:00:48
Average standard deviation of split frequencies: 0.019580
210500 -- (-976.414) (-980.570) (-974.533) [-975.212] * (-975.742) (-979.803) (-978.731) [-975.652] -- 0:00:48
211000 -- (-978.676) (-976.291) [-976.224] (-974.988) * (-975.449) (-974.335) [-974.673] (-977.150) -- 0:00:48
211500 -- (-976.318) (-976.294) (-975.477) [-974.833] * (-975.249) (-977.247) [-975.496] (-975.910) -- 0:00:48
212000 -- (-975.668) (-978.852) [-975.610] (-975.325) * (-975.298) (-977.071) (-976.104) [-977.860] -- 0:00:48
212500 -- (-975.256) (-979.158) [-976.085] (-975.477) * (-974.146) [-975.403] (-975.899) (-978.182) -- 0:00:48
213000 -- [-975.407] (-976.363) (-976.237) (-974.168) * (-975.111) [-974.625] (-974.359) (-976.168) -- 0:00:48
213500 -- (-975.024) (-977.871) [-976.398] (-976.944) * [-976.486] (-975.938) (-977.661) (-974.189) -- 0:00:47
214000 -- [-975.523] (-976.703) (-982.700) (-975.905) * (-975.365) [-975.194] (-974.854) (-977.857) -- 0:00:47
214500 -- (-976.174) (-977.256) (-978.716) [-974.706] * [-975.064] (-982.047) (-974.809) (-976.088) -- 0:00:47
215000 -- [-976.982] (-977.221) (-976.451) (-976.799) * [-974.852] (-977.978) (-976.368) (-983.147) -- 0:00:47
Average standard deviation of split frequencies: 0.018914
215500 -- (-974.074) [-979.120] (-975.110) (-975.314) * (-975.541) (-976.595) [-977.081] (-977.499) -- 0:00:47
216000 -- (-974.934) (-977.151) [-974.751] (-976.026) * (-978.790) (-977.149) [-976.322] (-977.241) -- 0:00:47
216500 -- [-974.337] (-976.118) (-976.282) (-976.414) * (-980.404) (-974.887) [-975.851] (-977.955) -- 0:00:47
217000 -- (-981.129) (-977.681) [-974.363] (-977.524) * (-978.142) (-976.462) (-976.508) [-976.643] -- 0:00:46
217500 -- (-976.541) [-975.412] (-977.304) (-979.179) * (-978.420) (-979.868) (-980.773) [-976.140] -- 0:00:46
218000 -- (-977.569) [-975.627] (-977.010) (-977.757) * (-977.355) [-977.184] (-973.975) (-975.648) -- 0:00:46
218500 -- [-974.258] (-976.514) (-973.946) (-978.243) * [-975.709] (-976.150) (-977.448) (-979.633) -- 0:00:46
219000 -- (-975.744) (-976.093) [-974.127] (-978.403) * (-976.479) [-976.159] (-975.497) (-978.772) -- 0:00:46
219500 -- (-975.804) (-980.344) [-974.559] (-978.515) * [-974.317] (-976.750) (-977.332) (-976.627) -- 0:00:46
220000 -- (-974.342) [-984.119] (-975.898) (-973.905) * [-974.490] (-975.299) (-976.454) (-979.308) -- 0:00:46
Average standard deviation of split frequencies: 0.019352
220500 -- (-974.009) (-977.536) [-977.312] (-978.637) * (-975.231) (-976.721) [-975.145] (-975.904) -- 0:00:45
221000 -- (-974.299) [-974.150] (-977.665) (-976.033) * (-975.291) [-977.424] (-976.604) (-975.503) -- 0:00:45
221500 -- [-976.127] (-980.143) (-977.544) (-976.450) * (-977.951) [-975.304] (-984.891) (-976.668) -- 0:00:49
222000 -- (-975.820) (-982.250) [-976.751] (-976.281) * (-976.900) (-978.252) [-978.227] (-975.816) -- 0:00:49
222500 -- (-979.564) (-975.298) [-975.730] (-975.019) * (-976.914) (-978.434) (-975.407) [-975.277] -- 0:00:48
223000 -- (-975.332) (-975.020) [-976.408] (-975.364) * (-974.463) (-980.212) (-977.452) [-974.159] -- 0:00:48
223500 -- (-974.678) (-975.739) [-976.588] (-974.716) * (-975.445) [-978.774] (-977.802) (-977.363) -- 0:00:48
224000 -- (-975.031) [-974.813] (-976.125) (-973.895) * (-975.757) (-976.486) [-976.158] (-975.607) -- 0:00:48
224500 -- (-976.089) [-975.068] (-976.834) (-974.950) * (-976.058) (-975.454) (-976.216) [-976.766] -- 0:00:48
225000 -- (-974.220) [-977.927] (-976.715) (-974.734) * [-974.372] (-976.010) (-976.069) (-978.007) -- 0:00:48
Average standard deviation of split frequencies: 0.018992
225500 -- (-974.745) [-975.173] (-975.514) (-977.340) * (-974.675) (-976.355) (-977.096) [-978.111] -- 0:00:48
226000 -- (-976.936) (-975.772) [-974.384] (-979.414) * (-974.849) [-976.249] (-978.407) (-976.440) -- 0:00:47
226500 -- (-976.275) [-974.993] (-976.477) (-977.596) * [-975.690] (-978.401) (-976.420) (-975.324) -- 0:00:47
227000 -- (-978.048) (-975.233) [-975.740] (-975.702) * (-975.662) (-977.588) [-977.892] (-974.313) -- 0:00:47
227500 -- (-975.163) (-975.835) [-974.129] (-975.996) * (-978.290) (-977.405) (-975.609) [-974.916] -- 0:00:47
228000 -- (-974.822) [-976.541] (-974.178) (-976.796) * (-977.622) [-976.542] (-975.149) (-976.112) -- 0:00:47
228500 -- (-976.445) (-975.873) (-974.170) [-978.494] * (-975.145) (-976.254) (-977.142) [-975.845] -- 0:00:47
229000 -- (-976.263) (-974.786) [-973.990] (-976.379) * (-975.978) (-978.390) (-977.017) [-974.265] -- 0:00:47
229500 -- (-975.968) [-974.405] (-976.358) (-975.561) * (-978.240) (-978.756) [-978.783] (-975.860) -- 0:00:47
230000 -- [-974.897] (-975.991) (-975.488) (-978.762) * [-974.008] (-979.358) (-976.217) (-975.407) -- 0:00:46
Average standard deviation of split frequencies: 0.017551
230500 -- (-974.873) (-977.235) [-977.112] (-975.741) * (-975.501) (-978.274) (-974.487) [-975.517] -- 0:00:46
231000 -- (-977.186) (-978.638) (-976.686) [-978.006] * (-975.260) [-979.429] (-977.752) (-976.353) -- 0:00:46
231500 -- (-974.278) [-976.387] (-975.365) (-975.471) * (-974.736) [-975.832] (-976.007) (-975.045) -- 0:00:46
232000 -- (-974.261) (-981.421) (-977.887) [-976.551] * (-976.816) (-975.738) [-977.301] (-976.896) -- 0:00:46
232500 -- (-975.593) (-977.795) [-975.002] (-977.853) * (-976.067) (-977.251) [-977.043] (-981.027) -- 0:00:46
233000 -- (-976.074) (-975.749) (-979.105) [-979.546] * (-976.959) [-976.370] (-976.630) (-978.574) -- 0:00:46
233500 -- (-975.399) (-977.172) [-977.660] (-978.033) * (-975.163) [-975.052] (-975.016) (-975.912) -- 0:00:45
234000 -- (-976.310) (-977.005) (-976.278) [-977.738] * (-976.789) [-975.022] (-975.472) (-975.684) -- 0:00:45
234500 -- (-980.372) (-976.809) [-974.929] (-976.457) * (-975.307) (-977.833) (-978.576) [-974.965] -- 0:00:45
235000 -- [-976.328] (-978.062) (-975.291) (-974.281) * (-976.118) [-974.247] (-977.465) (-976.191) -- 0:00:45
Average standard deviation of split frequencies: 0.017155
235500 -- [-975.028] (-978.011) (-976.081) (-975.268) * [-975.044] (-975.060) (-983.455) (-975.728) -- 0:00:45
236000 -- (-975.099) (-978.410) (-976.184) [-976.014] * (-979.431) (-975.075) (-979.455) [-975.523] -- 0:00:45
236500 -- (-976.917) (-974.638) (-977.018) [-977.817] * [-980.406] (-974.129) (-977.695) (-977.187) -- 0:00:45
237000 -- [-976.445] (-975.586) (-975.424) (-976.301) * (-976.606) (-974.372) [-975.678] (-976.126) -- 0:00:45
237500 -- (-975.147) (-975.586) (-977.493) [-975.773] * [-976.395] (-975.531) (-974.726) (-978.151) -- 0:00:44
238000 -- (-977.641) (-975.907) (-982.754) [-974.486] * (-975.069) (-975.109) [-975.741] (-975.841) -- 0:00:48
238500 -- (-980.645) [-974.626] (-979.428) (-975.345) * [-974.979] (-975.155) (-976.054) (-976.459) -- 0:00:47
239000 -- (-978.170) (-976.649) (-978.780) [-975.349] * (-975.070) [-975.557] (-976.997) (-975.198) -- 0:00:47
239500 -- (-976.571) [-976.972] (-974.980) (-975.112) * (-975.238) (-975.222) [-975.226] (-979.897) -- 0:00:47
240000 -- (-976.718) (-975.934) (-977.062) [-974.660] * [-974.882] (-976.533) (-974.311) (-979.633) -- 0:00:47
Average standard deviation of split frequencies: 0.017955
240500 -- (-975.568) (-976.166) [-977.865] (-974.163) * (-974.414) (-975.197) (-975.037) [-976.845] -- 0:00:47
241000 -- [-976.317] (-980.174) (-977.818) (-977.460) * (-975.647) [-977.592] (-978.025) (-976.598) -- 0:00:47
241500 -- (-975.003) (-978.632) (-975.697) [-974.458] * (-976.252) (-978.167) (-976.285) [-977.195] -- 0:00:47
242000 -- [-979.231] (-976.448) (-975.579) (-981.635) * [-975.283] (-975.306) (-978.228) (-974.548) -- 0:00:46
242500 -- (-975.605) (-977.632) [-976.840] (-975.126) * (-977.167) (-978.042) (-979.038) [-974.537] -- 0:00:46
243000 -- (-976.546) (-975.402) [-974.787] (-975.873) * (-975.324) (-976.561) [-974.497] (-974.179) -- 0:00:46
243500 -- (-981.776) (-982.584) (-975.295) [-976.155] * (-974.334) (-975.918) [-975.218] (-974.167) -- 0:00:46
244000 -- (-977.200) [-981.572] (-975.226) (-975.929) * (-976.289) (-974.989) [-976.946] (-974.218) -- 0:00:46
244500 -- (-976.150) (-976.408) (-977.841) [-976.171] * [-978.596] (-973.892) (-978.753) (-975.324) -- 0:00:46
245000 -- (-978.353) (-975.938) (-976.424) [-974.484] * (-976.826) [-974.445] (-977.230) (-973.868) -- 0:00:46
Average standard deviation of split frequencies: 0.018098
245500 -- (-977.282) (-977.510) (-975.504) [-974.563] * (-976.401) (-976.188) (-977.521) [-977.406] -- 0:00:46
246000 -- (-977.060) (-979.855) (-976.291) [-975.581] * [-977.568] (-981.142) (-976.368) (-975.595) -- 0:00:45
246500 -- (-974.858) (-976.935) [-977.575] (-974.795) * (-974.829) (-979.334) [-976.692] (-980.387) -- 0:00:45
247000 -- (-977.007) [-976.029] (-977.844) (-976.201) * (-975.886) [-975.419] (-977.839) (-977.016) -- 0:00:45
247500 -- (-976.363) (-981.454) (-977.506) [-975.813] * (-974.907) (-975.088) [-975.909] (-974.025) -- 0:00:45
248000 -- (-979.940) [-976.857] (-975.971) (-975.693) * (-976.040) (-977.385) [-974.495] (-977.370) -- 0:00:45
248500 -- (-975.829) (-976.375) (-977.145) [-977.658] * (-979.777) (-975.838) [-974.507] (-979.043) -- 0:00:45
249000 -- (-978.249) (-980.476) (-976.053) [-978.038] * (-977.071) [-977.766] (-974.943) (-978.039) -- 0:00:45
249500 -- [-976.131] (-976.836) (-977.526) (-974.209) * (-979.651) (-978.394) (-977.165) [-975.379] -- 0:00:45
250000 -- [-976.267] (-975.584) (-974.631) (-976.158) * (-977.520) (-975.431) (-977.474) [-975.354] -- 0:00:45
Average standard deviation of split frequencies: 0.018917
250500 -- (-979.009) (-976.136) (-974.786) [-978.638] * (-976.547) (-976.406) [-979.021] (-975.171) -- 0:00:44
251000 -- (-975.290) (-974.789) [-974.696] (-978.338) * (-976.380) (-978.118) [-976.688] (-974.328) -- 0:00:44
251500 -- (-977.282) (-975.872) (-978.265) [-977.762] * (-976.738) (-974.907) (-977.289) [-974.229] -- 0:00:44
252000 -- (-975.474) (-975.132) [-977.418] (-977.337) * (-977.120) (-975.494) (-977.900) [-973.955] -- 0:00:44
252500 -- (-975.238) (-975.974) (-974.815) [-974.063] * (-982.637) [-975.424] (-976.121) (-975.259) -- 0:00:44
253000 -- (-975.412) (-976.235) (-974.950) [-973.845] * [-980.056] (-975.739) (-976.198) (-979.270) -- 0:00:44
253500 -- (-975.764) (-976.210) [-976.822] (-975.802) * (-979.843) (-975.680) [-975.280] (-975.490) -- 0:00:44
254000 -- [-976.247] (-975.515) (-975.790) (-975.611) * (-978.865) [-975.854] (-974.993) (-979.361) -- 0:00:46
254500 -- (-978.927) (-976.758) [-974.795] (-976.363) * (-978.327) (-975.586) (-976.332) [-976.622] -- 0:00:46
255000 -- (-982.796) (-979.219) [-977.609] (-978.384) * (-975.505) [-976.293] (-975.918) (-976.798) -- 0:00:46
Average standard deviation of split frequencies: 0.019172
255500 -- (-974.929) [-975.805] (-975.886) (-980.966) * [-975.831] (-975.051) (-974.130) (-976.091) -- 0:00:46
256000 -- (-977.075) (-978.450) [-976.346] (-974.418) * (-975.275) (-975.327) (-975.190) [-976.400] -- 0:00:46
256500 -- [-980.819] (-975.494) (-981.337) (-974.727) * (-977.350) [-974.659] (-974.776) (-975.368) -- 0:00:46
257000 -- (-975.579) (-976.818) [-974.855] (-975.031) * [-981.745] (-975.070) (-974.448) (-975.662) -- 0:00:46
257500 -- (-977.991) (-976.380) (-974.521) [-975.772] * (-974.981) [-977.776] (-979.599) (-975.979) -- 0:00:46
258000 -- [-975.754] (-976.859) (-976.861) (-979.020) * [-974.980] (-975.603) (-975.853) (-975.360) -- 0:00:46
258500 -- (-975.412) (-977.206) (-976.473) [-977.099] * (-974.801) (-975.964) (-976.648) [-975.479] -- 0:00:45
259000 -- (-974.753) (-979.774) (-976.949) [-976.053] * (-979.011) (-977.584) [-974.724] (-977.365) -- 0:00:45
259500 -- (-978.763) (-976.711) (-976.567) [-980.128] * (-976.452) [-976.678] (-974.563) (-979.730) -- 0:00:45
260000 -- (-976.034) (-976.229) [-976.311] (-978.399) * (-975.665) (-975.121) [-976.319] (-977.367) -- 0:00:45
Average standard deviation of split frequencies: 0.018085
260500 -- (-975.586) (-978.223) (-977.826) [-975.068] * [-974.432] (-975.979) (-977.498) (-973.814) -- 0:00:45
261000 -- (-977.506) (-974.299) [-976.910] (-975.078) * (-974.678) (-975.621) [-976.077] (-974.209) -- 0:00:45
261500 -- [-975.827] (-976.797) (-977.163) (-977.783) * (-975.254) (-976.708) [-974.730] (-978.950) -- 0:00:45
262000 -- (-975.175) (-975.708) (-975.009) [-983.207] * (-978.101) (-976.102) [-975.347] (-979.172) -- 0:00:45
262500 -- [-976.439] (-975.703) (-975.039) (-978.266) * (-976.435) (-977.305) [-975.126] (-979.322) -- 0:00:44
263000 -- (-977.369) [-975.699] (-976.178) (-975.485) * (-978.772) (-979.342) [-976.202] (-977.158) -- 0:00:44
263500 -- (-977.289) [-978.077] (-976.465) (-975.975) * [-975.285] (-979.888) (-975.110) (-975.243) -- 0:00:44
264000 -- [-976.113] (-979.071) (-975.031) (-974.537) * (-975.277) (-977.149) [-978.470] (-977.007) -- 0:00:44
264500 -- (-980.822) (-979.950) [-976.395] (-973.899) * (-976.635) (-975.458) (-976.310) [-976.131] -- 0:00:44
265000 -- (-977.767) (-976.145) (-975.196) [-973.899] * (-975.232) [-977.245] (-975.683) (-977.003) -- 0:00:44
Average standard deviation of split frequencies: 0.017305
265500 -- (-974.849) (-976.161) [-975.078] (-976.888) * (-974.571) [-974.549] (-978.105) (-977.578) -- 0:00:44
266000 -- [-974.734] (-975.292) (-975.768) (-976.281) * (-975.143) (-974.720) [-975.454] (-975.473) -- 0:00:44
266500 -- (-976.705) (-978.805) (-979.012) [-975.696] * (-975.411) (-979.977) (-975.162) [-976.426] -- 0:00:44
267000 -- (-975.859) [-974.861] (-975.163) (-978.822) * (-975.121) (-978.174) [-976.007] (-979.027) -- 0:00:43
267500 -- (-974.119) [-975.296] (-979.045) (-975.354) * (-975.629) [-976.909] (-977.835) (-976.381) -- 0:00:43
268000 -- [-974.123] (-977.701) (-983.871) (-976.704) * (-976.809) [-978.575] (-977.128) (-976.731) -- 0:00:43
268500 -- [-976.842] (-977.982) (-979.956) (-976.055) * [-977.583] (-976.648) (-974.178) (-976.252) -- 0:00:43
269000 -- (-976.516) (-974.514) (-978.073) [-975.706] * (-979.993) (-976.936) [-975.484] (-976.247) -- 0:00:43
269500 -- (-978.558) (-976.878) [-978.072] (-975.176) * (-978.978) (-977.711) [-975.694] (-976.519) -- 0:00:43
270000 -- [-978.148] (-975.965) (-977.307) (-975.511) * (-980.129) (-978.574) (-975.309) [-975.678] -- 0:00:43
Average standard deviation of split frequencies: 0.015880
270500 -- (-979.243) (-974.434) [-974.958] (-974.772) * (-978.805) (-977.500) [-975.252] (-976.686) -- 0:00:45
271000 -- [-975.522] (-974.352) (-977.327) (-978.130) * (-976.203) [-975.034] (-975.812) (-975.854) -- 0:00:45
271500 -- [-975.003] (-979.835) (-978.176) (-977.313) * (-984.207) (-974.085) (-978.439) [-975.097] -- 0:00:45
272000 -- (-975.417) [-980.656] (-975.215) (-975.672) * (-975.989) (-978.724) [-975.813] (-977.825) -- 0:00:45
272500 -- (-975.288) (-975.261) (-974.708) [-975.849] * [-975.297] (-975.437) (-980.033) (-975.517) -- 0:00:45
273000 -- (-980.884) (-977.906) (-975.680) [-977.012] * [-975.505] (-978.837) (-974.597) (-976.557) -- 0:00:45
273500 -- (-979.737) (-977.649) (-980.208) [-977.150] * (-977.296) (-976.072) [-974.154] (-980.280) -- 0:00:45
274000 -- (-974.719) [-975.904] (-976.640) (-974.489) * (-975.669) (-975.956) (-975.950) [-974.846] -- 0:00:45
274500 -- (-976.507) (-975.940) [-976.346] (-974.302) * (-975.092) (-976.890) (-975.631) [-977.009] -- 0:00:44
275000 -- (-977.610) (-976.907) (-977.632) [-975.835] * (-974.568) (-975.013) [-975.068] (-976.536) -- 0:00:44
Average standard deviation of split frequencies: 0.015874
275500 -- (-975.490) (-977.328) (-978.752) [-976.333] * (-977.286) (-978.450) (-976.199) [-974.207] -- 0:00:44
276000 -- [-977.485] (-977.772) (-976.715) (-978.538) * (-975.266) [-976.307] (-976.265) (-974.873) -- 0:00:44
276500 -- (-977.546) (-976.247) [-976.506] (-976.220) * [-978.797] (-975.822) (-977.144) (-974.771) -- 0:00:44
277000 -- [-976.194] (-976.407) (-980.573) (-975.995) * (-976.207) (-975.805) [-975.421] (-974.698) -- 0:00:44
277500 -- (-976.574) (-977.464) (-975.427) [-976.063] * [-976.080] (-977.412) (-976.199) (-977.591) -- 0:00:44
278000 -- (-978.289) (-974.897) (-975.228) [-977.658] * [-979.269] (-976.865) (-976.936) (-975.541) -- 0:00:44
278500 -- [-974.953] (-974.128) (-974.530) (-977.001) * (-976.016) [-976.647] (-975.751) (-975.799) -- 0:00:44
279000 -- (-979.000) [-977.462] (-975.115) (-977.057) * (-975.905) [-977.608] (-977.428) (-978.978) -- 0:00:43
279500 -- (-978.461) (-974.798) [-976.160] (-978.082) * [-976.725] (-975.995) (-976.524) (-976.868) -- 0:00:43
280000 -- (-976.231) (-974.465) (-978.071) [-977.998] * (-974.217) [-974.932] (-976.590) (-978.059) -- 0:00:43
Average standard deviation of split frequencies: 0.014128
280500 -- [-975.041] (-974.476) (-979.027) (-976.446) * [-975.992] (-975.131) (-974.333) (-974.780) -- 0:00:43
281000 -- (-982.435) (-977.900) (-978.902) [-978.818] * (-974.821) (-978.557) [-974.404] (-976.686) -- 0:00:43
281500 -- (-977.534) (-978.541) (-980.501) [-974.694] * (-974.604) [-976.161] (-976.628) (-975.179) -- 0:00:43
282000 -- (-977.802) (-976.570) (-974.557) [-976.399] * (-976.981) [-974.503] (-975.839) (-976.924) -- 0:00:43
282500 -- (-975.301) (-975.533) [-979.011] (-977.153) * (-977.455) (-975.210) [-976.308] (-973.946) -- 0:00:43
283000 -- (-977.770) (-978.500) [-974.620] (-977.411) * (-974.663) [-977.362] (-977.270) (-974.896) -- 0:00:43
283500 -- (-977.339) [-978.336] (-976.463) (-974.526) * (-978.885) (-976.102) (-977.516) [-975.169] -- 0:00:42
284000 -- (-977.983) [-974.176] (-977.333) (-975.599) * (-978.041) [-974.846] (-975.466) (-974.584) -- 0:00:42
284500 -- (-974.901) (-977.419) [-976.370] (-975.197) * (-976.543) [-975.005] (-975.860) (-974.906) -- 0:00:42
285000 -- (-974.567) [-977.192] (-976.151) (-976.283) * (-973.953) [-976.986] (-983.851) (-975.552) -- 0:00:42
Average standard deviation of split frequencies: 0.015319
285500 -- (-974.640) (-978.936) (-975.829) [-976.821] * (-975.354) [-976.019] (-977.049) (-976.025) -- 0:00:42
286000 -- (-974.125) [-975.615] (-978.344) (-975.909) * (-974.788) [-976.183] (-978.383) (-978.321) -- 0:00:42
286500 -- [-974.988] (-979.062) (-978.479) (-975.180) * (-980.561) [-975.899] (-976.706) (-978.493) -- 0:00:42
287000 -- (-975.401) (-978.263) [-975.415] (-978.144) * (-976.036) (-978.163) [-979.005] (-975.648) -- 0:00:44
287500 -- (-974.332) (-976.723) (-975.445) [-975.757] * (-983.046) (-982.708) [-976.416] (-978.234) -- 0:00:44
288000 -- (-974.895) (-974.055) [-974.480] (-978.144) * [-977.137] (-978.436) (-977.998) (-976.252) -- 0:00:44
288500 -- [-974.786] (-974.692) (-974.437) (-976.757) * (-979.551) (-974.676) (-977.884) [-975.600] -- 0:00:44
289000 -- (-975.024) (-976.474) (-978.282) [-978.418] * (-975.866) (-975.136) [-975.542] (-975.405) -- 0:00:44
289500 -- [-978.044] (-974.617) (-974.311) (-977.693) * (-975.014) (-974.627) (-976.715) [-974.545] -- 0:00:44
290000 -- (-977.253) (-976.276) (-975.356) [-977.678] * (-975.245) (-974.359) [-975.394] (-975.667) -- 0:00:44
Average standard deviation of split frequencies: 0.014405
290500 -- (-974.222) (-975.880) [-976.699] (-976.906) * [-975.675] (-975.607) (-975.801) (-974.862) -- 0:00:43
291000 -- [-975.506] (-976.872) (-975.262) (-976.785) * (-978.218) (-975.625) [-975.748] (-975.772) -- 0:00:43
291500 -- (-974.655) (-977.173) [-975.520] (-975.625) * (-976.381) [-974.678] (-974.550) (-975.772) -- 0:00:43
292000 -- (-976.994) [-977.107] (-976.387) (-974.844) * (-978.222) (-975.487) (-974.498) [-976.644] -- 0:00:43
292500 -- (-982.807) (-974.471) [-974.689] (-975.471) * (-974.335) (-977.480) [-975.567] (-976.315) -- 0:00:43
293000 -- (-981.059) (-974.582) (-975.684) [-978.208] * (-975.934) [-975.156] (-977.997) (-974.805) -- 0:00:43
293500 -- (-975.017) (-974.205) [-978.621] (-979.436) * (-974.994) (-975.490) [-978.456] (-976.189) -- 0:00:43
294000 -- (-974.782) (-974.466) [-976.642] (-977.975) * (-976.439) (-974.386) [-979.489] (-978.050) -- 0:00:43
294500 -- (-976.994) (-974.800) (-978.366) [-978.241] * [-975.336] (-981.047) (-974.816) (-981.466) -- 0:00:43
295000 -- (-976.107) (-976.112) (-979.020) [-974.375] * [-974.388] (-978.633) (-977.718) (-976.621) -- 0:00:43
Average standard deviation of split frequencies: 0.014333
295500 -- (-974.828) [-975.614] (-974.886) (-976.266) * [-974.714] (-976.199) (-978.618) (-975.813) -- 0:00:42
296000 -- (-976.750) (-977.057) (-974.743) [-976.114] * (-974.819) [-978.244] (-975.569) (-974.708) -- 0:00:42
296500 -- (-979.920) (-976.402) [-974.932] (-977.244) * (-976.056) [-977.322] (-974.750) (-975.970) -- 0:00:42
297000 -- (-977.294) (-978.300) [-975.392] (-975.110) * [-979.002] (-976.675) (-977.919) (-978.368) -- 0:00:42
297500 -- (-975.271) [-975.026] (-975.844) (-974.833) * (-977.471) [-974.852] (-976.545) (-976.549) -- 0:00:42
298000 -- (-974.770) (-976.779) (-979.867) [-975.364] * (-976.776) (-975.147) [-974.544] (-976.233) -- 0:00:42
298500 -- (-979.353) (-974.469) [-977.381] (-975.648) * [-974.731] (-974.229) (-977.890) (-975.896) -- 0:00:42
299000 -- (-976.982) [-974.947] (-975.472) (-974.784) * [-974.671] (-976.486) (-976.439) (-975.493) -- 0:00:42
299500 -- [-974.652] (-974.948) (-974.242) (-974.867) * (-975.934) (-976.118) [-978.136] (-976.196) -- 0:00:42
300000 -- [-974.510] (-974.655) (-976.231) (-976.844) * (-975.684) [-975.748] (-976.021) (-974.660) -- 0:00:42
Average standard deviation of split frequencies: 0.013557
300500 -- (-974.563) (-977.408) [-977.507] (-976.452) * (-975.760) [-975.751] (-977.785) (-974.968) -- 0:00:41
301000 -- (-974.664) [-977.673] (-980.764) (-974.427) * (-976.152) (-976.682) [-975.571] (-975.770) -- 0:00:41
301500 -- (-976.018) (-975.936) (-975.561) [-974.816] * (-976.210) [-975.777] (-976.528) (-977.960) -- 0:00:41
302000 -- [-975.558] (-975.923) (-974.612) (-974.924) * (-977.072) [-974.580] (-977.341) (-978.677) -- 0:00:41
302500 -- (-974.840) (-975.971) [-977.764] (-974.328) * [-975.559] (-975.104) (-975.237) (-975.830) -- 0:00:41
303000 -- (-979.311) (-977.238) (-977.462) [-976.168] * (-973.862) (-976.045) [-974.367] (-976.297) -- 0:00:43
303500 -- (-978.269) [-978.140] (-976.846) (-975.724) * [-976.159] (-977.102) (-974.514) (-975.019) -- 0:00:43
304000 -- (-975.930) (-974.691) (-977.070) [-974.599] * (-975.556) (-979.023) [-974.137] (-976.998) -- 0:00:43
304500 -- (-978.312) [-975.072] (-978.069) (-975.968) * (-976.119) (-974.780) (-976.358) [-979.122] -- 0:00:43
305000 -- [-976.145] (-976.454) (-979.238) (-974.920) * [-974.673] (-978.262) (-976.225) (-975.636) -- 0:00:43
Average standard deviation of split frequencies: 0.012777
305500 -- (-974.652) [-976.175] (-974.948) (-975.525) * [-974.840] (-982.246) (-974.108) (-974.255) -- 0:00:43
306000 -- (-974.896) (-974.684) (-975.031) [-976.319] * (-978.202) (-983.436) (-974.260) [-975.124] -- 0:00:43
306500 -- (-973.972) [-975.361] (-976.528) (-974.253) * (-981.558) [-976.474] (-973.930) (-976.531) -- 0:00:42
307000 -- (-974.638) (-975.574) [-977.324] (-981.768) * (-975.306) [-976.209] (-974.114) (-976.326) -- 0:00:42
307500 -- [-977.421] (-974.680) (-980.669) (-978.705) * (-975.569) (-976.177) (-975.308) [-975.801] -- 0:00:42
308000 -- (-974.303) [-979.614] (-982.763) (-976.433) * (-975.163) [-977.273] (-975.316) (-976.075) -- 0:00:42
308500 -- [-974.170] (-975.413) (-974.445) (-976.125) * (-976.076) [-975.845] (-975.422) (-977.744) -- 0:00:42
309000 -- (-974.081) [-975.059] (-977.848) (-978.255) * (-975.868) (-981.395) [-976.205] (-975.833) -- 0:00:42
309500 -- (-975.068) [-977.579] (-975.574) (-984.608) * (-975.379) (-980.853) (-981.511) [-977.521] -- 0:00:42
310000 -- (-974.804) (-975.360) [-979.409] (-982.270) * (-975.707) (-981.329) (-979.409) [-975.446] -- 0:00:42
Average standard deviation of split frequencies: 0.011961
310500 -- [-977.339] (-973.966) (-978.595) (-976.239) * [-975.867] (-976.661) (-977.538) (-974.982) -- 0:00:42
311000 -- (-975.649) [-981.532] (-976.677) (-974.294) * [-975.699] (-976.690) (-978.113) (-976.644) -- 0:00:42
311500 -- (-974.625) (-977.374) [-979.080] (-976.638) * (-979.948) [-978.192] (-978.150) (-979.378) -- 0:00:41
312000 -- [-976.900] (-977.048) (-983.290) (-975.234) * (-979.841) [-978.074] (-978.256) (-976.326) -- 0:00:41
312500 -- (-974.955) (-973.888) (-978.449) [-975.458] * (-975.963) (-980.143) [-976.550] (-977.379) -- 0:00:41
313000 -- (-974.402) (-974.476) (-976.882) [-974.386] * (-974.606) (-974.509) [-977.492] (-975.966) -- 0:00:41
313500 -- (-974.048) (-975.115) [-977.291] (-975.471) * (-979.175) [-974.839] (-978.038) (-974.962) -- 0:00:41
314000 -- (-974.016) [-976.089] (-974.300) (-976.784) * (-978.517) (-977.382) [-975.721] (-975.859) -- 0:00:41
314500 -- (-975.629) (-976.983) [-979.695] (-976.719) * (-976.431) (-975.073) [-975.122] (-978.870) -- 0:00:41
315000 -- (-977.396) [-975.706] (-975.577) (-978.142) * [-975.323] (-975.850) (-975.121) (-980.087) -- 0:00:41
Average standard deviation of split frequencies: 0.011145
315500 -- (-974.324) (-978.190) [-976.695] (-976.019) * (-975.434) (-976.505) (-975.047) [-978.906] -- 0:00:41
316000 -- (-975.298) [-977.995] (-976.046) (-975.715) * (-977.212) (-979.704) (-974.801) [-977.205] -- 0:00:41
316500 -- (-975.813) [-974.674] (-976.681) (-977.072) * [-975.325] (-982.031) (-976.806) (-975.483) -- 0:00:41
317000 -- (-975.869) (-975.066) [-974.665] (-977.264) * (-977.927) [-979.176] (-977.476) (-975.601) -- 0:00:40
317500 -- [-974.763] (-977.599) (-975.781) (-977.258) * (-976.627) (-978.792) (-980.066) [-976.627] -- 0:00:40
318000 -- (-978.773) (-976.855) (-975.380) [-976.389] * [-976.260] (-974.367) (-977.669) (-976.816) -- 0:00:40
318500 -- (-978.073) (-976.837) [-974.440] (-978.571) * (-976.827) [-976.014] (-975.262) (-977.959) -- 0:00:40
319000 -- (-975.627) (-976.117) (-973.871) [-974.896] * [-977.349] (-976.011) (-974.880) (-977.623) -- 0:00:40
319500 -- (-977.928) [-975.930] (-974.518) (-974.664) * [-975.558] (-974.563) (-975.581) (-974.628) -- 0:00:40
320000 -- (-981.645) [-974.842] (-975.499) (-976.348) * (-975.802) [-975.258] (-976.157) (-975.185) -- 0:00:42
Average standard deviation of split frequencies: 0.011852
320500 -- [-975.483] (-978.824) (-975.635) (-974.090) * (-978.703) (-977.851) [-975.476] (-976.218) -- 0:00:42
321000 -- (-977.727) (-976.529) (-974.585) [-974.109] * [-976.334] (-977.468) (-980.910) (-975.332) -- 0:00:42
321500 -- [-976.960] (-975.931) (-978.747) (-976.702) * [-978.680] (-980.295) (-979.789) (-976.408) -- 0:00:42
322000 -- (-976.699) (-974.166) (-979.613) [-978.837] * (-974.902) (-975.776) [-977.920] (-974.360) -- 0:00:42
322500 -- [-974.830] (-975.568) (-977.661) (-977.865) * (-976.705) (-974.504) (-975.088) [-974.217] -- 0:00:42
323000 -- [-974.834] (-977.551) (-977.038) (-976.230) * (-976.091) [-976.260] (-975.594) (-974.433) -- 0:00:41
323500 -- (-976.813) [-979.913] (-974.239) (-975.453) * (-976.610) [-976.277] (-978.289) (-977.864) -- 0:00:41
324000 -- (-976.356) (-976.287) (-977.637) [-975.155] * (-974.852) [-976.134] (-974.880) (-979.323) -- 0:00:41
324500 -- (-976.152) (-976.351) [-974.576] (-975.092) * (-976.482) [-975.999] (-976.067) (-979.939) -- 0:00:41
325000 -- [-978.189] (-977.304) (-975.507) (-978.779) * (-976.157) (-974.840) [-976.130] (-976.392) -- 0:00:41
Average standard deviation of split frequencies: 0.011297
325500 -- (-977.777) [-975.734] (-975.071) (-979.894) * (-975.894) (-979.050) [-974.567] (-977.722) -- 0:00:41
326000 -- (-974.902) (-975.441) [-975.879] (-978.111) * (-978.419) (-976.359) [-974.730] (-977.164) -- 0:00:41
326500 -- [-974.820] (-975.435) (-976.021) (-975.792) * (-980.251) (-974.854) (-975.642) [-974.954] -- 0:00:41
327000 -- (-980.867) (-978.558) [-975.717] (-978.468) * (-977.619) (-977.042) (-975.046) [-979.326] -- 0:00:41
327500 -- [-977.491] (-976.134) (-979.699) (-977.352) * (-980.379) [-974.710] (-975.715) (-977.411) -- 0:00:41
328000 -- [-975.053] (-977.708) (-979.980) (-975.381) * (-976.357) (-976.266) [-974.373] (-977.009) -- 0:00:40
328500 -- (-978.605) (-975.066) (-976.920) [-977.319] * (-978.579) [-976.653] (-978.891) (-979.563) -- 0:00:40
329000 -- (-977.681) (-976.550) [-977.833] (-979.699) * (-980.331) (-978.505) [-983.232] (-978.570) -- 0:00:40
329500 -- (-976.524) (-978.478) [-977.835] (-976.728) * (-975.186) (-977.490) [-978.234] (-974.621) -- 0:00:40
330000 -- (-976.623) (-976.691) [-977.040] (-975.563) * [-974.137] (-979.943) (-974.742) (-976.874) -- 0:00:40
Average standard deviation of split frequencies: 0.010818
330500 -- (-976.941) (-977.313) (-974.940) [-974.527] * (-975.917) (-976.801) [-974.744] (-976.723) -- 0:00:40
331000 -- (-978.477) (-978.652) (-977.911) [-976.583] * [-975.464] (-975.615) (-974.485) (-977.725) -- 0:00:40
331500 -- (-977.565) (-976.440) [-976.034] (-975.248) * (-975.030) (-981.039) [-973.831] (-977.156) -- 0:00:40
332000 -- (-975.059) (-975.826) [-974.920] (-976.259) * (-979.393) [-977.368] (-978.510) (-974.888) -- 0:00:40
332500 -- (-973.940) (-974.558) (-975.165) [-974.779] * (-976.148) (-978.746) [-976.905] (-974.562) -- 0:00:40
333000 -- (-974.522) (-976.007) [-976.518] (-974.385) * (-975.600) (-978.811) [-976.204] (-974.682) -- 0:00:40
333500 -- (-975.224) (-979.718) (-975.364) [-974.871] * (-975.602) [-974.665] (-975.518) (-974.586) -- 0:00:39
334000 -- (-974.581) (-973.832) [-978.091] (-976.426) * [-976.523] (-976.371) (-977.369) (-974.788) -- 0:00:39
334500 -- (-975.454) (-973.964) [-974.704] (-976.040) * (-975.430) (-980.087) [-977.403] (-975.031) -- 0:00:39
335000 -- (-976.688) (-978.502) [-974.343] (-976.412) * (-974.987) (-977.340) [-980.804] (-974.069) -- 0:00:39
Average standard deviation of split frequencies: 0.010729
335500 -- (-975.712) [-978.303] (-975.109) (-977.055) * [-976.517] (-976.109) (-975.980) (-975.478) -- 0:00:39
336000 -- (-975.168) (-978.399) [-976.678] (-979.277) * (-982.345) (-978.052) (-974.500) [-974.884] -- 0:00:41
336500 -- (-976.938) (-976.219) [-980.548] (-976.819) * (-979.650) (-976.255) (-976.071) [-975.724] -- 0:00:41
337000 -- [-979.337] (-976.231) (-979.064) (-976.484) * (-978.760) (-977.741) [-974.804] (-976.259) -- 0:00:41
337500 -- [-974.941] (-978.990) (-981.208) (-978.806) * [-974.422] (-976.962) (-974.944) (-975.114) -- 0:00:41
338000 -- (-974.662) [-977.160] (-975.203) (-976.812) * (-975.120) [-976.750] (-976.334) (-975.979) -- 0:00:41
338500 -- (-974.635) (-974.775) [-974.818] (-976.868) * (-976.731) (-976.618) (-975.550) [-974.972] -- 0:00:41
339000 -- (-974.433) [-975.759] (-979.962) (-977.570) * (-975.271) (-977.897) (-977.063) [-976.178] -- 0:00:40
339500 -- (-975.876) [-974.865] (-978.319) (-978.852) * (-975.673) (-978.469) [-976.502] (-975.071) -- 0:00:40
340000 -- (-979.130) (-975.546) [-975.510] (-976.660) * (-975.800) [-975.721] (-976.437) (-974.462) -- 0:00:40
Average standard deviation of split frequencies: 0.011676
340500 -- (-974.296) [-977.128] (-975.456) (-975.410) * (-975.635) (-976.942) (-978.414) [-977.660] -- 0:00:40
341000 -- (-976.488) (-975.641) [-976.918] (-977.205) * (-975.082) (-977.032) (-978.129) [-977.818] -- 0:00:40
341500 -- [-979.244] (-976.507) (-975.586) (-975.708) * (-976.093) (-974.354) [-976.085] (-976.943) -- 0:00:40
342000 -- [-975.574] (-975.792) (-976.724) (-976.872) * (-975.907) (-974.197) (-981.033) [-975.743] -- 0:00:40
342500 -- (-975.555) [-974.439] (-975.732) (-975.801) * (-977.664) (-975.430) (-975.484) [-975.671] -- 0:00:40
343000 -- (-975.133) [-974.351] (-975.398) (-978.132) * (-976.231) (-974.537) (-975.681) [-974.858] -- 0:00:40
343500 -- (-975.138) [-974.349] (-974.514) (-975.165) * (-976.171) (-976.801) (-976.015) [-976.177] -- 0:00:40
344000 -- (-976.011) (-977.315) (-974.076) [-978.323] * (-975.086) (-975.390) (-975.658) [-975.976] -- 0:00:40
344500 -- (-974.439) (-975.986) (-975.440) [-976.497] * (-974.396) [-977.937] (-978.584) (-976.748) -- 0:00:39
345000 -- [-974.732] (-975.970) (-976.643) (-980.128) * (-978.409) (-975.468) (-976.595) [-974.008] -- 0:00:39
Average standard deviation of split frequencies: 0.011941
345500 -- (-977.238) (-976.514) [-974.539] (-976.443) * (-977.047) (-976.287) (-977.969) [-978.259] -- 0:00:39
346000 -- (-977.200) (-974.958) [-974.735] (-980.976) * [-975.290] (-975.695) (-977.440) (-975.431) -- 0:00:39
346500 -- (-977.054) [-978.571] (-975.179) (-975.450) * [-977.293] (-975.942) (-980.169) (-979.578) -- 0:00:39
347000 -- (-975.064) [-979.516] (-978.902) (-975.224) * (-979.376) (-975.250) (-975.539) [-976.494] -- 0:00:39
347500 -- (-975.663) (-976.209) [-975.171] (-977.701) * (-976.630) (-975.006) [-974.453] (-975.979) -- 0:00:39
348000 -- (-975.025) [-974.760] (-976.868) (-976.204) * (-980.850) (-985.304) (-975.215) [-974.678] -- 0:00:39
348500 -- (-974.388) (-974.591) (-975.769) [-977.052] * (-977.528) [-978.339] (-975.296) (-974.988) -- 0:00:39
349000 -- (-975.275) [-977.152] (-977.358) (-977.730) * (-976.173) (-976.996) [-976.596] (-977.037) -- 0:00:39
349500 -- [-974.801] (-976.570) (-976.864) (-975.192) * [-974.927] (-976.872) (-976.610) (-977.024) -- 0:00:39
350000 -- (-977.587) (-976.875) (-975.753) [-975.276] * [-975.993] (-977.701) (-974.187) (-975.265) -- 0:00:39
Average standard deviation of split frequencies: 0.012351
350500 -- (-976.900) [-980.212] (-976.367) (-979.621) * (-977.844) (-978.862) [-974.103] (-975.815) -- 0:00:38
351000 -- [-977.585] (-982.701) (-980.871) (-977.389) * (-975.813) (-977.704) (-974.322) [-974.635] -- 0:00:38
351500 -- (-975.549) (-980.323) (-980.054) [-975.110] * (-977.967) (-976.967) [-975.304] (-976.655) -- 0:00:38
352000 -- [-976.507] (-980.584) (-982.137) (-976.264) * (-977.967) (-978.526) (-976.435) [-977.339] -- 0:00:38
352500 -- (-976.794) (-980.015) [-980.136] (-976.762) * (-976.051) (-976.067) (-974.346) [-975.647] -- 0:00:40
353000 -- (-978.777) (-978.769) (-982.308) [-975.517] * (-978.055) (-976.184) (-976.381) [-976.391] -- 0:00:40
353500 -- [-977.259] (-977.737) (-975.352) (-975.065) * (-975.508) (-978.637) [-975.121] (-976.565) -- 0:00:40
354000 -- (-975.387) [-976.731] (-974.281) (-980.726) * (-975.457) (-976.909) (-978.517) [-976.907] -- 0:00:40
354500 -- [-974.982] (-977.422) (-975.769) (-974.240) * (-975.309) (-974.856) (-979.182) [-977.387] -- 0:00:40
355000 -- [-975.320] (-978.372) (-979.131) (-975.065) * (-975.424) (-974.992) (-977.597) [-978.415] -- 0:00:39
Average standard deviation of split frequencies: 0.012166
355500 -- [-976.840] (-978.162) (-978.537) (-975.059) * [-974.953] (-980.347) (-977.930) (-977.079) -- 0:00:39
356000 -- (-976.319) [-975.693] (-977.053) (-977.344) * [-975.104] (-976.491) (-977.212) (-975.450) -- 0:00:39
356500 -- [-974.812] (-975.324) (-977.743) (-975.939) * [-974.953] (-977.684) (-976.178) (-974.619) -- 0:00:39
357000 -- (-975.327) (-974.619) [-976.185] (-974.238) * [-976.530] (-975.574) (-975.209) (-975.526) -- 0:00:39
357500 -- [-975.353] (-974.257) (-979.165) (-974.528) * (-978.294) (-976.372) [-975.189] (-975.007) -- 0:00:39
358000 -- (-977.738) (-977.882) (-978.062) [-981.499] * (-977.340) [-977.625] (-974.754) (-976.534) -- 0:00:39
358500 -- (-975.134) (-976.403) [-978.739] (-981.758) * (-977.229) (-976.433) (-975.631) [-975.174] -- 0:00:39
359000 -- (-975.754) [-977.226] (-979.140) (-976.926) * (-976.899) (-977.518) (-976.464) [-975.011] -- 0:00:39
359500 -- [-977.279] (-976.897) (-976.249) (-977.693) * (-976.850) (-974.701) (-975.565) [-975.198] -- 0:00:39
360000 -- [-975.512] (-974.280) (-981.838) (-977.516) * [-978.885] (-977.834) (-975.938) (-975.052) -- 0:00:39
Average standard deviation of split frequencies: 0.012417
360500 -- (-979.449) (-974.452) (-975.685) [-977.953] * (-979.939) (-977.154) (-975.965) [-974.822] -- 0:00:39
361000 -- [-975.056] (-974.956) (-974.439) (-977.182) * (-976.922) (-978.946) [-976.170] (-976.349) -- 0:00:38
361500 -- (-981.149) (-974.593) (-974.813) [-978.247] * [-977.531] (-982.017) (-976.199) (-980.054) -- 0:00:38
362000 -- [-977.593] (-975.905) (-976.317) (-977.263) * [-978.948] (-976.551) (-974.689) (-977.225) -- 0:00:38
362500 -- (-974.420) (-979.491) (-974.788) [-975.754] * [-975.720] (-978.838) (-974.694) (-974.476) -- 0:00:38
363000 -- [-974.920] (-976.161) (-974.284) (-977.823) * [-974.905] (-976.570) (-974.526) (-976.883) -- 0:00:38
363500 -- [-975.263] (-976.006) (-974.360) (-975.601) * [-975.052] (-974.152) (-975.205) (-978.048) -- 0:00:38
364000 -- [-974.590] (-975.175) (-974.869) (-974.902) * (-977.739) (-974.405) [-976.256] (-979.234) -- 0:00:38
364500 -- (-974.625) (-974.559) (-974.806) [-975.462] * (-975.943) [-975.726] (-977.935) (-977.247) -- 0:00:38
365000 -- (-977.936) (-976.411) (-975.678) [-974.696] * [-974.538] (-974.164) (-978.089) (-976.892) -- 0:00:38
Average standard deviation of split frequencies: 0.013041
365500 -- (-976.073) (-974.709) (-975.459) [-975.218] * (-974.408) (-975.974) (-980.123) [-976.592] -- 0:00:38
366000 -- [-975.987] (-974.418) (-981.121) (-974.237) * (-977.451) (-975.924) [-975.088] (-975.927) -- 0:00:38
366500 -- (-977.024) (-974.366) (-977.620) [-974.961] * (-978.063) (-976.294) [-976.186] (-974.989) -- 0:00:38
367000 -- (-975.118) [-974.548] (-978.969) (-977.971) * [-975.089] (-976.033) (-975.971) (-977.874) -- 0:00:37
367500 -- (-979.303) [-974.115] (-981.448) (-976.295) * (-975.099) (-976.709) [-974.109] (-976.127) -- 0:00:37
368000 -- (-979.699) (-974.748) (-981.335) [-976.371] * [-975.949] (-975.781) (-975.379) (-975.715) -- 0:00:37
368500 -- (-975.581) (-975.390) (-981.608) [-976.635] * (-980.757) [-976.578] (-975.788) (-975.132) -- 0:00:37
369000 -- (-974.891) (-976.296) [-977.620] (-977.208) * (-974.619) (-976.232) (-981.051) [-976.850] -- 0:00:39
369500 -- [-978.002] (-976.648) (-975.592) (-978.397) * [-977.045] (-974.146) (-976.693) (-975.114) -- 0:00:39
370000 -- [-977.517] (-974.580) (-977.398) (-977.319) * (-976.322) (-975.014) (-976.234) [-976.832] -- 0:00:39
Average standard deviation of split frequencies: 0.013241
370500 -- (-981.322) (-980.249) (-975.883) [-976.285] * (-976.918) (-974.234) [-976.595] (-979.694) -- 0:00:39
371000 -- [-976.493] (-976.546) (-976.441) (-975.999) * [-974.926] (-978.329) (-974.652) (-976.133) -- 0:00:38
371500 -- (-977.153) [-976.333] (-975.343) (-975.572) * (-976.641) [-974.031] (-974.992) (-976.736) -- 0:00:38
372000 -- (-979.032) (-979.644) [-975.529] (-974.988) * (-978.282) (-977.183) (-973.992) [-975.070] -- 0:00:38
372500 -- (-975.631) [-976.513] (-975.621) (-977.091) * (-976.532) (-977.378) (-976.730) [-974.774] -- 0:00:38
373000 -- (-975.955) (-975.021) [-975.504] (-977.004) * (-975.001) [-977.171] (-974.898) (-982.264) -- 0:00:38
373500 -- [-975.902] (-976.031) (-977.901) (-978.396) * (-974.856) [-977.551] (-974.637) (-980.006) -- 0:00:38
374000 -- (-975.921) [-976.941] (-976.093) (-976.073) * (-976.683) [-977.434] (-975.910) (-978.605) -- 0:00:38
374500 -- [-974.275] (-974.709) (-975.356) (-976.802) * [-975.449] (-976.900) (-979.703) (-974.293) -- 0:00:38
375000 -- [-974.104] (-973.989) (-975.901) (-979.991) * [-979.046] (-974.182) (-979.006) (-976.571) -- 0:00:38
Average standard deviation of split frequencies: 0.013634
375500 -- (-975.954) [-974.854] (-977.868) (-978.054) * (-976.505) (-974.114) (-978.047) [-976.053] -- 0:00:38
376000 -- (-977.859) (-974.929) (-974.664) [-978.334] * (-979.041) [-974.283] (-975.242) (-977.726) -- 0:00:38
376500 -- (-980.382) (-975.153) (-975.509) [-975.274] * (-982.785) (-975.689) (-978.980) [-976.152] -- 0:00:38
377000 -- (-975.750) (-974.408) (-975.123) [-974.808] * [-980.754] (-975.366) (-974.455) (-974.798) -- 0:00:38
377500 -- (-976.428) (-973.944) [-977.009] (-974.554) * (-977.749) [-975.583] (-974.599) (-982.132) -- 0:00:37
378000 -- (-974.979) [-975.092] (-979.094) (-974.767) * (-974.950) (-977.853) (-974.960) [-979.260] -- 0:00:37
378500 -- [-976.082] (-975.490) (-976.608) (-978.831) * (-974.762) (-975.914) (-978.494) [-976.275] -- 0:00:37
379000 -- (-975.703) [-975.301] (-976.603) (-978.887) * [-974.916] (-975.627) (-977.273) (-975.177) -- 0:00:37
379500 -- [-974.894] (-975.221) (-977.669) (-975.612) * (-975.437) (-975.507) (-977.714) [-975.065] -- 0:00:37
380000 -- (-980.506) (-975.062) (-977.840) [-974.738] * (-977.023) [-978.316] (-975.924) (-979.176) -- 0:00:37
Average standard deviation of split frequencies: 0.013777
380500 -- (-976.358) (-976.178) (-975.911) [-974.748] * (-976.998) [-977.411] (-975.624) (-980.384) -- 0:00:37
381000 -- (-977.458) [-975.935] (-977.949) (-974.113) * [-976.653] (-975.348) (-976.220) (-983.427) -- 0:00:37
381500 -- (-980.153) (-977.844) [-975.477] (-976.150) * (-976.093) (-979.088) [-974.614] (-978.184) -- 0:00:37
382000 -- (-979.396) [-974.990] (-976.220) (-977.236) * (-980.446) (-975.797) (-974.005) [-974.684] -- 0:00:37
382500 -- [-977.144] (-975.023) (-975.366) (-975.424) * (-974.581) (-979.324) [-974.289] (-979.399) -- 0:00:37
383000 -- (-976.852) (-974.804) [-974.914] (-976.502) * (-975.606) (-975.993) (-974.992) [-974.480] -- 0:00:37
383500 -- (-976.113) (-976.233) [-974.789] (-974.378) * (-979.352) (-976.932) (-975.485) [-974.484] -- 0:00:36
384000 -- [-977.121] (-976.471) (-974.947) (-976.711) * (-978.883) (-981.593) [-975.823] (-975.017) -- 0:00:36
384500 -- (-978.007) (-978.730) [-974.461] (-975.310) * (-978.619) (-976.886) (-984.806) [-973.939] -- 0:00:36
385000 -- (-977.186) (-979.255) [-976.614] (-974.077) * [-975.893] (-976.005) (-979.771) (-976.678) -- 0:00:38
Average standard deviation of split frequencies: 0.013052
385500 -- (-980.854) [-976.235] (-975.484) (-977.174) * [-974.169] (-974.168) (-975.237) (-979.156) -- 0:00:38
386000 -- (-983.370) (-983.347) (-974.636) [-979.676] * (-974.968) (-974.534) (-976.999) [-976.136] -- 0:00:38
386500 -- (-975.971) (-979.501) (-976.500) [-974.015] * (-974.887) [-975.859] (-976.492) (-975.157) -- 0:00:38
387000 -- (-977.365) (-975.664) (-977.023) [-977.572] * (-978.589) (-979.861) [-975.334] (-981.053) -- 0:00:38
387500 -- (-974.636) (-974.882) (-977.582) [-974.475] * (-981.114) (-978.435) (-974.933) [-976.077] -- 0:00:37
388000 -- (-974.339) (-974.603) [-975.932] (-975.015) * (-976.730) (-979.286) [-979.059] (-977.346) -- 0:00:37
388500 -- [-976.964] (-975.224) (-975.598) (-978.348) * [-975.855] (-976.461) (-976.708) (-974.914) -- 0:00:37
389000 -- (-974.506) (-975.412) (-975.482) [-977.225] * (-975.982) [-974.680] (-976.155) (-975.342) -- 0:00:37
389500 -- (-974.056) [-974.652] (-975.606) (-975.668) * (-977.176) (-974.238) [-974.538] (-977.364) -- 0:00:37
390000 -- (-975.031) (-974.488) (-977.324) [-978.912] * (-976.670) [-978.016] (-975.854) (-977.174) -- 0:00:37
Average standard deviation of split frequencies: 0.012142
390500 -- (-976.080) [-976.494] (-975.479) (-978.308) * (-975.014) [-975.000] (-975.342) (-980.505) -- 0:00:37
391000 -- (-978.691) [-974.432] (-975.320) (-977.061) * [-976.901] (-979.570) (-977.760) (-980.423) -- 0:00:37
391500 -- (-981.972) [-974.655] (-976.434) (-980.001) * (-977.525) (-976.060) (-977.483) [-979.432] -- 0:00:37
392000 -- [-979.836] (-975.736) (-975.989) (-976.006) * (-975.901) (-974.472) (-977.119) [-975.266] -- 0:00:37
392500 -- [-977.203] (-974.975) (-975.516) (-975.500) * [-977.418] (-974.888) (-977.600) (-977.517) -- 0:00:37
393000 -- (-978.234) (-980.279) [-975.338] (-978.623) * (-977.844) [-974.682] (-977.299) (-975.239) -- 0:00:37
393500 -- (-974.688) (-976.073) (-975.155) [-976.530] * (-979.763) [-977.164] (-977.625) (-976.097) -- 0:00:36
394000 -- (-976.703) (-976.511) (-976.766) [-974.585] * (-976.316) (-976.773) (-975.578) [-975.303] -- 0:00:36
394500 -- (-976.047) (-978.217) [-978.363] (-975.371) * [-975.379] (-977.103) (-975.333) (-975.628) -- 0:00:36
395000 -- (-981.288) (-975.212) [-974.249] (-975.426) * (-977.356) (-974.715) (-974.567) [-975.043] -- 0:00:36
Average standard deviation of split frequencies: 0.010863
395500 -- (-977.466) [-976.568] (-975.640) (-975.770) * (-976.364) (-976.443) (-976.516) [-977.727] -- 0:00:36
396000 -- (-975.796) (-976.700) [-974.296] (-977.857) * (-978.081) [-979.276] (-976.917) (-976.870) -- 0:00:36
396500 -- (-975.479) (-981.627) [-974.868] (-980.393) * [-976.956] (-975.840) (-975.274) (-976.670) -- 0:00:36
397000 -- [-976.303] (-975.700) (-979.750) (-977.866) * (-975.369) (-979.025) (-977.090) [-976.343] -- 0:00:36
397500 -- (-975.632) (-975.860) (-977.982) [-975.297] * (-979.429) [-974.221] (-976.159) (-976.689) -- 0:00:36
398000 -- (-976.860) (-975.528) (-978.342) [-974.563] * (-976.073) [-974.595] (-975.978) (-976.967) -- 0:00:36
398500 -- [-975.175] (-978.812) (-976.554) (-976.943) * (-976.791) (-976.309) [-975.101] (-977.146) -- 0:00:36
399000 -- (-974.691) (-977.636) (-974.501) [-976.160] * (-978.473) (-977.058) [-976.744] (-978.662) -- 0:00:36
399500 -- [-975.109] (-974.666) (-977.073) (-977.101) * (-977.986) (-979.930) [-974.863] (-978.654) -- 0:00:37
400000 -- (-979.742) (-976.227) [-977.778] (-975.606) * (-979.773) (-978.573) (-976.700) [-975.528] -- 0:00:37
Average standard deviation of split frequencies: 0.011104
400500 -- [-978.851] (-975.829) (-976.906) (-976.667) * [-974.511] (-974.583) (-976.543) (-974.937) -- 0:00:37
401000 -- (-975.945) [-974.307] (-975.679) (-981.346) * (-974.328) [-975.468] (-975.877) (-975.504) -- 0:00:37
401500 -- (-975.310) (-974.825) [-976.939] (-980.633) * (-975.207) (-974.663) [-974.503] (-975.925) -- 0:00:37
402000 -- (-974.791) [-975.544] (-976.320) (-978.745) * [-974.947] (-974.649) (-975.709) (-976.829) -- 0:00:37
402500 -- [-977.770] (-974.459) (-979.511) (-974.571) * (-974.426) (-977.562) (-974.877) [-976.789] -- 0:00:37
403000 -- (-978.578) [-974.695] (-980.442) (-977.631) * [-974.844] (-978.816) (-974.277) (-976.328) -- 0:00:37
403500 -- (-976.910) [-976.688] (-976.066) (-977.576) * (-976.307) (-975.285) [-975.791] (-976.748) -- 0:00:36
404000 -- [-974.964] (-980.876) (-977.946) (-978.850) * (-976.047) (-976.075) [-979.598] (-976.661) -- 0:00:36
404500 -- (-975.109) (-981.228) [-978.650] (-977.391) * (-974.271) [-975.064] (-977.083) (-975.136) -- 0:00:36
405000 -- (-974.997) (-982.358) [-976.960] (-974.298) * [-976.073] (-984.284) (-977.041) (-977.764) -- 0:00:36
Average standard deviation of split frequencies: 0.011248
405500 -- (-978.003) [-975.355] (-978.710) (-975.904) * (-977.076) [-974.937] (-980.200) (-977.453) -- 0:00:36
406000 -- (-977.851) [-975.530] (-976.087) (-975.573) * (-974.281) [-977.894] (-975.551) (-979.233) -- 0:00:36
406500 -- (-977.074) (-976.290) [-975.663] (-977.436) * [-978.206] (-975.369) (-981.324) (-977.957) -- 0:00:36
407000 -- (-977.980) (-976.810) [-974.966] (-977.142) * (-977.672) [-974.874] (-976.938) (-977.852) -- 0:00:36
407500 -- [-974.899] (-975.593) (-975.319) (-976.701) * (-976.500) (-980.118) [-974.565] (-977.658) -- 0:00:36
408000 -- (-974.234) (-980.027) (-978.077) [-977.080] * (-977.046) (-979.406) [-974.976] (-977.195) -- 0:00:36
408500 -- (-975.351) (-975.600) (-975.072) [-976.358] * (-979.691) (-976.107) (-974.557) [-976.838] -- 0:00:36
409000 -- (-975.541) [-974.221] (-975.599) (-976.505) * (-977.338) (-974.377) (-980.117) [-976.558] -- 0:00:36
409500 -- (-974.211) (-976.356) (-978.586) [-976.248] * (-975.515) (-975.167) (-979.713) [-977.477] -- 0:00:36
410000 -- (-975.239) (-982.028) [-975.228] (-979.305) * [-977.527] (-975.778) (-977.558) (-978.093) -- 0:00:35
Average standard deviation of split frequencies: 0.010466
410500 -- (-977.382) (-977.093) [-974.874] (-975.956) * (-978.927) (-977.232) (-977.493) [-975.573] -- 0:00:35
411000 -- [-976.422] (-975.638) (-979.492) (-975.751) * (-977.706) (-974.947) [-977.404] (-976.198) -- 0:00:35
411500 -- [-979.625] (-975.740) (-985.202) (-978.102) * [-977.077] (-976.618) (-976.959) (-974.966) -- 0:00:35
412000 -- (-977.312) [-978.615] (-982.431) (-974.964) * (-973.869) [-977.105] (-976.667) (-975.739) -- 0:00:35
412500 -- (-978.819) (-978.336) (-975.902) [-975.142] * [-976.209] (-975.761) (-975.783) (-978.531) -- 0:00:35
413000 -- (-977.215) (-977.642) (-977.474) [-975.063] * (-975.194) [-979.155] (-978.990) (-977.024) -- 0:00:35
413500 -- (-975.933) (-979.178) [-975.012] (-975.748) * [-979.141] (-976.233) (-974.852) (-976.939) -- 0:00:35
414000 -- (-977.590) [-974.997] (-978.699) (-976.324) * (-977.467) (-974.488) (-974.316) [-976.485] -- 0:00:35
414500 -- (-977.482) [-976.284] (-977.764) (-976.781) * (-977.012) (-979.296) [-974.916] (-975.262) -- 0:00:35
415000 -- (-976.926) (-975.101) (-977.800) [-974.878] * (-977.868) (-976.568) [-976.093] (-976.702) -- 0:00:35
Average standard deviation of split frequencies: 0.010865
415500 -- (-974.786) (-975.523) [-976.847] (-976.562) * (-974.566) [-975.333] (-976.603) (-975.385) -- 0:00:36
416000 -- [-974.806] (-975.379) (-977.789) (-975.633) * (-977.927) (-974.207) [-981.676] (-974.293) -- 0:00:36
416500 -- (-975.500) (-976.760) (-979.484) [-976.154] * (-980.741) (-976.431) [-977.138] (-974.692) -- 0:00:36
417000 -- (-976.223) (-977.722) (-980.371) [-977.428] * (-977.132) (-979.490) [-975.171] (-975.866) -- 0:00:36
417500 -- (-975.883) (-976.075) [-978.192] (-981.568) * (-980.440) (-978.295) [-977.352] (-974.271) -- 0:00:36
418000 -- (-974.819) (-976.438) (-973.962) [-977.308] * (-979.631) (-978.928) [-975.796] (-975.661) -- 0:00:36
418500 -- (-975.513) (-978.403) [-974.542] (-975.102) * (-979.420) (-976.562) [-975.009] (-978.138) -- 0:00:36
419000 -- (-976.502) (-975.805) (-977.897) [-975.784] * (-979.131) [-976.305] (-974.551) (-977.976) -- 0:00:36
419500 -- (-975.485) (-975.328) (-980.729) [-974.600] * (-977.570) (-975.146) [-975.517] (-978.132) -- 0:00:35
420000 -- (-974.375) (-976.061) [-975.855] (-975.233) * (-977.347) [-973.726] (-975.699) (-978.208) -- 0:00:35
Average standard deviation of split frequencies: 0.010011
420500 -- (-976.752) (-974.945) (-979.197) [-975.332] * (-978.338) (-976.582) (-976.862) [-977.261] -- 0:00:35
421000 -- (-974.149) (-974.442) (-976.277) [-977.052] * (-974.550) [-977.957] (-976.941) (-978.229) -- 0:00:35
421500 -- [-974.286] (-974.634) (-976.694) (-979.119) * (-976.361) (-975.546) [-974.633] (-976.329) -- 0:00:35
422000 -- (-974.668) (-975.267) (-976.449) [-973.957] * (-976.562) (-974.181) [-975.427] (-976.185) -- 0:00:35
422500 -- [-974.692] (-975.196) (-978.532) (-974.068) * (-975.118) (-974.553) (-974.871) [-975.015] -- 0:00:35
423000 -- [-979.831] (-974.858) (-975.417) (-975.495) * (-974.638) (-974.747) (-977.140) [-975.269] -- 0:00:35
423500 -- [-976.297] (-975.328) (-978.508) (-975.414) * (-975.346) (-975.742) [-976.174] (-976.087) -- 0:00:35
424000 -- (-977.489) (-975.263) (-976.192) [-976.013] * (-975.914) [-976.898] (-976.669) (-977.384) -- 0:00:35
424500 -- (-976.629) (-976.417) (-976.263) [-979.596] * [-974.051] (-975.486) (-975.532) (-977.062) -- 0:00:35
425000 -- [-976.423] (-977.298) (-977.720) (-977.124) * (-979.285) (-977.496) [-975.231] (-978.126) -- 0:00:35
Average standard deviation of split frequencies: 0.010697
425500 -- (-977.275) [-975.024] (-976.013) (-979.601) * (-978.278) (-977.448) [-975.621] (-975.198) -- 0:00:35
426000 -- (-976.780) (-976.092) [-974.758] (-979.345) * (-978.553) [-975.850] (-975.420) (-975.735) -- 0:00:35
426500 -- (-975.436) (-975.185) [-974.969] (-974.890) * [-979.862] (-974.969) (-975.574) (-977.340) -- 0:00:34
427000 -- (-981.296) (-974.592) [-976.320] (-975.948) * (-975.348) (-974.099) (-982.284) [-980.425] -- 0:00:34
427500 -- (-979.205) (-975.655) (-975.385) [-975.059] * (-976.786) [-976.224] (-976.970) (-977.785) -- 0:00:34
428000 -- (-977.435) (-978.362) (-976.821) [-977.219] * (-974.645) (-975.230) [-975.187] (-975.716) -- 0:00:34
428500 -- (-979.778) (-975.345) [-976.642] (-974.051) * (-974.073) (-977.665) (-976.376) [-975.442] -- 0:00:34
429000 -- (-982.378) (-974.953) [-977.207] (-976.726) * (-980.119) (-976.593) [-974.144] (-978.036) -- 0:00:34
429500 -- (-978.449) (-974.560) (-978.644) [-977.372] * (-976.434) (-977.721) [-975.418] (-976.501) -- 0:00:34
430000 -- (-975.323) (-974.615) [-977.729] (-977.437) * (-981.034) (-976.259) (-975.349) [-975.121] -- 0:00:34
Average standard deviation of split frequencies: 0.009851
430500 -- (-975.774) (-974.813) (-978.068) [-975.465] * [-976.220] (-975.970) (-974.869) (-974.450) -- 0:00:34
431000 -- (-978.544) [-974.549] (-976.038) (-976.792) * [-978.093] (-977.677) (-975.193) (-976.380) -- 0:00:34
431500 -- [-975.229] (-974.927) (-975.555) (-979.749) * [-979.097] (-979.175) (-977.665) (-974.426) -- 0:00:35
432000 -- (-974.708) (-974.614) (-974.715) [-977.823] * (-979.261) (-976.586) [-977.347] (-974.454) -- 0:00:35
432500 -- (-974.696) [-976.694] (-974.767) (-978.891) * (-982.957) (-974.096) [-974.941] (-975.519) -- 0:00:35
433000 -- (-978.223) [-980.866] (-974.525) (-975.024) * (-978.278) (-977.191) [-974.936] (-979.333) -- 0:00:35
433500 -- (-976.498) (-977.273) (-974.126) [-976.087] * [-975.111] (-977.635) (-976.705) (-982.177) -- 0:00:35
434000 -- (-976.334) (-975.065) [-975.514] (-978.056) * (-975.764) (-974.550) (-980.832) [-975.262] -- 0:00:35
434500 -- (-976.325) [-974.831] (-973.985) (-977.060) * [-977.575] (-974.156) (-976.217) (-977.764) -- 0:00:35
435000 -- (-975.541) (-979.195) [-974.000] (-974.755) * (-975.953) [-975.961] (-976.236) (-976.136) -- 0:00:35
Average standard deviation of split frequencies: 0.010163
435500 -- (-975.729) (-982.681) [-976.866] (-977.311) * [-977.194] (-974.985) (-977.970) (-978.730) -- 0:00:34
436000 -- (-976.043) (-978.141) [-976.876] (-976.448) * (-976.954) [-977.217] (-981.363) (-976.518) -- 0:00:34
436500 -- [-977.701] (-977.235) (-976.450) (-976.609) * (-974.942) (-975.288) [-978.570] (-976.910) -- 0:00:34
437000 -- [-974.308] (-975.785) (-979.173) (-976.465) * (-974.188) (-976.794) [-977.049] (-975.001) -- 0:00:34
437500 -- [-975.105] (-975.292) (-978.371) (-975.178) * (-975.681) [-974.898] (-982.770) (-974.774) -- 0:00:34
438000 -- (-974.580) (-979.179) (-977.551) [-974.410] * (-979.189) (-975.706) (-981.552) [-976.030] -- 0:00:34
438500 -- (-974.202) [-976.139] (-974.459) (-975.239) * (-980.203) (-978.428) (-976.177) [-974.609] -- 0:00:34
439000 -- (-980.293) (-977.937) (-976.977) [-975.836] * [-978.544] (-978.151) (-979.354) (-975.241) -- 0:00:34
439500 -- [-978.428] (-975.336) (-974.895) (-975.856) * (-978.631) (-976.678) (-977.587) [-974.369] -- 0:00:34
440000 -- (-977.060) (-976.524) (-975.304) [-975.059] * (-978.009) [-976.582] (-976.019) (-976.729) -- 0:00:34
Average standard deviation of split frequencies: 0.009414
440500 -- (-977.325) (-976.575) (-975.641) [-974.929] * (-977.250) (-977.591) [-977.389] (-976.471) -- 0:00:34
441000 -- (-979.170) [-976.154] (-977.225) (-976.463) * (-981.567) [-975.235] (-977.640) (-974.913) -- 0:00:34
441500 -- [-975.579] (-975.472) (-976.541) (-976.584) * (-978.747) [-975.936] (-977.799) (-978.769) -- 0:00:34
442000 -- (-979.827) [-976.647] (-976.229) (-975.134) * [-979.689] (-977.895) (-975.212) (-976.432) -- 0:00:34
442500 -- (-978.094) (-975.698) [-975.184] (-976.913) * [-977.207] (-980.385) (-976.044) (-974.827) -- 0:00:34
443000 -- (-975.208) (-975.070) [-975.063] (-985.605) * (-979.440) (-982.154) (-978.366) [-975.038] -- 0:00:33
443500 -- (-975.381) (-974.554) [-977.455] (-984.126) * (-978.371) [-974.111] (-981.050) (-974.164) -- 0:00:33
444000 -- (-975.237) (-974.235) (-975.604) [-977.156] * (-976.590) [-976.340] (-981.813) (-973.954) -- 0:00:33
444500 -- [-975.091] (-974.233) (-974.958) (-976.641) * (-981.309) (-979.121) (-979.606) [-976.860] -- 0:00:33
445000 -- (-976.110) (-978.006) [-974.945] (-974.324) * (-978.667) (-976.695) (-974.688) [-977.439] -- 0:00:33
Average standard deviation of split frequencies: 0.009050
445500 -- (-976.355) [-976.287] (-975.881) (-977.266) * (-976.115) (-977.513) [-976.533] (-974.926) -- 0:00:33
446000 -- (-974.776) (-983.041) [-974.315] (-978.450) * (-980.138) (-976.300) (-979.475) [-977.890] -- 0:00:33
446500 -- (-977.935) [-981.792] (-976.481) (-977.898) * (-977.003) [-981.141] (-979.820) (-975.608) -- 0:00:33
447000 -- [-974.661] (-975.715) (-975.966) (-978.951) * (-976.361) (-979.953) (-975.161) [-976.178] -- 0:00:33
447500 -- (-979.328) [-976.488] (-978.329) (-977.036) * (-979.670) (-979.939) [-975.330] (-977.485) -- 0:00:33
448000 -- [-974.902] (-975.219) (-975.119) (-975.425) * (-979.240) [-975.500] (-977.024) (-975.200) -- 0:00:34
448500 -- (-974.707) (-975.311) [-976.172] (-976.837) * (-980.020) (-974.406) (-976.276) [-977.132] -- 0:00:34
449000 -- [-976.108] (-976.468) (-979.575) (-980.647) * (-976.398) (-974.799) [-975.253] (-977.139) -- 0:00:34
449500 -- (-976.783) (-977.727) [-982.190] (-974.586) * (-976.236) [-980.262] (-978.415) (-975.736) -- 0:00:34
450000 -- (-975.252) (-976.237) (-982.734) [-977.084] * (-976.507) (-974.290) (-977.148) [-975.489] -- 0:00:34
Average standard deviation of split frequencies: 0.010600
450500 -- [-976.895] (-978.902) (-976.634) (-979.654) * [-974.889] (-974.209) (-976.563) (-975.861) -- 0:00:34
451000 -- (-976.556) (-976.947) (-977.702) [-977.581] * [-978.542] (-974.381) (-975.195) (-977.321) -- 0:00:34
451500 -- (-976.628) [-975.780] (-978.397) (-976.428) * (-980.317) (-976.497) [-975.641] (-974.624) -- 0:00:34
452000 -- (-976.408) [-976.750] (-978.207) (-975.259) * (-976.842) [-976.142] (-977.149) (-976.910) -- 0:00:33
452500 -- (-981.810) (-976.741) [-974.585] (-975.961) * [-979.232] (-977.038) (-977.530) (-975.351) -- 0:00:33
453000 -- (-974.815) [-978.293] (-974.596) (-976.076) * (-974.494) (-976.956) [-977.437] (-975.558) -- 0:00:33
453500 -- [-974.649] (-977.339) (-973.947) (-973.864) * (-977.474) (-977.258) [-975.119] (-975.505) -- 0:00:33
454000 -- (-975.109) (-978.614) (-977.361) [-974.059] * [-979.340] (-978.313) (-978.848) (-975.930) -- 0:00:33
454500 -- (-975.680) [-980.344] (-975.202) (-974.806) * (-981.356) (-977.238) (-980.372) [-976.288] -- 0:00:33
455000 -- (-977.827) [-976.560] (-977.851) (-975.297) * (-976.624) [-975.948] (-983.741) (-978.693) -- 0:00:33
Average standard deviation of split frequencies: 0.011441
455500 -- (-977.046) (-977.304) [-978.294] (-975.289) * (-976.801) (-975.259) (-978.135) [-978.840] -- 0:00:33
456000 -- (-976.154) (-977.600) [-974.943] (-984.209) * (-977.288) (-975.550) (-977.865) [-974.204] -- 0:00:33
456500 -- [-976.037] (-978.666) (-977.870) (-978.570) * [-976.072] (-977.460) (-977.432) (-974.055) -- 0:00:33
457000 -- (-974.967) (-976.752) (-974.557) [-976.654] * [-975.138] (-974.554) (-974.549) (-978.984) -- 0:00:33
457500 -- (-978.419) (-981.774) (-975.204) [-975.063] * (-975.391) [-974.965] (-975.384) (-977.672) -- 0:00:33
458000 -- [-976.892] (-976.164) (-981.068) (-975.973) * [-975.335] (-976.549) (-978.462) (-974.226) -- 0:00:33
458500 -- (-976.204) [-976.102] (-975.932) (-977.408) * [-977.330] (-977.735) (-980.068) (-974.579) -- 0:00:33
459000 -- (-977.179) [-975.210] (-974.842) (-976.393) * [-976.720] (-976.020) (-978.042) (-974.065) -- 0:00:33
459500 -- (-978.425) [-976.191] (-976.236) (-976.651) * (-975.702) (-976.600) (-980.159) [-974.298] -- 0:00:32
460000 -- (-979.141) (-977.134) [-975.771] (-976.196) * (-975.002) (-977.946) [-974.221] (-977.953) -- 0:00:32
Average standard deviation of split frequencies: 0.009913
460500 -- (-977.392) (-976.539) (-978.557) [-978.371] * (-974.139) (-979.377) [-974.822] (-976.046) -- 0:00:32
461000 -- (-976.966) [-977.305] (-974.386) (-974.533) * (-974.509) (-976.539) [-975.339] (-975.614) -- 0:00:32
461500 -- [-977.060] (-974.402) (-974.489) (-974.656) * (-975.200) [-977.779] (-975.146) (-976.987) -- 0:00:32
462000 -- [-976.848] (-974.345) (-977.473) (-974.840) * (-974.914) [-978.510] (-975.446) (-978.090) -- 0:00:32
462500 -- (-975.368) (-974.242) [-975.112] (-974.904) * [-976.498] (-975.137) (-980.147) (-976.943) -- 0:00:32
463000 -- (-976.915) (-974.956) [-978.988] (-974.904) * (-977.763) [-974.901] (-976.680) (-976.291) -- 0:00:32
463500 -- [-973.921] (-977.692) (-978.529) (-976.823) * [-974.337] (-974.137) (-977.181) (-975.707) -- 0:00:32
464000 -- [-973.911] (-978.860) (-976.158) (-976.577) * (-979.333) (-976.265) (-975.686) [-978.762] -- 0:00:32
464500 -- (-976.030) (-977.731) [-975.491] (-975.528) * (-981.797) (-975.025) (-975.387) [-976.128] -- 0:00:33
465000 -- (-975.479) (-975.668) [-976.831] (-977.279) * (-974.488) (-974.632) [-976.150] (-974.903) -- 0:00:33
Average standard deviation of split frequencies: 0.009737
465500 -- (-977.234) (-974.487) (-974.729) [-975.651] * (-978.275) [-977.869] (-975.784) (-975.186) -- 0:00:33
466000 -- (-979.129) (-974.764) (-975.224) [-973.933] * [-975.761] (-977.751) (-978.924) (-974.615) -- 0:00:33
466500 -- [-976.081] (-979.502) (-976.508) (-975.614) * (-976.081) [-978.887] (-976.517) (-974.418) -- 0:00:33
467000 -- [-975.764] (-975.794) (-976.843) (-978.203) * [-976.322] (-976.759) (-975.203) (-974.488) -- 0:00:33
467500 -- (-977.140) [-975.644] (-976.910) (-975.093) * (-975.181) (-976.660) (-976.339) [-974.652] -- 0:00:33
468000 -- (-977.381) (-974.899) (-977.631) [-974.893] * (-976.574) [-975.229] (-976.053) (-977.607) -- 0:00:32
468500 -- (-978.314) (-976.320) [-974.265] (-975.089) * (-976.352) [-976.060] (-975.610) (-979.013) -- 0:00:32
469000 -- [-976.114] (-976.127) (-976.085) (-975.870) * (-977.251) (-986.663) (-980.512) [-976.580] -- 0:00:32
469500 -- (-978.381) (-979.780) (-976.920) [-977.352] * (-977.267) (-977.719) [-979.068] (-974.033) -- 0:00:32
470000 -- (-978.246) (-977.601) [-977.711] (-979.483) * (-975.027) (-976.068) (-978.376) [-975.458] -- 0:00:32
Average standard deviation of split frequencies: 0.010016
470500 -- (-978.480) (-975.359) (-976.129) [-976.018] * (-976.577) (-976.390) [-975.790] (-977.422) -- 0:00:32
471000 -- [-976.276] (-974.154) (-975.069) (-977.345) * (-975.276) (-975.081) [-974.266] (-978.807) -- 0:00:32
471500 -- (-977.499) [-974.835] (-982.069) (-976.452) * [-976.397] (-975.826) (-976.652) (-978.667) -- 0:00:32
472000 -- (-978.108) (-974.281) (-980.480) [-977.467] * (-983.216) (-979.514) (-976.300) [-976.696] -- 0:00:32
472500 -- (-977.742) (-974.264) (-976.843) [-978.373] * (-977.445) [-977.004] (-975.676) (-973.901) -- 0:00:32
473000 -- (-980.770) (-975.761) [-975.743] (-976.738) * (-974.926) (-975.761) [-976.663] (-975.765) -- 0:00:32
473500 -- (-975.788) (-974.240) (-977.342) [-975.807] * (-975.060) (-976.924) (-981.565) [-974.982] -- 0:00:32
474000 -- (-975.455) [-975.466] (-976.913) (-976.010) * [-977.139] (-978.257) (-981.250) (-974.894) -- 0:00:32
474500 -- (-976.426) (-981.998) [-976.217] (-977.560) * [-978.969] (-976.134) (-978.362) (-975.802) -- 0:00:32
475000 -- (-976.798) (-974.703) (-982.598) [-974.531] * (-976.371) (-975.660) [-978.548] (-975.808) -- 0:00:32
Average standard deviation of split frequencies: 0.010089
475500 -- (-975.697) (-978.253) [-979.523] (-976.194) * (-977.132) (-976.790) [-975.467] (-975.797) -- 0:00:31
476000 -- [-978.638] (-976.869) (-980.267) (-976.457) * (-976.030) [-977.136] (-974.049) (-975.525) -- 0:00:31
476500 -- (-975.636) [-980.482] (-977.482) (-977.330) * (-977.223) (-974.902) [-975.474] (-975.913) -- 0:00:31
477000 -- (-975.233) (-975.836) [-977.482] (-974.984) * (-978.972) (-978.130) (-977.789) [-977.326] -- 0:00:31
477500 -- (-975.632) (-977.173) (-978.751) [-979.006] * (-975.143) (-975.311) [-979.428] (-977.846) -- 0:00:31
478000 -- (-974.640) (-982.712) [-975.225] (-975.083) * (-975.629) [-974.647] (-978.384) (-979.003) -- 0:00:31
478500 -- (-977.003) (-977.704) [-975.545] (-978.365) * (-974.940) (-974.130) [-976.904] (-976.689) -- 0:00:31
479000 -- (-976.114) (-977.748) (-974.646) [-975.073] * (-976.343) [-976.336] (-975.711) (-974.049) -- 0:00:31
479500 -- (-974.381) [-975.807] (-974.143) (-976.690) * (-976.188) (-979.376) [-980.944] (-975.937) -- 0:00:31
480000 -- [-974.373] (-977.674) (-976.195) (-978.437) * (-976.407) (-974.686) [-978.441] (-977.887) -- 0:00:31
Average standard deviation of split frequencies: 0.009807
480500 -- [-975.408] (-979.046) (-977.692) (-976.174) * [-977.049] (-974.482) (-977.098) (-976.810) -- 0:00:31
481000 -- [-974.959] (-979.036) (-976.089) (-977.760) * (-977.178) (-975.926) (-973.754) [-977.376] -- 0:00:32
481500 -- (-976.546) [-975.780] (-975.227) (-978.040) * (-982.132) [-973.790] (-975.499) (-974.771) -- 0:00:32
482000 -- [-976.030] (-975.638) (-975.248) (-981.501) * (-976.303) (-976.780) [-975.824] (-975.852) -- 0:00:32
482500 -- (-977.456) [-976.552] (-976.798) (-983.791) * (-974.642) [-974.767] (-977.285) (-975.028) -- 0:00:32
483000 -- (-975.823) [-976.514] (-978.187) (-978.689) * (-977.975) (-975.322) (-978.045) [-975.110] -- 0:00:32
483500 -- (-980.950) (-978.429) [-976.644] (-974.108) * (-975.671) (-974.574) (-978.913) [-975.951] -- 0:00:32
484000 -- (-976.790) (-976.436) (-976.062) [-975.001] * [-977.346] (-974.058) (-975.652) (-978.194) -- 0:00:31
484500 -- (-978.263) (-977.626) [-976.818] (-976.084) * (-974.105) (-977.060) (-975.081) [-975.954] -- 0:00:31
485000 -- [-985.901] (-984.186) (-982.938) (-976.097) * (-976.095) [-974.797] (-974.954) (-978.564) -- 0:00:31
Average standard deviation of split frequencies: 0.009928
485500 -- (-976.144) (-974.661) [-974.904] (-974.807) * (-975.671) (-974.951) (-974.037) [-976.969] -- 0:00:31
486000 -- [-978.496] (-975.605) (-974.265) (-977.583) * (-978.016) [-976.073] (-982.160) (-976.715) -- 0:00:31
486500 -- (-977.289) (-977.828) (-974.990) [-976.730] * [-977.447] (-975.199) (-979.931) (-974.711) -- 0:00:31
487000 -- (-975.942) (-977.129) [-975.762] (-975.400) * [-975.744] (-976.170) (-976.244) (-978.667) -- 0:00:31
487500 -- [-977.708] (-975.293) (-975.136) (-974.076) * (-976.335) [-974.693] (-976.784) (-976.149) -- 0:00:31
488000 -- (-977.347) (-976.179) (-978.613) [-975.854] * [-974.627] (-973.956) (-975.773) (-975.631) -- 0:00:31
488500 -- (-976.210) (-978.685) (-976.871) [-974.593] * (-978.866) (-975.743) [-975.159] (-977.158) -- 0:00:31
489000 -- (-975.491) (-977.142) [-977.969] (-975.858) * (-975.721) (-975.848) [-975.247] (-975.254) -- 0:00:31
489500 -- [-974.722] (-977.598) (-980.527) (-976.243) * (-974.681) [-979.321] (-975.339) (-975.969) -- 0:00:31
490000 -- [-979.204] (-978.698) (-984.976) (-976.569) * (-974.806) [-976.929] (-975.683) (-974.429) -- 0:00:31
Average standard deviation of split frequencies: 0.009833
490500 -- [-977.451] (-976.271) (-978.762) (-977.395) * (-974.034) [-975.318] (-976.682) (-974.622) -- 0:00:31
491000 -- (-977.524) (-977.323) (-975.593) [-976.514] * (-977.119) [-975.324] (-976.516) (-974.579) -- 0:00:31
491500 -- (-980.273) (-977.023) [-979.108] (-974.320) * (-976.393) (-975.701) [-975.305] (-978.345) -- 0:00:31
492000 -- (-975.543) (-974.814) (-978.050) [-975.155] * [-974.907] (-974.786) (-977.776) (-975.677) -- 0:00:30
492500 -- (-976.346) (-974.358) (-977.119) [-980.088] * (-980.617) (-974.749) [-975.882] (-979.839) -- 0:00:30
493000 -- (-977.434) (-977.314) [-976.068] (-976.187) * (-976.519) [-981.098] (-975.515) (-974.726) -- 0:00:30
493500 -- (-978.215) [-976.377] (-975.497) (-975.338) * (-977.749) (-982.176) [-976.368] (-976.384) -- 0:00:30
494000 -- (-979.288) (-975.201) (-977.404) [-974.455] * (-980.084) [-977.213] (-977.797) (-977.534) -- 0:00:30
494500 -- [-980.159] (-976.532) (-975.534) (-975.030) * [-974.736] (-980.043) (-977.565) (-976.904) -- 0:00:30
495000 -- (-977.637) [-975.860] (-978.288) (-974.675) * [-980.904] (-977.910) (-976.259) (-976.245) -- 0:00:30
Average standard deviation of split frequencies: 0.009682
495500 -- (-979.869) (-975.660) [-977.343] (-976.361) * (-975.237) (-977.459) (-975.281) [-977.168] -- 0:00:30
496000 -- (-982.628) (-975.031) (-977.515) [-978.833] * (-975.414) (-977.039) (-976.197) [-976.551] -- 0:00:31
496500 -- (-981.144) [-975.321] (-975.522) (-979.187) * [-975.405] (-981.354) (-976.402) (-973.841) -- 0:00:31
497000 -- (-979.424) [-977.818] (-977.721) (-975.783) * (-975.215) (-974.658) (-976.154) [-974.755] -- 0:00:31
497500 -- (-975.348) (-977.882) [-975.186] (-976.420) * (-976.979) (-976.645) (-981.460) [-975.230] -- 0:00:31
498000 -- (-976.093) (-978.122) [-974.772] (-976.176) * (-977.572) [-975.236] (-977.099) (-975.599) -- 0:00:31
498500 -- [-975.135] (-978.469) (-974.278) (-974.781) * (-980.907) (-976.544) (-977.274) [-973.996] -- 0:00:31
499000 -- (-975.782) (-975.471) [-975.873] (-978.181) * (-976.787) (-978.249) [-975.041] (-977.826) -- 0:00:31
499500 -- (-974.537) (-975.096) [-975.998] (-984.468) * (-975.296) (-977.058) (-975.702) [-976.380] -- 0:00:31
500000 -- (-974.919) (-977.987) [-975.138] (-974.739) * [-975.638] (-975.574) (-975.004) (-975.438) -- 0:00:31
Average standard deviation of split frequencies: 0.009533
500500 -- (-976.737) (-977.237) (-976.634) [-974.808] * (-978.935) [-977.941] (-974.869) (-975.390) -- 0:00:30
501000 -- [-975.950] (-978.800) (-976.561) (-976.085) * (-980.901) (-976.121) (-974.575) [-976.080] -- 0:00:30
501500 -- [-980.383] (-978.789) (-977.722) (-975.617) * (-975.101) [-975.918] (-975.252) (-981.006) -- 0:00:30
502000 -- (-976.585) [-976.459] (-975.490) (-980.913) * [-975.679] (-976.752) (-976.539) (-976.603) -- 0:00:30
502500 -- (-975.988) (-976.515) [-976.378] (-974.996) * (-975.202) (-977.934) [-976.185] (-978.553) -- 0:00:30
503000 -- (-978.853) (-977.112) (-976.333) [-977.529] * (-980.279) (-975.483) (-976.371) [-976.834] -- 0:00:30
503500 -- (-980.617) (-976.858) [-976.769] (-977.579) * (-974.063) (-976.292) [-974.317] (-980.917) -- 0:00:30
504000 -- [-977.121] (-981.027) (-977.007) (-977.712) * (-975.423) (-976.787) [-976.036] (-980.877) -- 0:00:30
504500 -- (-975.327) (-976.805) (-976.094) [-975.774] * (-980.423) [-974.706] (-977.748) (-978.574) -- 0:00:30
505000 -- (-975.173) [-975.212] (-979.445) (-981.521) * (-976.137) [-977.295] (-975.537) (-977.119) -- 0:00:30
Average standard deviation of split frequencies: 0.009549
505500 -- (-975.701) [-974.964] (-978.059) (-975.671) * (-976.877) (-982.345) [-975.102] (-979.638) -- 0:00:30
506000 -- (-975.807) [-976.773] (-977.447) (-975.671) * (-976.204) (-978.607) [-978.635] (-976.147) -- 0:00:30
506500 -- (-975.084) (-974.599) [-979.655] (-975.834) * (-974.579) (-976.951) [-975.211] (-978.726) -- 0:00:30
507000 -- (-974.402) (-976.962) (-978.551) [-975.726] * [-977.899] (-976.505) (-975.002) (-976.890) -- 0:00:30
507500 -- (-975.227) (-975.611) [-975.982] (-975.541) * [-976.695] (-976.705) (-974.620) (-976.798) -- 0:00:30
508000 -- (-975.839) (-976.138) [-977.977] (-975.525) * (-977.034) (-976.816) [-975.770] (-976.178) -- 0:00:30
508500 -- (-978.063) [-976.073] (-978.471) (-976.647) * (-977.741) (-975.490) [-978.062] (-975.443) -- 0:00:29
509000 -- (-984.218) (-975.369) (-974.884) [-974.565] * [-977.426] (-975.724) (-975.397) (-975.766) -- 0:00:29
509500 -- (-979.160) (-976.120) [-975.717] (-974.556) * [-975.736] (-982.557) (-974.128) (-977.892) -- 0:00:30
510000 -- (-978.399) (-974.275) (-974.709) [-975.447] * (-975.956) [-976.203] (-978.993) (-979.420) -- 0:00:30
Average standard deviation of split frequencies: 0.010209
510500 -- (-976.095) [-974.415] (-974.806) (-978.854) * [-976.266] (-974.894) (-974.349) (-975.485) -- 0:00:30
511000 -- [-975.827] (-977.812) (-975.612) (-976.323) * (-976.582) (-983.530) (-975.796) [-975.834] -- 0:00:30
511500 -- [-975.522] (-976.252) (-974.982) (-975.785) * (-978.499) (-977.758) [-977.671] (-976.394) -- 0:00:30
512000 -- [-977.947] (-975.897) (-974.375) (-978.523) * (-975.564) [-975.611] (-975.810) (-975.216) -- 0:00:30
512500 -- [-974.514] (-978.608) (-974.413) (-975.291) * (-976.763) (-976.990) (-974.832) [-977.162] -- 0:00:30
513000 -- (-976.460) (-976.120) (-978.521) [-974.002] * (-975.082) (-973.921) (-976.823) [-975.495] -- 0:00:30
513500 -- (-975.624) (-976.202) (-975.444) [-976.271] * (-974.575) (-976.473) (-975.478) [-976.368] -- 0:00:30
514000 -- (-977.418) (-975.528) [-974.972] (-975.827) * [-974.567] (-975.766) (-975.662) (-974.081) -- 0:00:30
514500 -- (-974.748) [-976.375] (-979.911) (-980.527) * [-975.246] (-977.315) (-977.729) (-976.983) -- 0:00:30
515000 -- (-975.818) (-975.757) [-977.473] (-974.866) * [-974.281] (-977.098) (-975.985) (-977.443) -- 0:00:30
Average standard deviation of split frequencies: 0.009707
515500 -- (-975.309) (-976.130) [-975.579] (-976.113) * [-976.149] (-975.564) (-974.166) (-978.476) -- 0:00:30
516000 -- (-975.321) (-974.374) (-976.575) [-974.236] * [-980.211] (-978.874) (-975.295) (-978.454) -- 0:00:30
516500 -- (-974.294) [-976.506] (-976.594) (-974.445) * (-977.507) [-975.055] (-975.698) (-975.433) -- 0:00:29
517000 -- [-974.143] (-979.991) (-974.873) (-974.671) * (-976.795) [-975.738] (-980.052) (-975.660) -- 0:00:29
517500 -- [-974.420] (-980.422) (-974.511) (-977.542) * (-975.088) [-976.831] (-978.770) (-982.378) -- 0:00:29
518000 -- (-976.035) (-976.311) (-974.126) [-976.468] * (-974.651) (-976.904) (-977.028) [-978.594] -- 0:00:29
518500 -- [-973.930] (-976.060) (-976.072) (-975.750) * [-977.479] (-975.625) (-974.117) (-976.485) -- 0:00:29
519000 -- (-975.702) [-974.624] (-975.111) (-976.706) * (-978.457) (-978.163) (-974.152) [-974.592] -- 0:00:29
519500 -- [-975.813] (-977.118) (-974.881) (-976.973) * (-979.005) (-980.839) [-975.217] (-976.642) -- 0:00:29
520000 -- [-974.779] (-977.097) (-976.301) (-978.883) * (-979.805) (-975.612) [-974.342] (-979.859) -- 0:00:29
Average standard deviation of split frequencies: 0.009620
520500 -- (-976.092) [-978.226] (-975.322) (-975.960) * (-976.935) [-974.534] (-976.562) (-974.668) -- 0:00:29
521000 -- [-975.949] (-974.732) (-975.764) (-978.287) * (-977.254) [-975.143] (-977.389) (-975.181) -- 0:00:29
521500 -- (-975.482) (-980.285) (-974.635) [-974.181] * [-975.660] (-976.134) (-974.089) (-976.654) -- 0:00:29
522000 -- (-975.003) (-979.697) (-974.409) [-975.050] * (-975.915) [-978.569] (-974.801) (-976.270) -- 0:00:30
522500 -- (-977.032) (-975.915) (-975.356) [-974.416] * (-977.216) [-976.579] (-975.834) (-976.073) -- 0:00:30
523000 -- [-976.330] (-977.887) (-977.048) (-974.197) * (-974.170) (-976.055) (-976.127) [-977.738] -- 0:00:30
523500 -- (-977.972) (-976.652) [-976.949] (-977.147) * (-976.833) (-974.319) [-973.994] (-977.510) -- 0:00:30
524000 -- [-974.724] (-977.618) (-976.898) (-976.000) * (-976.659) (-974.075) [-977.360] (-976.412) -- 0:00:29
524500 -- (-977.109) [-978.261] (-978.746) (-975.930) * (-977.570) [-980.481] (-977.050) (-975.775) -- 0:00:29
525000 -- (-979.802) (-975.687) [-977.028] (-978.404) * (-976.416) [-976.477] (-978.591) (-977.050) -- 0:00:29
Average standard deviation of split frequencies: 0.009226
525500 -- (-978.470) (-977.457) (-974.949) [-976.531] * (-977.941) (-975.779) (-978.910) [-975.838] -- 0:00:29
526000 -- (-976.089) (-976.731) (-974.660) [-974.927] * (-976.386) (-974.493) [-976.499] (-975.729) -- 0:00:29
526500 -- [-974.671] (-976.806) (-974.198) (-977.621) * (-977.487) (-974.277) [-975.126] (-975.261) -- 0:00:29
527000 -- (-975.917) (-980.800) (-975.231) [-974.402] * [-974.943] (-977.933) (-975.198) (-975.105) -- 0:00:29
527500 -- [-978.195] (-975.231) (-974.698) (-980.041) * (-974.891) (-977.471) (-979.714) [-977.126] -- 0:00:29
528000 -- [-978.932] (-976.164) (-974.857) (-980.495) * (-975.696) [-981.638] (-977.750) (-975.375) -- 0:00:29
528500 -- (-976.731) [-981.456] (-975.777) (-979.754) * (-975.945) (-975.061) (-974.554) [-975.151] -- 0:00:29
529000 -- (-978.104) (-982.753) (-975.772) [-975.810] * (-975.497) (-976.520) [-978.066] (-976.440) -- 0:00:29
529500 -- [-975.213] (-976.297) (-976.025) (-981.073) * (-975.300) (-976.792) (-974.849) [-977.246] -- 0:00:29
530000 -- (-975.339) [-975.728] (-976.479) (-974.752) * (-975.229) [-975.707] (-975.672) (-977.610) -- 0:00:29
Average standard deviation of split frequencies: 0.009667
530500 -- (-975.720) [-975.512] (-976.218) (-977.903) * (-977.579) (-980.465) [-974.413] (-974.957) -- 0:00:29
531000 -- (-977.332) (-977.148) (-980.239) [-974.827] * (-977.864) (-978.360) [-974.362] (-976.654) -- 0:00:29
531500 -- [-975.144] (-975.421) (-978.548) (-977.271) * (-977.910) (-978.969) (-977.493) [-978.323] -- 0:00:29
532000 -- [-975.322] (-980.058) (-976.754) (-977.670) * [-974.740] (-977.787) (-976.662) (-980.311) -- 0:00:29
532500 -- [-974.897] (-975.180) (-977.627) (-975.701) * (-974.144) (-978.832) [-975.730] (-976.029) -- 0:00:28
533000 -- (-975.558) [-974.604] (-983.538) (-975.625) * (-979.059) (-977.615) (-975.854) [-976.909] -- 0:00:28
533500 -- (-976.992) [-974.315] (-975.813) (-974.581) * (-985.316) [-976.404] (-973.927) (-977.656) -- 0:00:28
534000 -- (-976.341) (-980.560) [-975.069] (-974.590) * [-976.160] (-977.585) (-974.885) (-974.327) -- 0:00:28
534500 -- (-974.484) [-979.488] (-976.835) (-975.079) * (-978.853) (-976.908) [-975.627] (-977.246) -- 0:00:28
535000 -- (-975.910) (-979.028) (-976.180) [-975.067] * [-974.894] (-979.132) (-976.470) (-976.006) -- 0:00:29
Average standard deviation of split frequencies: 0.009312
535500 -- (-977.930) [-981.884] (-974.591) (-977.283) * (-977.314) (-978.711) (-975.221) [-976.960] -- 0:00:29
536000 -- (-975.349) [-974.283] (-975.025) (-973.993) * (-978.415) (-978.570) [-978.614] (-977.001) -- 0:00:29
536500 -- (-974.605) (-974.974) (-975.722) [-978.793] * (-974.313) [-975.887] (-977.165) (-977.456) -- 0:00:29
537000 -- (-974.909) (-976.319) [-975.551] (-978.502) * (-974.896) (-974.869) (-978.663) [-977.815] -- 0:00:29
537500 -- (-975.741) [-974.684] (-977.754) (-981.783) * (-975.090) [-975.133] (-979.567) (-975.813) -- 0:00:29
538000 -- (-979.945) [-974.225] (-976.467) (-978.140) * (-974.386) (-976.830) [-976.254] (-976.619) -- 0:00:29
538500 -- [-977.980] (-978.848) (-974.428) (-976.626) * (-973.997) [-974.193] (-974.423) (-974.808) -- 0:00:29
539000 -- [-975.947] (-977.345) (-974.403) (-980.873) * (-975.785) [-973.748] (-977.421) (-976.138) -- 0:00:29
539500 -- (-974.455) (-975.142) (-975.759) [-975.575] * [-974.126] (-975.368) (-978.553) (-974.104) -- 0:00:29
540000 -- [-978.660] (-974.316) (-975.469) (-977.520) * (-976.151) [-976.482] (-975.075) (-977.506) -- 0:00:28
Average standard deviation of split frequencies: 0.008773
540500 -- (-976.622) (-975.980) [-975.574] (-977.414) * (-979.720) (-975.773) [-975.398] (-978.086) -- 0:00:28
541000 -- [-975.252] (-976.053) (-979.598) (-979.154) * (-979.617) (-975.050) [-975.490] (-977.079) -- 0:00:28
541500 -- (-979.627) [-975.455] (-974.877) (-978.946) * (-977.701) (-974.677) [-976.239] (-976.875) -- 0:00:28
542000 -- (-977.736) (-977.052) (-975.302) [-978.011] * [-980.176] (-975.295) (-976.149) (-979.362) -- 0:00:28
542500 -- [-974.330] (-976.430) (-976.930) (-975.725) * (-976.945) (-975.599) [-977.015] (-975.588) -- 0:00:28
543000 -- [-976.159] (-977.248) (-977.922) (-980.070) * (-974.673) (-977.963) (-976.761) [-975.605] -- 0:00:28
543500 -- (-974.134) (-977.630) (-974.713) [-974.296] * (-981.841) [-978.556] (-974.683) (-976.136) -- 0:00:28
544000 -- (-975.568) (-977.625) [-974.827] (-974.971) * (-976.667) (-980.587) [-974.737] (-976.168) -- 0:00:28
544500 -- [-976.443] (-975.549) (-975.968) (-976.820) * (-976.959) [-975.920] (-975.018) (-976.089) -- 0:00:28
545000 -- (-979.287) (-975.597) (-976.263) [-975.768] * (-975.042) [-974.029] (-977.805) (-974.880) -- 0:00:28
Average standard deviation of split frequencies: 0.008481
545500 -- (-975.441) [-977.006] (-976.435) (-974.345) * (-975.894) [-976.416] (-977.012) (-976.377) -- 0:00:28
546000 -- [-979.298] (-979.468) (-977.537) (-976.476) * (-977.618) [-977.589] (-976.787) (-977.592) -- 0:00:28
546500 -- (-977.831) (-978.569) [-976.881] (-974.442) * (-978.066) (-978.749) [-980.781] (-976.776) -- 0:00:28
547000 -- [-979.800] (-981.166) (-978.302) (-975.424) * (-977.772) (-977.124) [-975.998] (-976.434) -- 0:00:28
547500 -- (-978.719) (-981.233) [-976.059] (-974.763) * (-977.755) (-977.580) [-976.164] (-981.819) -- 0:00:28
548000 -- (-975.744) (-980.964) (-975.577) [-977.465] * (-975.368) (-978.883) (-978.825) [-980.628] -- 0:00:28
548500 -- (-980.264) [-976.909] (-974.434) (-977.999) * (-976.120) (-977.439) (-976.022) [-977.937] -- 0:00:27
549000 -- [-975.345] (-974.682) (-977.959) (-976.683) * (-974.587) [-976.321] (-976.962) (-976.470) -- 0:00:27
549500 -- (-976.087) (-977.011) (-974.276) [-978.002] * (-974.289) (-977.366) [-975.565] (-977.582) -- 0:00:27
550000 -- [-975.307] (-979.915) (-975.825) (-978.680) * [-976.936] (-979.574) (-974.983) (-978.185) -- 0:00:28
Average standard deviation of split frequencies: 0.008882
550500 -- [-978.826] (-981.072) (-976.413) (-976.092) * (-978.134) (-975.225) [-974.312] (-975.713) -- 0:00:28
551000 -- [-976.808] (-978.159) (-976.328) (-976.005) * [-975.880] (-975.780) (-975.363) (-977.180) -- 0:00:28
551500 -- (-975.668) (-974.192) [-975.213] (-975.348) * (-973.834) (-978.413) [-977.150] (-974.544) -- 0:00:28
552000 -- (-978.395) [-975.939] (-975.526) (-978.566) * (-976.330) (-976.851) [-980.519] (-975.574) -- 0:00:28
552500 -- (-974.438) (-977.369) [-977.012] (-980.924) * (-977.710) (-975.105) (-977.200) [-976.895] -- 0:00:28
553000 -- (-976.757) (-975.657) [-975.054] (-976.423) * [-980.520] (-978.571) (-985.864) (-976.818) -- 0:00:28
553500 -- (-975.312) (-976.558) [-976.299] (-976.839) * (-974.695) (-975.624) (-978.278) [-977.551] -- 0:00:28
554000 -- (-975.947) (-976.221) [-974.683] (-980.461) * [-974.403] (-976.202) (-974.726) (-977.506) -- 0:00:28
554500 -- (-977.323) (-981.967) [-976.166] (-975.334) * [-974.248] (-976.142) (-978.618) (-976.124) -- 0:00:28
555000 -- [-974.772] (-981.390) (-976.820) (-975.655) * (-975.727) (-976.224) (-981.824) [-975.677] -- 0:00:28
Average standard deviation of split frequencies: 0.009044
555500 -- (-974.326) (-979.785) (-975.908) [-976.239] * (-974.728) (-974.765) (-977.801) [-975.532] -- 0:00:28
556000 -- (-975.956) (-976.193) [-976.091] (-975.730) * (-975.055) (-975.482) (-975.403) [-978.880] -- 0:00:27
556500 -- [-975.868] (-976.047) (-975.019) (-974.986) * (-978.702) (-976.465) (-976.910) [-983.136] -- 0:00:27
557000 -- (-975.468) (-976.548) (-974.933) [-976.277] * [-979.148] (-976.922) (-978.199) (-975.009) -- 0:00:27
557500 -- (-977.263) [-975.346] (-977.411) (-978.255) * (-974.618) (-975.881) (-982.976) [-975.595] -- 0:00:27
558000 -- [-976.500] (-975.942) (-975.556) (-975.561) * (-974.969) (-974.264) [-976.500] (-979.066) -- 0:00:27
558500 -- (-976.753) (-976.201) (-974.957) [-975.899] * (-975.610) (-974.241) (-975.617) [-977.215] -- 0:00:27
559000 -- (-976.027) [-974.392] (-977.588) (-975.965) * (-976.356) (-974.990) (-975.879) [-974.607] -- 0:00:27
559500 -- [-975.532] (-975.012) (-976.174) (-977.204) * (-979.224) [-976.942] (-974.716) (-975.217) -- 0:00:27
560000 -- (-977.935) (-974.471) [-975.805] (-977.379) * (-978.993) (-979.342) (-977.971) [-975.018] -- 0:00:27
Average standard deviation of split frequencies: 0.009091
560500 -- (-977.025) (-979.089) [-975.803] (-975.120) * (-976.164) (-974.782) (-974.857) [-974.820] -- 0:00:27
561000 -- (-977.152) (-974.645) (-976.481) [-974.928] * (-976.126) (-976.174) [-976.286] (-976.077) -- 0:00:27
561500 -- (-976.680) (-975.913) [-974.578] (-977.583) * (-975.432) (-981.790) [-974.466] (-977.898) -- 0:00:27
562000 -- (-976.753) (-975.021) [-975.171] (-974.866) * (-979.591) (-976.364) [-976.769] (-976.029) -- 0:00:27
562500 -- (-975.642) (-975.978) (-976.422) [-975.282] * (-977.609) (-977.990) [-974.537] (-978.985) -- 0:00:27
563000 -- (-976.671) (-976.806) [-974.001] (-974.694) * (-975.376) (-975.476) (-975.202) [-975.510] -- 0:00:27
563500 -- (-976.381) [-974.816] (-978.005) (-976.845) * (-977.897) (-975.352) (-975.317) [-975.004] -- 0:00:27
564000 -- (-976.617) (-975.505) (-976.839) [-977.767] * (-978.087) (-976.391) [-974.846] (-974.483) -- 0:00:27
564500 -- (-976.271) (-978.234) [-976.495] (-975.956) * (-978.741) [-975.787] (-974.752) (-973.949) -- 0:00:27
565000 -- (-974.438) (-978.009) (-979.303) [-975.835] * (-974.288) (-980.017) [-978.689] (-975.912) -- 0:00:27
Average standard deviation of split frequencies: 0.008277
565500 -- (-974.662) (-974.814) (-980.077) [-975.318] * [-974.426] (-975.956) (-976.580) (-978.447) -- 0:00:27
566000 -- (-978.210) (-975.373) [-975.250] (-974.873) * [-975.640] (-974.915) (-979.134) (-977.078) -- 0:00:27
566500 -- [-975.782] (-978.963) (-976.657) (-974.934) * [-975.944] (-973.853) (-975.903) (-978.713) -- 0:00:27
567000 -- [-976.270] (-979.604) (-977.803) (-977.221) * (-980.192) (-975.473) (-975.759) [-977.143] -- 0:00:27
567500 -- (-978.782) (-976.629) (-980.422) [-974.633] * [-979.013] (-975.987) (-975.118) (-977.146) -- 0:00:27
568000 -- (-974.447) (-974.748) [-978.604] (-977.168) * (-976.751) (-976.619) (-975.864) [-977.930] -- 0:00:27
568500 -- (-974.813) (-975.059) (-976.873) [-974.361] * (-976.593) (-977.700) [-975.611] (-977.595) -- 0:00:27
569000 -- (-980.149) [-976.057] (-976.789) (-976.371) * [-975.739] (-979.034) (-976.692) (-975.258) -- 0:00:27
569500 -- [-977.479] (-975.704) (-978.344) (-974.987) * (-975.188) (-977.504) (-976.477) [-975.760] -- 0:00:27
570000 -- (-974.696) [-974.690] (-979.259) (-975.585) * (-978.226) (-976.707) [-974.568] (-976.060) -- 0:00:27
Average standard deviation of split frequencies: 0.007331
570500 -- (-976.225) [-977.173] (-974.652) (-975.451) * (-977.083) (-976.485) [-974.937] (-977.527) -- 0:00:27
571000 -- (-977.413) [-974.519] (-978.134) (-976.681) * (-977.738) [-976.955] (-974.695) (-975.225) -- 0:00:27
571500 -- (-976.367) [-975.005] (-977.418) (-975.413) * (-976.330) (-976.584) (-974.714) [-974.951] -- 0:00:26
572000 -- (-975.498) (-974.562) [-974.551] (-973.973) * (-976.552) (-978.000) [-975.710] (-976.355) -- 0:00:26
572500 -- (-977.633) (-974.764) [-975.142] (-974.272) * [-974.628] (-975.529) (-974.562) (-980.028) -- 0:00:26
573000 -- (-980.269) [-976.486] (-974.945) (-980.235) * [-975.180] (-975.210) (-976.307) (-981.083) -- 0:00:26
573500 -- (-980.166) (-975.928) (-974.031) [-976.627] * (-976.187) (-975.651) (-975.706) [-976.067] -- 0:00:26
574000 -- (-984.214) [-975.887] (-978.382) (-978.615) * (-978.026) (-975.904) (-976.998) [-976.065] -- 0:00:26
574500 -- [-983.568] (-977.338) (-978.579) (-975.970) * (-975.242) [-975.256] (-974.061) (-975.937) -- 0:00:26
575000 -- [-977.223] (-975.317) (-975.544) (-975.037) * (-977.059) [-975.017] (-977.122) (-976.736) -- 0:00:26
Average standard deviation of split frequencies: 0.006766
575500 -- (-977.192) [-979.542] (-978.180) (-974.928) * (-978.384) (-975.166) [-975.099] (-976.368) -- 0:00:26
576000 -- [-976.241] (-974.386) (-976.459) (-974.918) * [-977.625] (-976.785) (-978.086) (-977.650) -- 0:00:26
576500 -- (-979.677) (-976.612) [-977.545] (-977.019) * (-976.571) (-974.102) (-977.768) [-976.190] -- 0:00:26
577000 -- (-979.749) (-975.127) [-976.841] (-977.182) * [-975.066] (-974.104) (-982.120) (-977.653) -- 0:00:26
577500 -- (-974.548) (-976.114) [-973.896] (-979.752) * (-978.815) [-975.879] (-979.071) (-976.750) -- 0:00:26
578000 -- (-976.756) (-975.111) (-974.490) [-976.686] * (-978.061) [-977.408] (-983.397) (-975.342) -- 0:00:26
578500 -- (-975.201) [-974.324] (-974.675) (-977.309) * (-977.782) (-975.810) (-979.011) [-977.012] -- 0:00:26
579000 -- [-977.321] (-975.180) (-978.079) (-976.299) * (-974.457) (-978.480) (-975.927) [-977.121] -- 0:00:26
579500 -- (-975.352) (-976.190) (-975.102) [-974.833] * (-978.583) (-977.883) [-977.799] (-976.343) -- 0:00:26
580000 -- [-975.324] (-977.046) (-976.866) (-976.004) * (-977.153) [-977.417] (-975.580) (-975.354) -- 0:00:26
Average standard deviation of split frequencies: 0.007865
580500 -- [-975.854] (-976.176) (-976.442) (-974.002) * (-975.957) (-976.248) [-976.257] (-974.020) -- 0:00:26
581000 -- (-977.550) (-975.060) [-975.521] (-974.583) * (-980.859) (-979.058) (-974.755) [-974.870] -- 0:00:26
581500 -- [-975.949] (-974.531) (-975.136) (-976.817) * [-977.350] (-978.198) (-977.583) (-974.290) -- 0:00:26
582000 -- [-976.413] (-976.689) (-975.550) (-977.281) * [-976.140] (-975.743) (-974.940) (-975.499) -- 0:00:26
582500 -- (-977.173) [-974.859] (-977.471) (-982.301) * (-979.737) [-974.597] (-974.535) (-975.975) -- 0:00:26
583000 -- (-976.840) [-975.335] (-977.596) (-978.265) * (-975.786) [-978.531] (-974.490) (-976.604) -- 0:00:26
583500 -- [-976.774] (-980.389) (-976.070) (-976.290) * (-974.675) [-975.046] (-974.125) (-975.083) -- 0:00:26
584000 -- (-974.392) (-982.707) (-975.728) [-976.724] * (-975.215) (-977.380) (-977.507) [-977.284] -- 0:00:26
584500 -- (-977.853) [-976.239] (-980.047) (-980.724) * (-975.629) (-975.362) (-976.943) [-975.525] -- 0:00:26
585000 -- (-978.447) (-977.174) (-977.426) [-974.253] * (-976.208) [-975.476] (-975.385) (-977.356) -- 0:00:26
Average standard deviation of split frequencies: 0.007994
585500 -- (-976.397) (-977.864) [-974.794] (-974.349) * (-974.794) (-975.818) [-974.244] (-983.649) -- 0:00:26
586000 -- (-974.501) (-977.034) (-976.958) [-978.048] * (-982.507) (-976.378) (-974.122) [-975.601] -- 0:00:26
586500 -- [-974.818] (-976.104) (-975.044) (-978.744) * (-975.331) (-975.517) (-974.692) [-976.641] -- 0:00:26
587000 -- (-977.985) (-976.883) [-975.135] (-975.211) * (-975.411) (-979.288) [-975.295] (-976.573) -- 0:00:26
587500 -- [-977.289] (-980.007) (-975.892) (-976.159) * (-975.821) [-978.882] (-979.955) (-976.973) -- 0:00:25
588000 -- [-981.421] (-980.816) (-977.743) (-978.276) * [-977.135] (-980.545) (-978.005) (-974.771) -- 0:00:25
588500 -- [-976.449] (-978.559) (-974.548) (-977.608) * (-974.579) (-975.747) (-976.642) [-976.887] -- 0:00:25
589000 -- [-975.385] (-974.722) (-975.094) (-974.797) * (-975.452) (-979.561) [-977.525] (-977.501) -- 0:00:25
589500 -- (-975.766) [-974.185] (-976.967) (-977.281) * (-976.372) (-977.252) (-977.078) [-974.704] -- 0:00:25
590000 -- (-977.495) [-974.557] (-977.822) (-974.578) * (-977.573) (-976.519) (-977.273) [-974.648] -- 0:00:25
Average standard deviation of split frequencies: 0.007931
590500 -- (-975.474) (-976.970) (-975.756) [-975.342] * [-975.557] (-975.188) (-975.526) (-975.746) -- 0:00:25
591000 -- (-974.752) (-976.757) [-974.223] (-975.671) * (-979.102) (-974.999) [-975.913] (-977.786) -- 0:00:26
591500 -- (-976.014) [-978.157] (-976.661) (-976.298) * (-974.970) [-977.272] (-976.059) (-978.351) -- 0:00:26
592000 -- (-977.207) (-977.953) (-975.517) [-975.514] * (-976.238) (-975.998) (-977.133) [-975.229] -- 0:00:26
592500 -- (-975.586) (-978.713) (-978.259) [-975.510] * [-976.675] (-976.025) (-980.211) (-975.149) -- 0:00:26
593000 -- (-975.698) (-975.475) (-976.824) [-977.722] * (-977.080) (-976.117) (-980.035) [-974.372] -- 0:00:26
593500 -- (-974.374) (-974.490) (-977.881) [-975.848] * (-976.661) (-976.167) [-976.374] (-978.090) -- 0:00:26
594000 -- (-975.620) (-974.330) (-977.045) [-975.083] * [-975.349] (-977.154) (-977.163) (-975.401) -- 0:00:25
594500 -- (-974.741) (-976.626) (-976.845) [-979.208] * (-980.846) [-976.216] (-980.763) (-976.761) -- 0:00:25
595000 -- (-975.513) (-975.513) (-978.477) [-977.338] * (-975.653) (-975.721) (-977.049) [-974.457] -- 0:00:25
Average standard deviation of split frequencies: 0.007491
595500 -- (-975.721) (-978.798) [-978.367] (-974.496) * (-976.585) (-981.754) [-975.358] (-974.183) -- 0:00:25
596000 -- (-977.830) (-976.898) (-981.648) [-974.641] * (-976.522) (-979.492) (-975.594) [-975.748] -- 0:00:25
596500 -- [-976.189] (-975.993) (-975.348) (-975.829) * (-974.872) (-980.735) (-978.172) [-975.262] -- 0:00:25
597000 -- (-976.442) (-975.441) (-978.280) [-976.503] * (-977.821) [-974.968] (-977.855) (-977.334) -- 0:00:25
597500 -- [-976.515] (-974.994) (-978.950) (-974.805) * [-979.072] (-977.127) (-975.107) (-976.783) -- 0:00:25
598000 -- (-975.171) (-974.695) [-976.609] (-976.256) * (-976.686) (-975.383) [-975.007] (-976.430) -- 0:00:25
598500 -- (-974.480) (-976.435) (-976.367) [-975.427] * (-976.082) (-974.494) (-975.961) [-977.334] -- 0:00:25
599000 -- (-974.842) (-976.058) (-977.049) [-975.874] * (-976.405) [-974.429] (-979.047) (-975.514) -- 0:00:25
599500 -- [-974.881] (-975.651) (-976.178) (-975.702) * (-976.746) (-974.565) (-974.540) [-977.485] -- 0:00:25
600000 -- [-974.747] (-978.815) (-975.274) (-974.039) * (-977.531) (-975.643) (-974.308) [-974.713] -- 0:00:25
Average standard deviation of split frequencies: 0.007202
600500 -- (-975.331) (-975.982) (-975.424) [-974.217] * (-981.399) [-974.797] (-974.551) (-977.496) -- 0:00:25
601000 -- (-976.927) (-976.025) [-975.797] (-977.414) * (-979.097) (-974.161) (-974.229) [-977.373] -- 0:00:25
601500 -- (-975.858) (-974.962) [-975.337] (-977.215) * [-975.300] (-975.731) (-974.648) (-974.472) -- 0:00:25
602000 -- (-975.007) [-974.870] (-975.220) (-978.493) * [-974.516] (-982.396) (-974.114) (-974.639) -- 0:00:25
602500 -- (-979.101) [-977.528] (-978.589) (-975.088) * (-977.682) (-976.076) (-974.490) [-981.278] -- 0:00:25
603000 -- [-977.633] (-977.057) (-978.133) (-974.014) * (-981.483) (-975.093) [-973.916] (-974.712) -- 0:00:25
603500 -- (-975.881) [-976.872] (-977.934) (-974.002) * (-979.495) (-977.385) (-974.088) [-974.690] -- 0:00:24
604000 -- (-978.816) [-976.318] (-975.777) (-973.920) * (-974.911) [-975.200] (-978.315) (-975.577) -- 0:00:24
604500 -- (-976.015) (-975.186) (-978.526) [-974.369] * (-978.152) [-976.249] (-974.966) (-976.456) -- 0:00:24
605000 -- (-976.625) (-977.973) (-977.934) [-974.364] * [-978.562] (-976.018) (-975.827) (-978.430) -- 0:00:24
Average standard deviation of split frequencies: 0.007504
605500 -- (-980.104) (-975.291) [-974.876] (-977.291) * (-975.123) (-975.612) [-976.037] (-977.184) -- 0:00:24
606000 -- (-975.940) (-977.988) (-976.757) [-974.119] * (-974.146) (-974.780) (-979.339) [-976.657] -- 0:00:24
606500 -- [-976.083] (-979.512) (-973.880) (-977.438) * (-974.873) [-974.873] (-981.296) (-978.123) -- 0:00:25
607000 -- [-977.591] (-979.392) (-974.623) (-976.739) * (-975.267) (-977.107) [-976.335] (-977.647) -- 0:00:25
607500 -- (-975.063) [-978.097] (-975.734) (-974.432) * (-974.611) (-976.209) [-981.265] (-977.472) -- 0:00:25
608000 -- (-975.983) [-979.352] (-978.056) (-974.877) * [-974.758] (-975.772) (-977.290) (-977.865) -- 0:00:25
608500 -- (-975.106) (-975.958) (-974.900) [-975.554] * (-975.260) (-978.359) [-979.723] (-975.685) -- 0:00:25
609000 -- (-978.560) [-975.774] (-974.938) (-977.544) * (-976.305) (-978.968) (-976.679) [-975.053] -- 0:00:25
609500 -- [-976.687] (-977.678) (-976.116) (-974.001) * (-975.240) (-974.497) [-978.698] (-974.724) -- 0:00:24
610000 -- (-979.270) (-976.187) (-977.170) [-974.001] * (-978.040) (-975.182) [-979.628] (-975.824) -- 0:00:24
Average standard deviation of split frequencies: 0.007492
610500 -- (-978.378) (-975.343) (-977.063) [-982.903] * (-976.598) [-976.013] (-976.243) (-974.884) -- 0:00:24
611000 -- (-978.161) (-976.264) (-980.088) [-975.581] * (-977.424) (-975.797) (-977.617) [-973.925] -- 0:00:24
611500 -- (-978.190) [-976.255] (-975.643) (-976.121) * (-980.231) (-982.278) (-976.358) [-973.976] -- 0:00:24
612000 -- (-977.726) [-974.076] (-975.489) (-976.518) * (-975.426) (-979.352) (-976.450) [-975.427] -- 0:00:24
612500 -- (-977.401) [-975.282] (-979.497) (-977.187) * [-975.912] (-978.064) (-976.512) (-974.309) -- 0:00:24
613000 -- [-975.314] (-977.053) (-977.577) (-975.717) * (-977.591) [-975.794] (-974.395) (-976.122) -- 0:00:24
613500 -- (-977.473) [-976.566] (-974.934) (-975.364) * (-981.547) (-976.303) [-977.878] (-976.959) -- 0:00:24
614000 -- (-977.765) [-974.096] (-975.140) (-975.945) * (-977.543) (-976.136) (-976.374) [-978.065] -- 0:00:24
614500 -- [-980.530] (-974.166) (-974.634) (-976.817) * [-975.484] (-977.466) (-977.065) (-976.952) -- 0:00:24
615000 -- (-982.215) [-975.450] (-977.042) (-975.467) * (-976.893) [-975.827] (-978.231) (-974.839) -- 0:00:24
Average standard deviation of split frequencies: 0.006932
615500 -- (-974.578) (-974.781) (-979.573) [-974.493] * (-975.159) (-976.900) [-975.007] (-976.043) -- 0:00:24
616000 -- (-975.762) (-978.391) (-975.680) [-979.178] * (-975.675) (-976.987) (-975.996) [-974.603] -- 0:00:24
616500 -- [-974.908] (-979.503) (-977.498) (-977.604) * (-975.210) (-978.066) [-974.726] (-975.823) -- 0:00:24
617000 -- (-975.938) (-978.338) (-978.229) [-977.991] * (-974.150) (-974.726) [-975.520] (-978.230) -- 0:00:24
617500 -- (-975.991) (-978.802) [-974.917] (-977.102) * (-978.463) (-979.481) [-975.862] (-978.416) -- 0:00:24
618000 -- (-974.687) (-976.842) (-974.789) [-975.692] * (-979.618) (-976.014) (-974.210) [-975.551] -- 0:00:24
618500 -- (-974.417) [-978.381] (-975.180) (-981.797) * (-977.733) (-974.583) (-979.235) [-975.589] -- 0:00:24
619000 -- (-974.821) (-975.576) (-977.095) [-976.658] * [-978.808] (-975.196) (-975.101) (-975.838) -- 0:00:24
619500 -- (-975.425) [-976.314] (-974.655) (-976.625) * (-977.573) (-975.305) [-975.831] (-975.694) -- 0:00:23
620000 -- [-977.512] (-977.507) (-975.297) (-975.343) * (-985.155) (-975.423) (-976.470) [-974.049] -- 0:00:23
Average standard deviation of split frequencies: 0.006657
620500 -- (-978.675) (-976.708) (-978.225) [-977.017] * (-975.662) (-975.773) (-974.779) [-976.667] -- 0:00:23
621000 -- (-975.979) (-976.416) (-976.174) [-977.083] * (-976.625) (-978.790) [-976.456] (-973.921) -- 0:00:23
621500 -- (-976.678) [-977.955] (-974.154) (-977.932) * (-977.558) (-980.896) (-975.324) [-975.774] -- 0:00:23
622000 -- (-974.499) (-976.519) (-974.770) [-979.810] * (-982.859) (-976.385) [-974.611] (-974.399) -- 0:00:23
622500 -- (-975.062) [-976.948] (-981.065) (-974.797) * (-977.685) (-979.209) [-975.141] (-976.014) -- 0:00:24
623000 -- (-976.041) (-975.256) (-979.774) [-975.015] * [-974.438] (-980.704) (-979.751) (-977.338) -- 0:00:24
623500 -- (-977.134) (-978.844) (-975.127) [-975.996] * (-978.418) [-982.856] (-976.142) (-975.380) -- 0:00:24
624000 -- [-974.602] (-976.869) (-974.848) (-977.199) * (-976.521) (-976.920) [-980.220] (-975.722) -- 0:00:24
624500 -- (-975.175) [-975.855] (-976.123) (-974.814) * (-975.415) (-977.608) [-976.320] (-976.316) -- 0:00:24
625000 -- (-975.373) [-974.765] (-976.295) (-974.525) * (-975.740) (-978.635) (-974.365) [-976.954] -- 0:00:24
Average standard deviation of split frequencies: 0.006910
625500 -- [-974.631] (-977.481) (-979.095) (-975.787) * (-975.363) (-976.510) [-977.842] (-977.021) -- 0:00:23
626000 -- [-974.566] (-977.638) (-976.314) (-976.156) * (-978.201) (-973.886) [-974.629] (-975.279) -- 0:00:23
626500 -- (-975.121) [-976.719] (-978.914) (-975.952) * [-976.274] (-975.827) (-977.662) (-976.865) -- 0:00:23
627000 -- (-976.520) (-975.930) (-979.733) [-976.400] * (-974.819) [-976.324] (-976.790) (-976.066) -- 0:00:23
627500 -- (-977.128) [-978.045] (-978.414) (-976.700) * (-974.818) [-977.043] (-978.129) (-974.885) -- 0:00:23
628000 -- (-975.606) (-974.762) (-975.116) [-975.867] * (-974.918) (-977.246) [-975.358] (-975.979) -- 0:00:23
628500 -- (-979.277) (-979.061) [-974.381] (-976.227) * [-977.926] (-977.009) (-975.212) (-974.371) -- 0:00:23
629000 -- (-976.411) (-975.351) [-975.784] (-975.569) * [-977.841] (-975.537) (-975.212) (-975.660) -- 0:00:23
629500 -- (-974.996) [-974.106] (-975.328) (-977.285) * (-977.417) [-975.636] (-976.394) (-975.294) -- 0:00:23
630000 -- [-975.651] (-976.683) (-974.509) (-976.135) * (-977.490) [-974.397] (-975.253) (-976.680) -- 0:00:23
Average standard deviation of split frequencies: 0.007475
630500 -- (-975.322) (-974.056) (-975.570) [-975.765] * [-976.281] (-974.754) (-977.120) (-976.125) -- 0:00:23
631000 -- (-979.983) [-976.124] (-975.225) (-976.155) * (-974.412) (-974.834) [-976.260] (-977.242) -- 0:00:23
631500 -- [-976.841] (-977.811) (-975.596) (-977.140) * [-978.095] (-976.361) (-978.968) (-975.598) -- 0:00:23
632000 -- (-975.633) (-976.723) [-976.255] (-978.172) * [-976.769] (-975.954) (-974.437) (-976.670) -- 0:00:23
632500 -- (-975.096) (-976.734) [-975.622] (-977.694) * (-977.087) (-975.540) [-980.424] (-975.596) -- 0:00:23
633000 -- (-978.037) (-975.311) [-975.010] (-975.823) * (-978.396) (-976.110) [-980.065] (-974.725) -- 0:00:23
633500 -- (-976.918) (-977.331) [-978.120] (-980.859) * (-974.001) [-976.228] (-977.885) (-977.094) -- 0:00:23
634000 -- (-975.409) (-976.071) [-979.332] (-983.776) * (-974.147) (-975.040) (-976.932) [-977.942] -- 0:00:23
634500 -- (-976.026) [-974.799] (-975.204) (-978.713) * [-975.845] (-973.922) (-978.771) (-976.988) -- 0:00:23
635000 -- (-975.213) (-981.289) [-976.342] (-977.269) * (-979.336) (-973.934) (-978.036) [-975.741] -- 0:00:22
Average standard deviation of split frequencies: 0.007456
635500 -- (-983.171) (-978.020) (-976.429) [-974.882] * [-975.510] (-974.895) (-976.999) (-977.965) -- 0:00:22
636000 -- (-975.270) (-976.399) (-976.468) [-978.912] * (-980.087) [-977.119] (-976.842) (-975.945) -- 0:00:22
636500 -- (-978.103) (-978.540) [-976.030] (-974.732) * [-974.909] (-976.235) (-980.953) (-976.552) -- 0:00:22
637000 -- (-978.524) (-975.975) [-974.058] (-974.278) * (-974.905) [-977.337] (-980.229) (-977.202) -- 0:00:22
637500 -- (-976.496) [-974.587] (-977.904) (-976.319) * (-978.138) (-975.180) (-977.014) [-977.666] -- 0:00:22
638000 -- (-975.149) [-976.212] (-976.031) (-975.549) * [-975.459] (-978.940) (-974.749) (-979.994) -- 0:00:22
638500 -- [-975.872] (-976.893) (-977.470) (-975.075) * (-975.039) (-979.703) [-975.931] (-979.202) -- 0:00:22
639000 -- (-977.769) [-977.932] (-975.342) (-976.443) * (-974.450) (-981.911) [-975.265] (-975.997) -- 0:00:22
639500 -- (-974.030) (-977.459) [-977.416] (-980.370) * (-976.317) (-979.472) [-974.677] (-975.993) -- 0:00:23
640000 -- (-974.130) (-975.707) (-978.167) [-979.180] * (-978.042) (-976.209) [-975.425] (-975.423) -- 0:00:23
Average standard deviation of split frequencies: 0.007748
640500 -- (-975.634) (-978.912) [-978.613] (-974.045) * (-976.530) (-976.240) (-977.014) [-976.066] -- 0:00:23
641000 -- (-975.829) [-976.359] (-976.702) (-973.821) * (-974.239) (-977.183) (-974.774) [-976.762] -- 0:00:22
641500 -- (-976.532) (-982.480) (-977.112) [-977.015] * (-977.216) [-974.380] (-979.169) (-975.557) -- 0:00:22
642000 -- (-976.496) [-977.198] (-978.213) (-977.008) * (-976.092) [-979.349] (-980.756) (-975.557) -- 0:00:22
642500 -- (-980.254) (-977.131) [-977.946] (-976.103) * [-974.958] (-976.819) (-976.789) (-979.220) -- 0:00:22
643000 -- [-976.356] (-977.730) (-977.268) (-976.376) * (-974.895) (-976.779) [-977.555] (-974.918) -- 0:00:22
643500 -- (-976.325) (-977.472) [-975.520] (-977.874) * (-975.292) [-976.681] (-975.092) (-977.972) -- 0:00:22
644000 -- (-977.050) (-975.808) [-977.682] (-974.817) * (-977.254) (-975.677) [-978.072] (-978.732) -- 0:00:22
644500 -- [-976.826] (-975.406) (-976.150) (-975.869) * (-978.143) (-975.797) [-973.971] (-976.853) -- 0:00:22
645000 -- [-977.266] (-976.444) (-975.292) (-974.389) * (-980.911) (-974.560) (-975.238) [-977.874] -- 0:00:22
Average standard deviation of split frequencies: 0.007469
645500 -- [-974.654] (-976.262) (-976.399) (-976.498) * (-974.971) (-975.505) [-976.151] (-980.280) -- 0:00:22
646000 -- (-976.707) (-977.313) [-976.953] (-979.013) * (-976.218) (-978.083) [-975.405] (-977.186) -- 0:00:22
646500 -- [-977.254] (-976.197) (-981.195) (-977.626) * (-980.351) (-975.391) [-974.820] (-976.304) -- 0:00:22
647000 -- (-977.901) [-977.792] (-974.790) (-975.362) * (-978.637) (-977.272) [-977.771] (-976.682) -- 0:00:22
647500 -- (-984.202) (-975.164) [-975.688] (-974.337) * (-974.469) (-975.265) (-978.942) [-976.008] -- 0:00:22
648000 -- (-980.431) (-974.944) (-977.817) [-974.224] * (-974.538) (-977.126) [-976.382] (-976.328) -- 0:00:22
648500 -- (-977.418) [-979.391] (-978.729) (-974.641) * (-975.933) (-977.027) (-974.811) [-977.055] -- 0:00:22
649000 -- (-976.383) (-975.401) (-976.774) [-977.852] * (-977.117) (-976.847) [-977.363] (-979.550) -- 0:00:22
649500 -- (-977.578) (-974.750) (-975.632) [-975.882] * [-975.761] (-979.801) (-979.493) (-975.794) -- 0:00:22
650000 -- (-976.612) (-976.006) (-981.291) [-975.680] * (-975.479) (-977.026) [-976.271] (-975.447) -- 0:00:22
Average standard deviation of split frequencies: 0.007458
650500 -- [-975.261] (-978.234) (-976.291) (-975.268) * (-977.011) [-978.317] (-978.662) (-975.219) -- 0:00:22
651000 -- (-979.079) [-977.103] (-978.144) (-977.723) * (-977.834) (-976.098) (-976.827) [-974.211] -- 0:00:21
651500 -- [-977.566] (-975.657) (-980.550) (-987.979) * (-980.448) (-975.836) [-977.963] (-975.828) -- 0:00:21
652000 -- (-978.005) (-976.118) (-976.000) [-977.930] * (-975.759) [-976.127] (-978.098) (-974.901) -- 0:00:21
652500 -- (-978.530) (-975.077) (-974.619) [-977.420] * [-974.709] (-975.796) (-975.957) (-974.780) -- 0:00:21
653000 -- (-976.404) (-980.688) (-975.467) [-982.191] * (-975.066) (-976.239) [-979.218] (-974.676) -- 0:00:21
653500 -- (-977.429) (-977.915) [-975.257] (-976.160) * (-974.112) (-978.936) (-977.553) [-977.440] -- 0:00:21
654000 -- (-974.740) [-976.667] (-975.620) (-977.501) * [-975.470] (-975.904) (-976.825) (-976.837) -- 0:00:22
654500 -- (-974.517) (-979.703) (-974.672) [-974.581] * (-975.892) (-975.099) [-975.463] (-977.202) -- 0:00:22
655000 -- [-975.867] (-977.747) (-974.755) (-976.208) * (-975.318) [-978.410] (-976.694) (-975.462) -- 0:00:22
Average standard deviation of split frequencies: 0.007397
655500 -- (-975.563) [-975.116] (-976.734) (-977.718) * (-974.794) (-974.457) [-976.598] (-975.630) -- 0:00:22
656000 -- (-974.735) (-974.233) (-974.344) [-974.452] * [-975.181] (-974.457) (-974.847) (-976.532) -- 0:00:22
656500 -- [-974.132] (-974.370) (-979.229) (-976.019) * [-974.109] (-982.405) (-977.710) (-978.399) -- 0:00:21
657000 -- [-976.515] (-974.628) (-978.148) (-976.142) * [-976.919] (-978.434) (-977.010) (-976.673) -- 0:00:21
657500 -- (-976.747) (-975.383) [-974.714] (-975.550) * (-975.315) (-974.004) (-975.604) [-975.868] -- 0:00:21
658000 -- (-980.298) [-975.472] (-974.843) (-976.936) * [-977.168] (-978.412) (-978.509) (-976.907) -- 0:00:21
658500 -- (-979.781) [-974.076] (-975.331) (-974.205) * (-975.883) (-978.355) [-978.096] (-976.103) -- 0:00:21
659000 -- (-974.423) (-975.050) (-977.980) [-974.421] * (-977.267) (-978.473) (-974.452) [-976.424] -- 0:00:21
659500 -- (-975.416) (-974.343) (-978.096) [-977.535] * [-975.328] (-975.187) (-974.119) (-976.528) -- 0:00:21
660000 -- (-974.173) (-976.796) [-978.473] (-974.477) * (-978.712) [-980.940] (-974.415) (-974.475) -- 0:00:21
Average standard deviation of split frequencies: 0.007429
660500 -- [-975.920] (-975.262) (-978.763) (-977.298) * (-977.542) [-977.364] (-974.279) (-974.215) -- 0:00:21
661000 -- (-977.964) (-978.784) (-977.260) [-974.116] * [-979.283] (-977.231) (-976.376) (-976.630) -- 0:00:21
661500 -- (-976.389) (-975.107) (-978.661) [-977.614] * (-979.825) (-977.570) (-974.619) [-975.687] -- 0:00:21
662000 -- (-977.324) (-974.107) (-980.926) [-975.488] * (-975.932) (-976.283) [-976.638] (-975.066) -- 0:00:21
662500 -- [-976.537] (-976.938) (-976.053) (-978.714) * (-975.973) [-975.195] (-976.842) (-976.629) -- 0:00:21
663000 -- (-976.424) (-976.710) [-974.571] (-979.078) * (-974.372) (-976.655) [-975.382] (-975.246) -- 0:00:21
663500 -- (-977.104) [-975.725] (-974.497) (-979.237) * (-978.323) (-975.310) [-975.968] (-976.774) -- 0:00:21
664000 -- [-977.168] (-980.196) (-978.033) (-976.423) * [-976.880] (-975.567) (-977.039) (-974.732) -- 0:00:21
664500 -- (-978.509) [-977.457] (-977.544) (-977.942) * (-977.849) (-978.684) (-977.643) [-974.119] -- 0:00:21
665000 -- (-978.405) (-975.125) [-979.070] (-977.894) * (-976.575) [-978.860] (-978.085) (-974.756) -- 0:00:21
Average standard deviation of split frequencies: 0.007245
665500 -- (-975.884) (-976.212) [-974.602] (-975.343) * (-978.890) (-978.313) [-977.224] (-974.756) -- 0:00:21
666000 -- (-975.335) (-979.299) [-978.073] (-975.784) * (-976.635) (-975.854) [-975.365] (-981.799) -- 0:00:21
666500 -- (-975.255) (-977.921) (-974.352) [-977.837] * (-975.815) (-976.736) [-976.580] (-975.014) -- 0:00:21
667000 -- (-977.264) [-973.820] (-975.293) (-976.343) * (-979.101) (-977.521) (-976.736) [-974.270] -- 0:00:20
667500 -- [-979.251] (-977.866) (-978.368) (-979.514) * (-978.397) (-975.375) (-981.968) [-973.970] -- 0:00:20
668000 -- [-977.534] (-975.311) (-975.234) (-975.452) * (-978.678) (-975.395) (-974.951) [-976.225] -- 0:00:20
668500 -- (-975.553) (-975.295) (-977.595) [-974.131] * (-976.245) (-976.744) (-975.710) [-974.981] -- 0:00:20
669000 -- (-975.207) (-976.934) (-975.077) [-974.100] * (-976.208) (-979.184) [-974.358] (-979.640) -- 0:00:20
669500 -- (-980.671) (-975.593) [-978.207] (-974.579) * (-977.540) (-985.238) (-978.965) [-975.921] -- 0:00:20
670000 -- (-983.298) (-976.741) [-979.114] (-974.700) * (-974.954) [-974.364] (-974.773) (-977.624) -- 0:00:20
Average standard deviation of split frequencies: 0.006822
670500 -- (-979.981) (-976.002) [-974.857] (-974.292) * [-978.138] (-975.064) (-976.505) (-979.920) -- 0:00:21
671000 -- (-975.451) (-975.229) [-974.396] (-974.881) * (-975.643) [-974.259] (-975.495) (-975.975) -- 0:00:21
671500 -- (-979.815) [-975.585] (-975.383) (-974.418) * (-976.211) (-974.362) [-979.082] (-974.589) -- 0:00:21
672000 -- (-975.650) (-978.585) (-975.945) [-973.954] * [-975.046] (-976.697) (-977.445) (-975.525) -- 0:00:20
672500 -- (-975.256) (-976.706) [-976.589] (-974.532) * (-975.556) [-977.965] (-977.147) (-974.963) -- 0:00:20
673000 -- (-978.273) (-976.938) (-976.553) [-976.954] * (-975.781) [-975.309] (-976.772) (-975.424) -- 0:00:20
673500 -- [-977.518] (-977.334) (-979.734) (-975.785) * (-976.227) (-975.882) (-975.058) [-974.977] -- 0:00:20
674000 -- (-978.021) (-975.170) [-977.680] (-973.971) * (-976.498) (-975.922) (-978.301) [-975.294] -- 0:00:20
674500 -- (-974.602) [-977.588] (-976.367) (-976.233) * (-981.573) (-975.555) [-979.873] (-975.996) -- 0:00:20
675000 -- (-974.697) (-977.468) (-977.289) [-975.253] * (-977.102) (-975.476) [-975.633] (-977.340) -- 0:00:20
Average standard deviation of split frequencies: 0.006358
675500 -- [-977.752] (-978.452) (-976.352) (-977.634) * (-978.697) (-977.840) [-978.828] (-975.691) -- 0:00:20
676000 -- (-974.840) (-977.935) (-976.798) [-976.216] * [-976.285] (-977.182) (-978.019) (-974.138) -- 0:00:20
676500 -- (-974.832) [-977.938] (-977.817) (-978.537) * (-978.314) (-978.048) (-975.960) [-975.161] -- 0:00:20
677000 -- [-975.577] (-975.702) (-976.483) (-975.700) * (-975.593) (-977.050) [-976.192] (-979.764) -- 0:00:20
677500 -- [-974.463] (-979.423) (-975.536) (-974.859) * (-975.534) (-974.811) [-976.186] (-976.872) -- 0:00:20
678000 -- (-975.881) [-978.866] (-976.542) (-975.124) * [-975.475] (-974.948) (-980.244) (-976.480) -- 0:00:20
678500 -- (-976.955) (-976.676) [-974.212] (-975.040) * [-975.695] (-977.368) (-978.546) (-975.414) -- 0:00:20
679000 -- (-976.850) (-974.025) [-974.043] (-975.342) * (-975.028) [-977.184] (-975.686) (-975.538) -- 0:00:20
679500 -- (-976.678) (-975.160) [-975.659] (-975.335) * [-975.006] (-976.957) (-976.434) (-975.655) -- 0:00:20
680000 -- (-974.562) [-977.044] (-975.714) (-976.579) * (-979.759) (-976.029) [-976.663] (-977.994) -- 0:00:20
Average standard deviation of split frequencies: 0.006396
680500 -- (-974.259) (-974.601) (-975.915) [-976.977] * (-982.708) [-977.272] (-975.253) (-976.945) -- 0:00:20
681000 -- (-974.340) [-977.392] (-976.882) (-981.123) * (-981.113) (-978.307) (-974.749) [-976.411] -- 0:00:20
681500 -- (-975.622) (-974.978) [-977.505] (-980.899) * (-978.532) (-980.709) [-976.710] (-977.248) -- 0:00:20
682000 -- (-974.291) (-978.134) [-975.380] (-975.865) * (-979.377) (-975.873) [-975.846] (-977.758) -- 0:00:20
682500 -- (-975.254) [-975.678] (-977.785) (-981.803) * (-977.025) [-979.578] (-977.214) (-976.953) -- 0:00:20
683000 -- (-974.946) [-975.505] (-980.055) (-981.823) * (-975.697) [-978.405] (-976.990) (-977.678) -- 0:00:19
683500 -- (-975.739) (-975.419) [-977.040] (-975.499) * (-976.811) [-976.429] (-977.173) (-976.747) -- 0:00:19
684000 -- [-974.122] (-975.838) (-975.183) (-974.071) * (-976.195) [-978.375] (-974.963) (-976.312) -- 0:00:19
684500 -- (-973.951) [-975.482] (-976.831) (-974.825) * (-976.469) (-974.399) [-975.400] (-976.377) -- 0:00:19
685000 -- [-975.535] (-976.425) (-978.415) (-980.316) * [-976.065] (-980.534) (-976.242) (-978.895) -- 0:00:19
Average standard deviation of split frequencies: 0.006387
685500 -- (-976.781) (-975.660) [-977.112] (-977.332) * (-975.935) [-974.902] (-977.402) (-978.278) -- 0:00:19
686000 -- [-979.334] (-976.619) (-979.270) (-982.141) * [-976.290] (-975.190) (-978.457) (-981.083) -- 0:00:19
686500 -- [-976.449] (-978.808) (-976.687) (-978.063) * [-976.100] (-978.501) (-981.884) (-977.204) -- 0:00:20
687000 -- (-975.247) (-976.574) [-975.005] (-977.706) * [-979.023] (-979.986) (-976.805) (-983.024) -- 0:00:20
687500 -- [-975.098] (-975.178) (-975.861) (-977.423) * (-976.626) [-979.826] (-980.422) (-975.463) -- 0:00:20
688000 -- (-975.592) [-976.320] (-976.004) (-979.333) * (-975.026) [-976.789] (-977.059) (-975.067) -- 0:00:19
688500 -- (-975.563) [-976.128] (-979.058) (-974.799) * (-975.261) (-975.661) (-977.507) [-974.187] -- 0:00:19
689000 -- (-977.916) (-976.844) (-977.904) [-973.964] * (-974.419) [-974.823] (-974.246) (-974.859) -- 0:00:19
689500 -- [-974.314] (-975.716) (-974.562) (-974.761) * (-974.992) [-977.059] (-978.154) (-977.058) -- 0:00:19
690000 -- [-979.391] (-975.694) (-974.443) (-975.974) * (-976.484) [-974.470] (-976.791) (-978.875) -- 0:00:19
Average standard deviation of split frequencies: 0.006544
690500 -- (-976.031) (-976.931) [-976.975] (-974.629) * (-977.022) (-976.977) [-975.633] (-974.996) -- 0:00:19
691000 -- (-976.376) (-979.985) (-977.023) [-976.810] * (-982.812) (-975.472) (-974.484) [-976.197] -- 0:00:19
691500 -- (-976.888) (-975.235) (-977.568) [-975.694] * (-976.941) (-979.164) (-975.403) [-975.144] -- 0:00:19
692000 -- (-975.535) [-974.597] (-983.424) (-980.552) * [-974.849] (-978.215) (-975.787) (-975.694) -- 0:00:19
692500 -- (-974.931) (-982.606) [-978.230] (-978.397) * (-977.163) (-980.461) [-978.829] (-978.856) -- 0:00:19
693000 -- (-974.727) (-980.720) (-974.466) [-978.049] * (-977.557) (-975.609) (-975.011) [-975.391] -- 0:00:19
693500 -- (-974.919) [-975.368] (-975.394) (-977.094) * [-977.132] (-975.616) (-976.653) (-975.203) -- 0:00:19
694000 -- (-976.398) (-974.401) (-975.458) [-974.820] * (-976.802) (-979.472) (-975.699) [-975.958] -- 0:00:19
694500 -- (-976.079) (-979.865) [-976.076] (-977.290) * [-975.954] (-978.984) (-977.974) (-977.497) -- 0:00:19
695000 -- (-975.276) (-978.995) (-976.414) [-976.199] * (-978.223) (-974.811) [-977.020] (-981.791) -- 0:00:19
Average standard deviation of split frequencies: 0.006733
695500 -- (-974.663) [-978.152] (-974.382) (-976.448) * [-974.934] (-981.514) (-975.860) (-977.473) -- 0:00:19
696000 -- (-974.785) (-979.169) [-974.323] (-976.265) * [-975.772] (-974.971) (-974.249) (-976.266) -- 0:00:19
696500 -- (-976.176) [-977.928] (-979.918) (-977.222) * (-977.268) (-978.725) [-974.996] (-976.056) -- 0:00:19
697000 -- (-977.483) (-974.534) [-976.318] (-977.031) * (-977.545) [-976.476] (-974.717) (-975.837) -- 0:00:19
697500 -- (-976.707) (-975.506) [-975.765] (-980.258) * (-978.922) [-974.609] (-975.327) (-974.733) -- 0:00:19
698000 -- (-975.367) (-975.477) (-977.593) [-975.413] * [-975.713] (-977.113) (-975.820) (-975.048) -- 0:00:19
698500 -- [-975.845] (-975.011) (-978.102) (-977.061) * (-976.719) [-976.523] (-975.363) (-979.557) -- 0:00:18
699000 -- (-983.899) (-976.699) (-978.351) [-976.033] * [-976.515] (-976.252) (-979.191) (-975.188) -- 0:00:18
699500 -- (-975.345) [-976.274] (-975.250) (-974.330) * (-976.428) [-974.512] (-975.381) (-977.875) -- 0:00:18
700000 -- (-978.542) [-975.716] (-975.699) (-978.077) * (-974.892) (-976.552) [-975.275] (-974.912) -- 0:00:18
Average standard deviation of split frequencies: 0.006570
700500 -- (-976.731) (-977.158) (-976.126) [-976.536] * (-976.255) (-974.540) (-979.176) [-974.705] -- 0:00:18
701000 -- (-976.764) [-977.906] (-976.600) (-976.173) * [-976.607] (-976.873) (-975.325) (-975.029) -- 0:00:18
701500 -- (-977.469) [-976.869] (-976.538) (-974.555) * (-976.993) (-976.184) (-978.521) [-976.464] -- 0:00:18
702000 -- (-977.947) [-976.600] (-974.878) (-976.094) * (-976.150) [-974.722] (-974.461) (-973.957) -- 0:00:18
702500 -- [-978.033] (-978.496) (-975.826) (-976.870) * (-976.057) (-976.690) (-980.655) [-974.253] -- 0:00:18
703000 -- (-976.638) [-977.498] (-974.105) (-979.558) * (-976.241) [-976.178] (-984.150) (-974.271) -- 0:00:19
703500 -- (-974.194) (-980.824) [-976.316] (-977.284) * [-976.219] (-975.329) (-981.676) (-974.360) -- 0:00:18
704000 -- [-974.708] (-980.328) (-980.906) (-979.657) * (-980.368) (-975.781) [-978.654] (-974.968) -- 0:00:18
704500 -- (-977.131) [-976.262] (-975.176) (-980.611) * (-975.847) (-976.384) [-976.780] (-977.310) -- 0:00:18
705000 -- (-979.110) (-974.066) (-976.352) [-974.287] * [-976.278] (-977.905) (-974.661) (-975.114) -- 0:00:18
Average standard deviation of split frequencies: 0.006284
705500 -- (-979.038) (-974.089) [-975.333] (-979.974) * [-976.278] (-974.981) (-978.953) (-974.778) -- 0:00:18
706000 -- (-978.200) (-977.681) (-980.108) [-976.490] * (-976.242) (-976.851) [-976.635] (-974.683) -- 0:00:18
706500 -- (-980.647) (-976.688) [-975.085] (-977.234) * [-974.319] (-975.637) (-979.601) (-977.451) -- 0:00:18
707000 -- (-976.206) [-976.799] (-974.965) (-976.478) * (-974.742) [-978.853] (-975.789) (-977.044) -- 0:00:18
707500 -- (-976.906) (-976.242) [-975.964] (-976.181) * (-975.302) [-979.205] (-974.870) (-977.574) -- 0:00:18
708000 -- [-975.227] (-975.445) (-978.505) (-977.761) * (-975.416) [-977.466] (-976.098) (-976.220) -- 0:00:18
708500 -- (-976.082) [-975.780] (-979.419) (-974.457) * (-975.893) (-980.581) (-975.962) [-979.008] -- 0:00:18
709000 -- (-976.222) [-979.644] (-977.629) (-975.042) * (-978.495) [-975.545] (-977.736) (-978.214) -- 0:00:18
709500 -- (-976.230) (-976.191) [-974.966] (-975.185) * (-974.812) (-974.143) (-975.608) [-978.700] -- 0:00:18
710000 -- (-979.095) (-976.065) [-974.703] (-978.473) * (-976.248) (-974.874) [-976.456] (-978.455) -- 0:00:18
Average standard deviation of split frequencies: 0.006867
710500 -- (-975.831) (-974.771) [-977.115] (-977.798) * (-977.190) [-977.620] (-977.582) (-978.913) -- 0:00:18
711000 -- (-977.693) [-975.350] (-974.977) (-977.710) * (-981.269) (-979.467) [-976.357] (-974.026) -- 0:00:18
711500 -- (-978.708) [-975.404] (-975.682) (-977.978) * (-975.092) [-975.612] (-977.437) (-975.507) -- 0:00:18
712000 -- (-984.199) (-975.173) [-977.978] (-973.792) * (-975.972) (-978.196) (-974.997) [-974.297] -- 0:00:18
712500 -- (-978.617) (-975.552) [-976.134] (-974.390) * [-977.479] (-977.283) (-974.616) (-975.689) -- 0:00:18
713000 -- (-975.663) (-974.981) (-976.366) [-976.080] * (-978.888) [-977.161] (-976.708) (-974.073) -- 0:00:18
713500 -- (-978.620) (-975.026) [-974.366] (-978.433) * (-975.323) (-975.781) (-976.998) [-975.896] -- 0:00:18
714000 -- (-977.754) [-975.575] (-974.728) (-977.781) * (-974.823) (-975.459) (-976.253) [-978.171] -- 0:00:18
714500 -- (-977.710) (-975.198) (-974.379) [-979.457] * (-979.982) (-976.026) (-977.065) [-974.712] -- 0:00:17
715000 -- (-980.363) [-975.097] (-974.338) (-974.583) * (-979.052) [-976.300] (-976.062) (-976.192) -- 0:00:17
Average standard deviation of split frequencies: 0.006468
715500 -- (-978.264) (-976.259) [-976.228] (-976.043) * (-975.926) [-979.575] (-975.869) (-974.901) -- 0:00:17
716000 -- (-982.249) [-975.440] (-977.766) (-978.339) * (-975.118) (-976.663) [-974.238] (-975.549) -- 0:00:17
716500 -- (-975.345) (-974.649) (-976.892) [-977.350] * (-975.075) (-977.157) (-975.243) [-974.346] -- 0:00:17
717000 -- (-975.522) (-974.099) [-979.233] (-973.995) * (-977.306) [-975.478] (-975.149) (-975.598) -- 0:00:17
717500 -- (-976.196) [-978.325] (-977.276) (-974.871) * (-975.541) (-979.304) (-974.446) [-974.769] -- 0:00:17
718000 -- (-975.891) [-975.114] (-977.924) (-976.229) * [-975.657] (-977.110) (-977.040) (-978.616) -- 0:00:17
718500 -- [-975.996] (-975.737) (-978.383) (-975.338) * (-975.515) [-974.894] (-981.036) (-974.157) -- 0:00:17
719000 -- (-974.046) (-977.066) (-977.695) [-977.683] * (-978.416) (-974.901) [-975.235] (-974.136) -- 0:00:17
719500 -- (-974.223) (-976.809) (-976.113) [-977.123] * [-974.003] (-976.849) (-974.546) (-974.665) -- 0:00:17
720000 -- (-976.769) (-976.076) (-976.392) [-974.979] * (-976.082) [-974.298] (-980.050) (-978.306) -- 0:00:17
Average standard deviation of split frequencies: 0.006387
720500 -- (-974.630) [-975.519] (-976.004) (-975.182) * [-975.035] (-975.953) (-976.352) (-976.132) -- 0:00:17
721000 -- (-974.690) (-976.645) (-976.571) [-978.008] * (-976.703) (-978.511) [-976.051] (-979.064) -- 0:00:17
721500 -- (-975.082) [-975.050] (-976.664) (-977.265) * (-976.798) (-975.888) [-974.509] (-977.308) -- 0:00:17
722000 -- (-975.526) [-974.417] (-978.132) (-982.230) * [-977.710] (-974.506) (-978.172) (-976.148) -- 0:00:17
722500 -- (-977.357) (-975.155) [-974.226] (-975.146) * (-975.826) (-974.667) [-974.617] (-974.853) -- 0:00:17
723000 -- [-974.358] (-978.152) (-975.249) (-974.788) * (-976.172) (-975.729) (-974.223) [-974.337] -- 0:00:17
723500 -- [-974.365] (-975.649) (-975.970) (-979.079) * (-975.872) (-976.716) (-974.128) [-975.147] -- 0:00:17
724000 -- (-975.417) [-974.741] (-977.506) (-974.482) * (-974.743) (-976.498) (-975.289) [-976.458] -- 0:00:17
724500 -- (-982.459) (-976.037) [-976.950] (-976.667) * (-974.063) [-974.767] (-976.315) (-975.575) -- 0:00:17
725000 -- (-979.497) [-974.510] (-979.435) (-976.285) * [-977.277] (-974.348) (-974.518) (-979.095) -- 0:00:17
Average standard deviation of split frequencies: 0.006149
725500 -- (-978.825) [-974.301] (-977.436) (-975.013) * (-980.487) (-974.824) (-975.868) [-976.164] -- 0:00:17
726000 -- [-976.137] (-976.613) (-977.762) (-975.035) * (-974.999) [-976.713] (-978.526) (-976.203) -- 0:00:17
726500 -- [-978.373] (-976.067) (-977.234) (-975.424) * [-974.767] (-976.321) (-978.284) (-975.282) -- 0:00:17
727000 -- (-984.129) (-975.995) [-976.724] (-975.280) * [-974.579] (-975.801) (-980.921) (-977.483) -- 0:00:17
727500 -- (-974.905) [-976.293] (-977.033) (-976.983) * [-974.689] (-976.955) (-978.369) (-975.219) -- 0:00:17
728000 -- (-976.413) (-974.469) [-974.903] (-975.914) * (-975.664) [-975.390] (-977.013) (-976.275) -- 0:00:17
728500 -- (-977.986) [-978.433] (-974.208) (-974.333) * (-976.853) [-975.867] (-975.127) (-977.387) -- 0:00:17
729000 -- (-975.605) [-977.947] (-975.270) (-978.005) * (-976.512) [-976.847] (-977.226) (-978.211) -- 0:00:17
729500 -- (-974.284) (-975.019) [-975.352] (-977.045) * (-977.299) [-976.863] (-975.118) (-978.012) -- 0:00:17
730000 -- (-977.594) [-975.964] (-974.323) (-975.236) * [-974.268] (-975.400) (-974.894) (-975.872) -- 0:00:17
Average standard deviation of split frequencies: 0.006490
730500 -- (-978.587) (-978.110) (-978.896) [-974.298] * (-974.091) (-975.563) [-977.975] (-974.772) -- 0:00:16
731000 -- (-978.680) (-974.814) [-977.421] (-975.860) * (-974.459) [-975.214] (-976.219) (-977.764) -- 0:00:16
731500 -- (-975.037) (-981.232) (-975.311) [-975.421] * (-976.375) [-976.953] (-977.323) (-979.036) -- 0:00:16
732000 -- (-975.036) (-979.472) [-976.616] (-977.170) * (-981.260) (-979.549) [-976.851] (-977.745) -- 0:00:16
732500 -- (-977.601) (-977.125) (-977.170) [-974.556] * (-974.605) [-979.419] (-977.573) (-976.233) -- 0:00:16
733000 -- (-976.739) [-977.056] (-974.411) (-974.952) * (-975.215) (-979.969) [-979.986] (-976.594) -- 0:00:16
733500 -- [-978.048] (-978.738) (-974.767) (-974.629) * (-975.013) [-983.975] (-977.798) (-974.452) -- 0:00:16
734000 -- (-976.237) (-977.396) [-975.609] (-977.990) * (-975.541) [-978.457] (-976.531) (-974.452) -- 0:00:16
734500 -- [-976.985] (-979.409) (-975.252) (-980.007) * (-975.738) (-974.085) [-974.392] (-975.504) -- 0:00:16
735000 -- (-974.963) (-978.463) [-975.022] (-974.253) * (-977.133) (-974.981) (-974.768) [-975.610] -- 0:00:16
Average standard deviation of split frequencies: 0.006028
735500 -- [-974.408] (-975.237) (-977.056) (-975.782) * (-975.419) (-976.486) (-975.221) [-979.998] -- 0:00:16
736000 -- (-975.217) [-975.893] (-976.613) (-980.462) * (-978.692) (-976.388) [-976.373] (-977.039) -- 0:00:16
736500 -- (-975.987) (-976.426) (-975.816) [-978.724] * [-976.961] (-974.141) (-975.434) (-977.073) -- 0:00:16
737000 -- (-975.664) [-975.470] (-974.722) (-977.933) * (-976.473) [-975.234] (-975.450) (-976.128) -- 0:00:16
737500 -- [-977.869] (-975.599) (-975.006) (-975.791) * (-976.616) [-975.077] (-975.244) (-975.487) -- 0:00:16
738000 -- (-976.071) (-975.042) [-975.720] (-975.888) * (-977.158) (-979.698) [-974.505] (-978.171) -- 0:00:16
738500 -- [-974.299] (-976.808) (-976.742) (-978.448) * (-980.921) (-977.045) [-976.689] (-975.828) -- 0:00:16
739000 -- (-977.542) [-975.999] (-980.478) (-976.012) * (-974.896) [-974.156] (-976.498) (-977.196) -- 0:00:16
739500 -- [-974.730] (-974.652) (-976.568) (-976.228) * (-976.635) (-975.231) [-981.711] (-977.959) -- 0:00:16
740000 -- (-974.710) (-974.937) (-974.973) [-978.120] * (-974.987) [-976.075] (-980.014) (-980.647) -- 0:00:16
Average standard deviation of split frequencies: 0.006028
740500 -- (-974.725) [-974.499] (-976.591) (-976.109) * (-976.148) (-975.171) (-977.386) [-975.749] -- 0:00:16
741000 -- (-977.147) [-977.461] (-976.056) (-976.090) * (-976.432) (-977.183) [-977.972] (-978.915) -- 0:00:16
741500 -- [-975.679] (-975.836) (-975.477) (-978.283) * (-974.503) [-978.972] (-974.568) (-975.679) -- 0:00:16
742000 -- (-979.207) [-974.763] (-976.403) (-974.596) * (-975.344) [-975.213] (-974.896) (-976.048) -- 0:00:16
742500 -- (-976.339) (-974.503) [-974.969] (-975.895) * (-975.238) (-976.450) [-974.508] (-977.976) -- 0:00:16
743000 -- [-975.123] (-976.105) (-977.402) (-979.953) * (-978.172) (-977.002) (-976.340) [-976.277] -- 0:00:16
743500 -- (-976.040) (-975.924) (-977.401) [-975.252] * (-975.677) [-975.183] (-978.329) (-974.994) -- 0:00:16
744000 -- (-976.161) (-978.302) [-974.103] (-977.800) * [-976.086] (-981.547) (-977.425) (-974.190) -- 0:00:16
744500 -- [-976.456] (-976.594) (-975.986) (-975.512) * (-974.954) [-975.563] (-975.144) (-974.188) -- 0:00:16
745000 -- (-976.688) (-976.733) (-975.966) [-975.156] * (-979.301) (-977.486) (-975.792) [-976.137] -- 0:00:16
Average standard deviation of split frequencies: 0.006468
745500 -- [-976.244] (-979.103) (-978.080) (-975.797) * (-974.515) [-977.063] (-978.086) (-976.409) -- 0:00:16
746000 -- (-979.516) (-977.358) [-976.296] (-979.486) * (-978.168) (-977.945) (-975.511) [-976.384] -- 0:00:16
746500 -- (-977.014) (-975.115) [-975.628] (-977.707) * [-974.991] (-974.165) (-976.660) (-977.259) -- 0:00:15
747000 -- (-976.993) (-975.905) (-975.268) [-974.316] * (-977.655) [-977.761] (-979.126) (-974.863) -- 0:00:15
747500 -- (-977.111) (-976.622) (-978.061) [-977.286] * (-975.262) (-975.660) [-976.729] (-976.367) -- 0:00:15
748000 -- (-975.051) (-977.009) (-981.027) [-976.190] * (-976.086) [-980.362] (-981.503) (-976.479) -- 0:00:15
748500 -- (-977.781) [-974.425] (-976.435) (-976.077) * [-977.132] (-976.365) (-976.179) (-974.333) -- 0:00:15
749000 -- (-979.687) (-974.360) [-982.127] (-975.774) * (-979.067) (-975.777) [-975.733] (-977.114) -- 0:00:15
749500 -- [-980.376] (-974.405) (-977.621) (-976.661) * (-980.265) (-975.742) [-976.286] (-978.673) -- 0:00:15
750000 -- (-975.900) [-975.393] (-976.375) (-976.199) * (-979.698) (-974.857) (-976.520) [-976.829] -- 0:00:15
Average standard deviation of split frequencies: 0.006501
750500 -- (-978.400) (-978.683) [-975.796] (-976.433) * (-977.043) (-976.199) [-976.709] (-976.909) -- 0:00:15
751000 -- (-976.756) (-975.717) [-979.102] (-976.012) * [-976.554] (-974.805) (-976.100) (-975.716) -- 0:00:15
751500 -- [-976.358] (-974.367) (-974.884) (-977.218) * (-978.080) (-978.248) [-975.286] (-975.422) -- 0:00:15
752000 -- [-976.759] (-975.801) (-975.608) (-978.747) * [-976.391] (-979.567) (-981.375) (-975.249) -- 0:00:15
752500 -- (-977.148) [-979.246] (-979.950) (-975.824) * (-977.128) (-977.469) (-982.535) [-974.095] -- 0:00:15
753000 -- [-975.598] (-975.730) (-976.913) (-974.531) * (-975.293) (-976.555) [-980.914] (-978.222) -- 0:00:15
753500 -- [-975.811] (-974.252) (-975.592) (-974.304) * (-974.069) (-976.611) [-978.148] (-977.489) -- 0:00:15
754000 -- (-979.358) (-974.555) (-975.425) [-977.037] * (-975.077) [-977.241] (-976.260) (-976.270) -- 0:00:15
754500 -- (-975.637) (-976.076) (-975.948) [-977.532] * (-974.645) (-978.361) [-976.214] (-975.922) -- 0:00:15
755000 -- (-976.399) [-975.140] (-977.742) (-977.047) * (-978.828) [-977.736] (-978.905) (-976.088) -- 0:00:15
Average standard deviation of split frequencies: 0.006566
755500 -- [-983.851] (-975.237) (-977.849) (-974.838) * (-975.705) (-977.603) (-981.071) [-975.281] -- 0:00:15
756000 -- (-980.204) (-975.967) (-978.275) [-974.429] * [-975.767] (-974.765) (-978.381) (-974.616) -- 0:00:15
756500 -- [-978.061] (-974.856) (-974.703) (-974.078) * (-978.287) (-975.251) [-978.301] (-974.683) -- 0:00:15
757000 -- (-975.117) [-974.787] (-974.500) (-977.507) * (-975.450) (-974.230) (-976.635) [-975.608] -- 0:00:15
757500 -- (-975.576) [-975.572] (-976.806) (-976.705) * [-975.976] (-974.215) (-978.260) (-975.534) -- 0:00:15
758000 -- [-976.801] (-976.585) (-974.719) (-976.604) * (-978.727) (-975.374) [-978.407] (-976.603) -- 0:00:15
758500 -- (-977.378) [-977.194] (-976.154) (-974.736) * (-974.400) (-978.267) (-974.627) [-977.364] -- 0:00:15
759000 -- (-978.238) (-975.143) [-975.747] (-977.592) * (-974.353) (-976.285) [-975.711] (-978.684) -- 0:00:15
759500 -- (-976.235) [-974.593] (-980.048) (-980.924) * [-976.354] (-976.400) (-973.839) (-977.780) -- 0:00:15
760000 -- (-974.683) (-976.733) [-976.765] (-976.017) * [-974.752] (-978.191) (-973.841) (-976.215) -- 0:00:15
Average standard deviation of split frequencies: 0.006197
760500 -- [-977.331] (-975.176) (-975.127) (-982.301) * (-976.482) [-975.587] (-979.932) (-974.697) -- 0:00:15
761000 -- (-977.030) (-977.322) (-975.421) [-974.461] * [-975.222] (-975.022) (-978.265) (-975.251) -- 0:00:15
761500 -- (-975.022) (-975.530) [-974.453] (-975.791) * [-980.143] (-976.452) (-976.706) (-975.386) -- 0:00:15
762000 -- (-974.498) (-974.963) [-974.317] (-976.031) * (-975.289) (-979.701) (-976.028) [-975.113] -- 0:00:14
762500 -- (-974.850) (-976.696) (-974.285) [-979.629] * (-974.792) [-978.912] (-978.284) (-975.914) -- 0:00:14
763000 -- (-977.053) [-975.296] (-975.259) (-978.967) * [-975.041] (-975.597) (-977.964) (-980.774) -- 0:00:14
763500 -- (-977.793) (-977.289) [-974.041] (-978.838) * [-975.485] (-975.718) (-978.399) (-982.306) -- 0:00:14
764000 -- (-976.052) (-977.394) [-974.986] (-979.647) * (-975.716) (-978.832) (-976.705) [-974.978] -- 0:00:14
764500 -- (-978.801) (-977.517) (-979.881) [-978.830] * (-976.461) [-977.929] (-975.299) (-974.509) -- 0:00:14
765000 -- [-977.485] (-976.541) (-980.476) (-977.997) * (-975.639) [-978.334] (-975.446) (-975.104) -- 0:00:14
Average standard deviation of split frequencies: 0.006770
765500 -- [-977.254] (-979.306) (-975.212) (-975.681) * (-977.247) (-975.524) [-975.938] (-975.809) -- 0:00:14
766000 -- (-974.379) (-977.545) [-977.634] (-976.981) * [-974.947] (-979.948) (-975.688) (-975.811) -- 0:00:14
766500 -- (-973.985) [-977.682] (-974.338) (-976.643) * [-975.065] (-979.528) (-977.746) (-980.585) -- 0:00:14
767000 -- (-979.358) [-976.086] (-980.734) (-974.896) * (-975.158) (-974.214) [-975.455] (-977.647) -- 0:00:14
767500 -- (-975.372) (-975.233) (-979.125) [-974.051] * [-976.304] (-975.028) (-977.239) (-979.941) -- 0:00:14
768000 -- [-976.246] (-976.596) (-977.719) (-974.208) * (-974.289) (-975.019) (-976.813) [-976.935] -- 0:00:14
768500 -- (-980.076) [-976.370] (-976.304) (-975.311) * (-975.723) (-977.108) [-976.685] (-981.904) -- 0:00:14
769000 -- [-979.526] (-979.005) (-977.763) (-975.326) * [-974.531] (-976.585) (-977.365) (-974.254) -- 0:00:14
769500 -- [-978.510] (-978.697) (-975.497) (-974.463) * (-974.976) (-975.107) (-975.327) [-974.743] -- 0:00:14
770000 -- (-975.511) [-975.946] (-976.653) (-974.232) * (-976.498) (-979.589) [-976.078] (-976.523) -- 0:00:14
Average standard deviation of split frequencies: 0.006729
770500 -- [-978.104] (-975.205) (-977.166) (-979.202) * (-976.867) (-975.651) [-974.498] (-976.989) -- 0:00:14
771000 -- [-977.082] (-976.094) (-975.289) (-977.982) * (-978.083) (-975.337) [-975.702] (-976.549) -- 0:00:14
771500 -- (-984.226) [-976.697] (-977.679) (-974.905) * [-974.198] (-976.273) (-977.308) (-977.289) -- 0:00:14
772000 -- [-979.544] (-977.142) (-979.144) (-976.511) * [-976.207] (-977.175) (-976.143) (-976.596) -- 0:00:14
772500 -- (-976.540) (-976.387) (-975.686) [-973.816] * (-975.789) [-978.818] (-975.901) (-977.809) -- 0:00:14
773000 -- [-974.254] (-979.822) (-975.721) (-977.546) * (-975.636) (-975.333) [-974.969] (-974.846) -- 0:00:14
773500 -- [-975.707] (-975.163) (-974.118) (-977.278) * (-977.395) (-979.741) (-974.170) [-977.853] -- 0:00:14
774000 -- (-976.241) (-975.177) [-978.733] (-975.841) * [-977.110] (-978.062) (-974.506) (-975.225) -- 0:00:14
774500 -- (-975.381) [-977.453] (-977.570) (-978.657) * (-976.591) (-977.377) [-974.328] (-975.083) -- 0:00:14
775000 -- (-976.871) [-976.485] (-974.249) (-980.458) * (-975.012) [-978.733] (-976.558) (-977.892) -- 0:00:14
Average standard deviation of split frequencies: 0.006396
775500 -- (-978.521) [-977.116] (-974.451) (-975.068) * (-974.999) (-975.739) (-975.619) [-976.274] -- 0:00:14
776000 -- (-977.445) (-976.314) [-978.120] (-974.937) * (-975.096) (-975.899) (-978.219) [-974.536] -- 0:00:14
776500 -- (-977.191) [-978.190] (-980.792) (-976.349) * (-976.508) (-975.537) [-976.081] (-975.826) -- 0:00:14
777000 -- (-975.545) (-977.274) [-975.849] (-976.424) * (-975.179) (-974.040) (-978.283) [-976.521] -- 0:00:14
777500 -- (-975.462) [-978.667] (-976.172) (-974.718) * (-985.174) [-973.804] (-976.986) (-976.521) -- 0:00:14
778000 -- (-979.119) (-977.572) [-977.197] (-978.972) * (-978.547) [-976.355] (-979.090) (-976.889) -- 0:00:13
778500 -- (-976.464) [-978.108] (-976.854) (-976.715) * [-978.049] (-974.880) (-976.238) (-976.743) -- 0:00:13
779000 -- [-975.677] (-979.901) (-974.996) (-976.235) * (-977.760) [-975.044] (-977.578) (-975.684) -- 0:00:13
779500 -- (-978.030) (-977.312) [-974.152] (-980.723) * (-976.482) (-976.588) (-976.796) [-976.354] -- 0:00:13
780000 -- [-974.719] (-977.482) (-976.531) (-976.168) * [-976.593] (-975.509) (-981.223) (-977.476) -- 0:00:13
Average standard deviation of split frequencies: 0.006114
780500 -- (-975.053) (-974.370) [-976.745] (-976.351) * (-977.025) (-979.369) (-981.590) [-976.349] -- 0:00:13
781000 -- (-976.611) (-975.597) (-974.795) [-977.908] * (-975.593) (-974.291) (-977.024) [-978.113] -- 0:00:13
781500 -- [-974.522] (-974.604) (-973.956) (-982.987) * (-975.440) [-977.538] (-974.489) (-975.256) -- 0:00:13
782000 -- (-974.569) (-982.374) [-975.584] (-974.882) * (-975.781) [-974.764] (-977.764) (-976.244) -- 0:00:13
782500 -- (-975.932) (-976.431) (-975.473) [-974.946] * [-977.352] (-974.388) (-975.053) (-974.545) -- 0:00:13
783000 -- (-978.967) [-975.109] (-976.307) (-975.616) * (-976.888) [-976.136] (-974.432) (-974.889) -- 0:00:13
783500 -- (-977.673) (-976.187) [-976.044] (-975.615) * [-976.439] (-975.455) (-974.928) (-978.657) -- 0:00:13
784000 -- (-974.659) (-976.241) (-976.077) [-976.386] * (-975.288) (-975.680) [-977.622] (-976.774) -- 0:00:13
784500 -- (-976.522) (-977.174) [-974.708] (-977.721) * [-975.065] (-978.307) (-976.988) (-977.352) -- 0:00:13
785000 -- [-976.517] (-975.348) (-973.841) (-975.030) * [-975.044] (-980.210) (-975.669) (-976.602) -- 0:00:13
Average standard deviation of split frequencies: 0.006527
785500 -- (-975.342) [-975.535] (-975.687) (-975.552) * (-974.878) (-978.660) [-975.520] (-979.415) -- 0:00:13
786000 -- (-978.420) [-974.680] (-975.072) (-977.542) * (-977.116) (-978.961) [-974.559] (-977.162) -- 0:00:13
786500 -- [-974.715] (-980.708) (-975.619) (-975.236) * (-975.881) (-981.454) [-975.804] (-980.037) -- 0:00:13
787000 -- (-977.149) [-978.047] (-978.304) (-974.495) * (-980.795) [-976.288] (-974.613) (-976.956) -- 0:00:13
787500 -- [-974.288] (-976.628) (-976.212) (-975.760) * (-981.018) (-974.758) [-975.168] (-980.740) -- 0:00:13
788000 -- (-975.776) [-977.001] (-978.521) (-977.575) * (-980.098) (-974.757) (-977.463) [-975.606] -- 0:00:13
788500 -- (-975.845) [-975.801] (-979.461) (-976.026) * [-976.785] (-975.782) (-976.555) (-977.520) -- 0:00:13
789000 -- (-976.324) (-975.773) [-975.397] (-975.628) * (-975.412) [-974.886] (-975.410) (-979.381) -- 0:00:13
789500 -- [-974.591] (-974.587) (-977.986) (-977.369) * (-976.282) [-978.232] (-975.486) (-974.883) -- 0:00:13
790000 -- (-978.280) (-977.073) (-974.331) [-976.798] * (-975.631) (-975.736) (-975.754) [-975.792] -- 0:00:13
Average standard deviation of split frequencies: 0.006628
790500 -- [-976.032] (-975.208) (-978.794) (-977.072) * [-976.935] (-976.208) (-976.553) (-976.526) -- 0:00:13
791000 -- (-976.968) [-975.751] (-978.241) (-977.491) * (-975.176) (-975.327) (-978.353) [-974.854] -- 0:00:13
791500 -- (-977.369) (-979.148) [-977.751] (-978.346) * [-974.383] (-977.454) (-980.458) (-979.016) -- 0:00:13
792000 -- (-978.614) (-975.705) (-976.793) [-975.198] * (-975.012) [-976.016] (-976.085) (-978.087) -- 0:00:13
792500 -- (-979.956) [-975.416] (-977.687) (-974.897) * [-975.118] (-975.924) (-976.659) (-976.173) -- 0:00:13
793000 -- (-975.253) (-976.120) [-975.215] (-974.575) * (-974.072) [-976.376] (-975.628) (-979.230) -- 0:00:13
793500 -- (-979.757) (-977.231) (-974.967) [-975.515] * (-977.298) (-975.707) (-974.898) [-976.783] -- 0:00:13
794000 -- (-979.553) [-974.551] (-975.428) (-980.960) * [-977.281] (-975.649) (-978.998) (-977.065) -- 0:00:12
794500 -- (-977.489) (-974.618) (-975.810) [-977.310] * (-975.482) (-976.472) [-981.901] (-977.447) -- 0:00:12
795000 -- (-977.163) [-975.348] (-975.742) (-976.763) * (-978.068) (-974.288) [-978.026] (-976.010) -- 0:00:12
Average standard deviation of split frequencies: 0.006549
795500 -- [-976.323] (-976.651) (-975.125) (-986.027) * [-976.403] (-975.153) (-981.629) (-977.847) -- 0:00:12
796000 -- [-982.589] (-974.462) (-977.533) (-979.783) * (-976.004) (-976.359) (-979.820) [-975.601] -- 0:00:12
796500 -- (-977.372) (-974.668) (-976.448) [-976.380] * (-975.009) (-978.510) (-977.019) [-977.337] -- 0:00:12
797000 -- (-974.889) [-975.413] (-976.190) (-976.854) * (-973.899) (-974.918) [-984.813] (-974.142) -- 0:00:12
797500 -- (-976.388) (-974.728) (-974.208) [-976.477] * (-973.899) (-983.517) (-977.652) [-977.643] -- 0:00:12
798000 -- (-978.849) (-975.122) (-974.942) [-974.805] * (-973.976) (-981.370) [-977.797] (-976.641) -- 0:00:12
798500 -- (-976.336) [-979.250] (-976.145) (-977.127) * (-975.705) (-975.746) [-977.410] (-977.283) -- 0:00:12
799000 -- [-977.231] (-975.226) (-979.195) (-975.178) * (-977.489) [-976.857] (-977.156) (-976.704) -- 0:00:12
799500 -- [-976.999] (-980.152) (-975.264) (-975.030) * [-977.997] (-976.829) (-976.826) (-978.146) -- 0:00:12
800000 -- (-977.179) (-982.151) (-976.146) [-975.155] * [-974.829] (-976.467) (-977.351) (-975.800) -- 0:00:12
Average standard deviation of split frequencies: 0.006476
800500 -- [-978.465] (-978.535) (-975.513) (-974.999) * (-978.085) (-975.830) (-976.292) [-975.597] -- 0:00:12
801000 -- [-976.942] (-978.923) (-974.966) (-975.724) * [-975.323] (-979.791) (-976.796) (-975.364) -- 0:00:12
801500 -- (-976.084) (-978.508) (-975.940) [-978.270] * (-975.019) (-977.131) (-974.414) [-974.942] -- 0:00:12
802000 -- (-975.555) [-975.348] (-977.801) (-975.074) * (-976.699) [-976.430] (-977.089) (-974.559) -- 0:00:12
802500 -- (-976.710) (-975.822) (-975.230) [-974.314] * [-975.723] (-975.401) (-974.501) (-975.703) -- 0:00:12
803000 -- (-975.439) (-975.849) (-975.635) [-979.462] * (-975.327) [-975.956] (-975.984) (-975.268) -- 0:00:12
803500 -- (-974.130) (-978.998) [-974.411] (-974.723) * (-976.316) [-976.152] (-976.358) (-975.570) -- 0:00:12
804000 -- (-974.995) (-978.799) [-974.484] (-977.386) * [-975.229] (-975.690) (-975.014) (-975.436) -- 0:00:12
804500 -- (-975.480) (-974.221) [-974.492] (-974.544) * (-976.728) [-977.250] (-976.003) (-977.274) -- 0:00:12
805000 -- (-974.720) (-975.418) [-977.228] (-975.311) * (-978.985) [-975.791] (-974.601) (-977.870) -- 0:00:12
Average standard deviation of split frequencies: 0.006984
805500 -- (-974.810) (-975.772) (-975.642) [-974.910] * (-978.507) [-975.366] (-977.436) (-976.906) -- 0:00:12
806000 -- (-977.676) (-975.023) [-976.834] (-981.417) * (-978.165) (-977.593) [-979.473] (-976.183) -- 0:00:12
806500 -- (-974.540) (-975.949) (-974.234) [-975.591] * (-976.950) (-977.487) [-974.358] (-976.069) -- 0:00:12
807000 -- (-976.131) (-974.722) [-975.092] (-977.265) * (-979.033) [-974.187] (-976.207) (-980.712) -- 0:00:12
807500 -- (-975.474) (-975.337) (-975.353) [-976.068] * (-976.803) (-977.836) (-976.741) [-977.024] -- 0:00:12
808000 -- (-976.905) [-976.311] (-975.839) (-975.629) * (-974.609) (-976.583) [-977.235] (-977.600) -- 0:00:12
808500 -- (-974.523) (-976.256) (-976.096) [-975.610] * (-978.258) (-978.865) (-983.307) [-978.913] -- 0:00:12
809000 -- (-974.306) (-976.652) [-974.915] (-975.422) * (-978.471) (-978.767) (-979.277) [-974.549] -- 0:00:12
809500 -- (-978.012) (-976.039) (-974.700) [-975.833] * [-974.341] (-980.710) (-978.600) (-975.384) -- 0:00:12
810000 -- (-976.192) (-977.150) (-975.221) [-974.763] * [-975.366] (-977.653) (-976.621) (-975.971) -- 0:00:11
Average standard deviation of split frequencies: 0.007087
810500 -- (-977.646) [-976.203] (-976.217) (-975.961) * (-978.681) [-978.689] (-975.080) (-974.640) -- 0:00:11
811000 -- (-977.428) (-975.207) (-979.273) [-975.971] * (-976.670) [-975.103] (-975.629) (-975.593) -- 0:00:11
811500 -- (-978.763) (-977.219) (-976.477) [-977.208] * (-977.357) (-975.298) [-974.896] (-975.702) -- 0:00:11
812000 -- [-977.388] (-975.483) (-977.080) (-976.431) * (-975.980) (-974.905) (-975.780) [-976.617] -- 0:00:11
812500 -- (-978.641) (-975.432) (-976.438) [-977.180] * (-976.325) [-978.366] (-974.433) (-974.841) -- 0:00:11
813000 -- [-974.270] (-975.483) (-976.575) (-976.809) * (-975.697) (-978.729) [-974.342] (-974.554) -- 0:00:11
813500 -- [-974.084] (-975.128) (-975.968) (-976.621) * [-981.659] (-977.158) (-974.280) (-975.333) -- 0:00:11
814000 -- [-976.521] (-975.689) (-976.606) (-980.820) * (-975.298) (-979.623) [-974.099] (-981.617) -- 0:00:11
814500 -- (-974.939) (-976.202) (-976.464) [-978.666] * [-975.354] (-977.545) (-976.230) (-974.862) -- 0:00:11
815000 -- (-976.968) [-978.201] (-975.240) (-977.951) * (-978.389) (-977.647) (-976.295) [-977.044] -- 0:00:11
Average standard deviation of split frequencies: 0.007041
815500 -- [-974.561] (-974.730) (-974.563) (-975.399) * (-977.970) [-975.206] (-975.921) (-975.830) -- 0:00:11
816000 -- (-974.498) [-974.864] (-977.020) (-975.010) * (-978.119) (-977.036) [-976.320] (-977.497) -- 0:00:11
816500 -- [-974.370] (-982.128) (-975.431) (-976.807) * (-976.817) (-977.297) (-978.767) [-977.340] -- 0:00:11
817000 -- (-976.586) (-978.144) (-974.637) [-975.845] * [-975.874] (-975.678) (-975.309) (-975.157) -- 0:00:11
817500 -- [-980.200] (-977.406) (-974.954) (-978.253) * (-975.434) [-978.635] (-975.232) (-974.073) -- 0:00:11
818000 -- (-980.944) (-976.632) [-974.595] (-974.990) * [-975.611] (-975.815) (-975.897) (-974.262) -- 0:00:11
818500 -- (-977.441) (-979.601) [-975.442] (-975.611) * (-979.213) [-975.876] (-980.214) (-981.199) -- 0:00:11
819000 -- (-976.829) (-975.258) (-973.965) [-974.915] * [-974.519] (-975.184) (-975.118) (-976.454) -- 0:00:11
819500 -- [-975.919] (-980.939) (-975.495) (-976.401) * (-974.796) [-974.737] (-979.753) (-974.895) -- 0:00:11
820000 -- [-978.572] (-974.133) (-975.483) (-975.828) * [-974.342] (-976.397) (-976.487) (-974.701) -- 0:00:11
Average standard deviation of split frequencies: 0.007163
820500 -- (-974.212) (-974.362) [-977.200] (-975.799) * (-974.559) (-980.605) (-977.473) [-974.836] -- 0:00:11
821000 -- (-976.240) (-976.501) [-978.211] (-977.083) * (-976.123) (-981.653) (-974.130) [-974.606] -- 0:00:11
821500 -- (-977.828) (-973.968) [-976.486] (-976.785) * (-975.317) [-982.689] (-976.497) (-976.168) -- 0:00:11
822000 -- (-977.089) (-974.574) [-977.654] (-975.580) * (-974.165) (-977.323) (-976.476) [-979.803] -- 0:00:11
822500 -- (-975.936) (-975.886) (-978.643) [-975.589] * [-975.677] (-976.588) (-974.887) (-983.963) -- 0:00:11
823000 -- [-975.939] (-975.085) (-974.210) (-974.719) * (-974.469) [-978.028] (-977.165) (-977.582) -- 0:00:11
823500 -- (-976.145) [-974.621] (-975.750) (-975.002) * [-976.789] (-976.418) (-975.889) (-981.381) -- 0:00:11
824000 -- (-979.681) [-974.269] (-975.532) (-975.026) * (-974.693) (-979.088) (-977.367) [-975.275] -- 0:00:11
824500 -- (-975.658) [-975.600] (-975.558) (-984.147) * (-976.715) (-974.627) (-974.126) [-975.365] -- 0:00:11
825000 -- (-981.655) [-975.579] (-978.083) (-977.292) * (-978.985) (-974.715) (-974.646) [-975.596] -- 0:00:11
Average standard deviation of split frequencies: 0.007083
825500 -- (-975.837) [-974.692] (-975.038) (-978.915) * (-977.364) (-974.794) [-977.316] (-975.714) -- 0:00:10
826000 -- [-975.356] (-975.937) (-976.223) (-978.399) * (-974.333) (-976.206) (-975.041) [-977.058] -- 0:00:10
826500 -- (-975.056) (-977.824) (-975.503) [-974.205] * [-974.184] (-976.907) (-975.827) (-976.839) -- 0:00:10
827000 -- (-976.195) [-977.990] (-975.012) (-978.324) * (-975.768) [-975.604] (-975.657) (-977.711) -- 0:00:10
827500 -- (-975.996) (-980.912) (-975.962) [-976.337] * (-976.668) [-979.701] (-976.776) (-975.168) -- 0:00:10
828000 -- [-974.729] (-976.550) (-976.057) (-975.508) * (-976.873) (-979.111) (-978.916) [-974.706] -- 0:00:10
828500 -- [-977.769] (-975.275) (-978.372) (-975.600) * (-977.586) (-977.674) (-980.005) [-974.730] -- 0:00:10
829000 -- (-974.994) [-974.810] (-980.386) (-975.263) * (-977.293) [-976.044] (-978.488) (-974.708) -- 0:00:10
829500 -- (-979.009) (-974.878) [-978.684] (-975.621) * (-975.497) (-975.958) [-979.296] (-974.311) -- 0:00:10
830000 -- (-975.419) (-980.208) [-976.298] (-978.265) * (-982.466) (-975.943) (-977.293) [-974.834] -- 0:00:10
Average standard deviation of split frequencies: 0.006633
830500 -- (-977.115) [-974.471] (-975.896) (-975.441) * (-984.242) (-973.806) [-977.464] (-974.972) -- 0:00:10
831000 -- (-978.572) [-974.450] (-977.566) (-975.714) * (-978.090) (-975.836) (-974.492) [-976.912] -- 0:00:10
831500 -- [-975.406] (-977.226) (-985.832) (-980.793) * (-975.517) (-978.923) (-974.691) [-979.124] -- 0:00:10
832000 -- (-976.859) (-977.802) [-976.727] (-975.859) * [-974.689] (-977.204) (-978.904) (-977.818) -- 0:00:10
832500 -- (-976.828) (-978.889) (-975.505) [-974.221] * (-976.162) [-974.353] (-976.786) (-976.720) -- 0:00:10
833000 -- (-975.550) (-978.737) (-978.625) [-976.860] * [-975.722] (-975.364) (-976.070) (-974.557) -- 0:00:10
833500 -- (-974.836) [-978.947] (-979.421) (-977.041) * (-975.119) (-977.711) (-975.423) [-974.383] -- 0:00:10
834000 -- (-974.828) [-977.318] (-978.494) (-976.023) * (-974.150) (-980.415) (-977.074) [-974.254] -- 0:00:10
834500 -- (-976.944) [-975.308] (-976.097) (-976.473) * [-976.123] (-976.677) (-975.285) (-979.666) -- 0:00:10
835000 -- [-975.116] (-975.495) (-975.632) (-974.610) * [-975.285] (-975.486) (-974.995) (-977.332) -- 0:00:10
Average standard deviation of split frequencies: 0.006555
835500 -- (-974.052) (-975.048) (-975.210) [-976.108] * [-975.652] (-975.395) (-979.407) (-981.264) -- 0:00:10
836000 -- [-974.891] (-974.968) (-976.247) (-975.501) * (-977.171) (-976.349) (-974.375) [-976.239] -- 0:00:10
836500 -- (-974.577) [-976.520] (-976.258) (-974.677) * [-975.115] (-978.561) (-979.909) (-974.251) -- 0:00:10
837000 -- (-977.429) (-976.829) (-977.796) [-976.530] * (-975.953) [-978.103] (-976.272) (-975.299) -- 0:00:10
837500 -- (-975.029) (-977.450) [-977.382] (-979.063) * (-979.823) (-975.476) (-976.346) [-975.467] -- 0:00:10
838000 -- (-974.150) (-976.165) (-974.995) [-974.366] * (-976.215) [-974.488] (-975.465) (-974.736) -- 0:00:10
838500 -- [-976.128] (-974.935) (-974.930) (-977.273) * (-975.215) [-976.392] (-974.674) (-975.468) -- 0:00:10
839000 -- (-976.850) (-976.702) (-974.923) [-975.667] * (-976.285) (-975.954) (-976.703) [-977.496] -- 0:00:10
839500 -- (-975.781) (-979.904) (-976.630) [-975.065] * [-975.208] (-975.909) (-979.025) (-975.351) -- 0:00:10
840000 -- (-975.607) (-977.020) [-976.134] (-975.688) * [-973.948] (-975.447) (-978.341) (-975.960) -- 0:00:10
Average standard deviation of split frequencies: 0.006554
840500 -- (-975.336) (-976.325) (-977.075) [-977.393] * (-976.464) [-977.071] (-975.869) (-977.172) -- 0:00:10
841000 -- (-974.990) (-977.176) (-974.423) [-975.248] * (-974.943) [-976.395] (-976.165) (-975.973) -- 0:00:10
841500 -- (-975.517) (-975.707) (-974.679) [-976.523] * (-984.741) (-975.452) [-975.070] (-977.154) -- 0:00:09
842000 -- (-978.600) (-976.639) (-977.642) [-974.300] * (-986.752) (-975.031) (-976.483) [-975.922] -- 0:00:09
842500 -- (-977.681) (-975.390) [-978.284] (-974.577) * (-976.515) (-976.207) [-977.556] (-978.454) -- 0:00:09
843000 -- (-978.506) [-978.864] (-976.271) (-976.055) * (-975.066) (-977.765) [-974.914] (-981.397) -- 0:00:09
843500 -- [-980.007] (-978.780) (-975.766) (-978.358) * (-975.797) [-976.667] (-980.128) (-977.577) -- 0:00:09
844000 -- (-976.811) (-974.797) [-978.755] (-976.894) * (-979.936) (-975.937) [-976.728] (-982.947) -- 0:00:09
844500 -- [-977.642] (-978.076) (-979.423) (-974.084) * [-975.542] (-975.227) (-978.453) (-975.834) -- 0:00:09
845000 -- [-974.670] (-975.526) (-981.828) (-975.386) * (-978.043) (-977.141) (-975.912) [-975.168] -- 0:00:09
Average standard deviation of split frequencies: 0.006547
845500 -- [-976.617] (-979.131) (-978.419) (-975.113) * [-975.916] (-974.691) (-975.136) (-976.560) -- 0:00:09
846000 -- (-980.310) [-974.494] (-973.914) (-976.343) * (-974.964) (-976.213) [-977.132] (-975.248) -- 0:00:09
846500 -- (-979.711) (-984.646) (-975.082) [-978.032] * [-975.230] (-978.348) (-977.008) (-976.310) -- 0:00:09
847000 -- (-976.801) (-983.422) [-976.090] (-977.346) * [-977.769] (-975.765) (-976.646) (-976.138) -- 0:00:09
847500 -- (-978.864) [-977.274] (-976.519) (-974.753) * (-976.431) (-976.640) (-976.830) [-975.443] -- 0:00:09
848000 -- (-976.357) (-980.045) [-976.671] (-974.253) * [-977.458] (-976.583) (-979.884) (-976.735) -- 0:00:09
848500 -- (-976.086) (-980.955) (-978.503) [-975.342] * (-975.461) (-976.716) [-975.243] (-974.400) -- 0:00:09
849000 -- (-976.643) [-980.479] (-978.582) (-975.934) * (-975.800) (-974.666) (-974.141) [-976.651] -- 0:00:09
849500 -- (-974.589) (-976.528) [-975.301] (-975.703) * (-975.496) (-974.928) (-974.675) [-977.646] -- 0:00:09
850000 -- [-975.519] (-975.470) (-975.244) (-978.670) * [-976.179] (-974.741) (-975.883) (-975.977) -- 0:00:09
Average standard deviation of split frequencies: 0.006546
850500 -- (-975.973) [-978.127] (-976.111) (-976.004) * (-974.617) (-974.385) (-974.842) [-976.556] -- 0:00:09
851000 -- (-978.116) (-979.335) (-975.285) [-975.304] * [-974.423] (-978.705) (-977.317) (-975.225) -- 0:00:09
851500 -- (-976.083) [-975.886] (-980.708) (-975.536) * [-976.066] (-976.665) (-977.978) (-974.357) -- 0:00:09
852000 -- (-978.735) (-976.703) (-976.909) [-977.803] * (-976.173) (-977.614) (-976.945) [-979.114] -- 0:00:09
852500 -- (-975.551) [-974.149] (-977.716) (-979.346) * (-975.250) (-976.156) (-977.421) [-975.716] -- 0:00:09
853000 -- (-974.818) (-975.743) [-974.537] (-979.612) * (-976.237) [-974.940] (-975.791) (-976.450) -- 0:00:09
853500 -- [-976.060] (-976.451) (-976.382) (-976.817) * (-977.413) (-976.242) [-976.796] (-976.898) -- 0:00:09
854000 -- [-974.204] (-974.387) (-978.413) (-977.929) * (-976.083) [-976.759] (-975.368) (-974.856) -- 0:00:09
854500 -- (-975.372) [-978.482] (-977.423) (-975.874) * (-979.092) (-976.369) (-975.668) [-974.983] -- 0:00:09
855000 -- [-979.840] (-978.650) (-976.119) (-977.474) * [-974.723] (-974.409) (-976.064) (-975.313) -- 0:00:09
Average standard deviation of split frequencies: 0.006738
855500 -- (-977.102) (-977.677) [-976.272] (-976.339) * [-975.462] (-975.396) (-975.275) (-983.090) -- 0:00:09
856000 -- (-978.502) (-977.715) [-980.647] (-975.751) * (-977.204) (-976.057) (-974.335) [-974.129] -- 0:00:09
856500 -- (-976.493) [-977.250] (-978.925) (-974.955) * [-978.835] (-978.019) (-975.769) (-975.097) -- 0:00:09
857000 -- (-977.372) [-974.790] (-974.550) (-977.538) * (-983.831) (-975.672) (-977.576) [-977.085] -- 0:00:09
857500 -- (-977.449) (-974.340) (-977.404) [-975.351] * [-978.483] (-977.866) (-974.660) (-978.263) -- 0:00:08
858000 -- (-974.856) [-974.628] (-977.375) (-981.121) * (-975.596) (-975.239) [-974.428] (-978.534) -- 0:00:08
858500 -- (-976.508) [-974.810] (-977.738) (-980.530) * (-976.414) [-975.229] (-974.532) (-976.856) -- 0:00:08
859000 -- [-974.708] (-975.673) (-976.931) (-976.531) * (-979.483) [-974.677] (-973.902) (-978.665) -- 0:00:08
859500 -- (-975.829) (-976.092) (-980.036) [-975.251] * (-975.091) (-975.843) (-976.437) [-983.354] -- 0:00:08
860000 -- (-978.568) (-975.726) (-977.658) [-975.271] * [-974.795] (-975.867) (-975.182) (-978.209) -- 0:00:08
Average standard deviation of split frequencies: 0.006895
860500 -- (-974.736) (-975.915) [-975.581] (-975.501) * (-977.043) [-975.549] (-976.168) (-976.071) -- 0:00:08
861000 -- [-977.109] (-977.790) (-974.668) (-978.072) * (-975.001) (-974.298) [-974.329] (-974.743) -- 0:00:08
861500 -- [-977.767] (-975.993) (-976.334) (-976.375) * (-977.993) (-975.650) (-977.039) [-977.157] -- 0:00:08
862000 -- (-976.026) [-976.884] (-975.528) (-975.065) * [-976.911] (-976.434) (-975.627) (-977.678) -- 0:00:08
862500 -- (-976.782) [-975.524] (-976.602) (-976.224) * [-976.668] (-974.704) (-975.965) (-977.185) -- 0:00:08
863000 -- (-977.960) (-976.503) (-978.732) [-974.503] * (-979.173) (-974.255) [-979.126] (-974.739) -- 0:00:08
863500 -- (-975.080) (-977.166) (-977.524) [-977.729] * (-974.261) (-974.672) [-976.764] (-974.511) -- 0:00:08
864000 -- [-976.466] (-976.716) (-977.331) (-974.335) * [-979.682] (-974.612) (-976.509) (-976.807) -- 0:00:08
864500 -- [-975.419] (-975.771) (-976.354) (-977.364) * (-976.308) [-976.126] (-976.886) (-975.816) -- 0:00:08
865000 -- (-978.069) [-976.806] (-978.231) (-975.316) * (-976.811) [-984.393] (-978.553) (-978.753) -- 0:00:08
Average standard deviation of split frequencies: 0.007269
865500 -- (-974.634) (-975.655) (-974.562) [-975.932] * (-975.666) (-986.323) [-978.389] (-976.380) -- 0:00:08
866000 -- (-974.162) (-976.307) [-976.902] (-974.922) * [-979.366] (-982.458) (-975.994) (-974.351) -- 0:00:08
866500 -- [-974.557] (-976.956) (-978.539) (-974.829) * (-974.888) (-979.180) [-975.945] (-976.638) -- 0:00:08
867000 -- (-974.708) (-975.053) [-976.925] (-975.027) * (-975.385) (-977.676) [-975.712] (-980.114) -- 0:00:08
867500 -- (-978.769) [-975.772] (-975.394) (-976.202) * (-975.258) [-975.855] (-977.775) (-976.467) -- 0:00:08
868000 -- (-978.458) (-977.116) [-975.700] (-979.220) * (-978.256) [-975.472] (-977.390) (-978.135) -- 0:00:08
868500 -- (-976.004) [-974.669] (-976.463) (-976.783) * [-979.296] (-980.365) (-977.235) (-975.759) -- 0:00:08
869000 -- (-978.050) [-974.233] (-975.637) (-975.940) * (-978.637) [-975.836] (-977.697) (-976.309) -- 0:00:08
869500 -- (-977.256) (-978.358) (-975.679) [-976.474] * (-983.210) (-974.424) (-976.155) [-980.973] -- 0:00:08
870000 -- (-974.836) [-975.156] (-976.866) (-975.607) * (-978.359) (-977.415) (-975.784) [-980.804] -- 0:00:08
Average standard deviation of split frequencies: 0.006943
870500 -- (-975.791) (-977.481) [-975.163] (-975.756) * (-980.811) (-976.079) (-974.976) [-976.534] -- 0:00:08
871000 -- (-974.907) (-976.226) (-975.030) [-975.221] * [-975.869] (-975.193) (-977.146) (-976.047) -- 0:00:08
871500 -- (-975.344) (-974.397) (-977.089) [-976.726] * (-977.179) (-975.172) [-977.830] (-984.142) -- 0:00:08
872000 -- (-975.910) (-975.360) [-978.225] (-977.910) * [-974.553] (-977.536) (-979.466) (-975.142) -- 0:00:08
872500 -- (-975.017) [-977.152] (-980.326) (-980.376) * [-977.721] (-975.783) (-975.175) (-975.116) -- 0:00:08
873000 -- (-974.899) (-977.117) [-976.499] (-977.877) * (-976.613) (-976.520) (-975.763) [-975.171] -- 0:00:08
873500 -- (-975.579) [-975.813] (-978.377) (-978.295) * (-979.355) [-975.020] (-976.419) (-975.001) -- 0:00:07
874000 -- (-975.188) (-978.652) (-975.368) [-976.410] * (-977.310) [-974.718] (-978.928) (-980.649) -- 0:00:07
874500 -- (-975.736) (-975.649) [-975.872] (-978.054) * [-977.756] (-975.149) (-976.283) (-976.031) -- 0:00:07
875000 -- (-980.665) (-975.143) (-974.550) [-976.903] * (-974.208) [-975.876] (-978.804) (-978.586) -- 0:00:07
Average standard deviation of split frequencies: 0.006932
875500 -- (-974.767) (-977.180) (-975.059) [-975.493] * [-974.702] (-976.141) (-975.847) (-978.191) -- 0:00:07
876000 -- (-976.918) (-975.831) [-974.349] (-975.396) * [-975.698] (-977.486) (-974.492) (-977.237) -- 0:00:07
876500 -- (-977.637) (-979.382) (-974.822) [-975.324] * (-979.029) (-980.032) [-975.893] (-978.781) -- 0:00:07
877000 -- (-976.825) (-977.060) (-977.405) [-976.024] * (-974.802) (-980.198) (-976.964) [-979.197] -- 0:00:07
877500 -- (-975.523) (-974.931) [-976.726] (-974.666) * (-975.688) [-975.018] (-974.338) (-976.466) -- 0:00:07
878000 -- (-977.800) (-980.833) (-982.013) [-975.248] * (-977.995) (-976.017) (-975.616) [-975.392] -- 0:00:07
878500 -- (-975.680) [-977.778] (-980.073) (-976.423) * (-976.900) [-976.427] (-974.904) (-976.596) -- 0:00:07
879000 -- [-975.705] (-977.788) (-981.565) (-975.565) * (-976.573) (-976.653) [-975.744] (-980.795) -- 0:00:07
879500 -- (-979.705) (-974.527) (-976.258) [-974.613] * (-975.611) (-974.646) [-979.248] (-976.186) -- 0:00:07
880000 -- (-975.285) [-975.987] (-976.529) (-974.177) * (-977.281) (-975.150) (-975.928) [-975.214] -- 0:00:07
Average standard deviation of split frequencies: 0.006591
880500 -- [-976.967] (-976.133) (-973.863) (-977.725) * (-980.411) (-975.483) (-976.429) [-975.913] -- 0:00:07
881000 -- [-975.798] (-975.299) (-975.108) (-976.107) * (-978.014) [-975.509] (-976.268) (-978.296) -- 0:00:07
881500 -- (-977.297) (-976.851) [-974.421] (-976.498) * [-977.177] (-975.571) (-975.639) (-979.866) -- 0:00:07
882000 -- (-975.458) (-976.455) (-976.374) [-975.185] * (-975.328) (-976.885) [-975.384] (-977.444) -- 0:00:07
882500 -- [-976.068] (-975.167) (-977.544) (-974.667) * (-978.263) [-977.814] (-974.958) (-977.383) -- 0:00:07
883000 -- (-974.697) [-974.933] (-976.326) (-975.905) * (-974.243) (-976.173) (-975.418) [-978.433] -- 0:00:07
883500 -- (-975.143) (-974.742) (-977.213) [-977.495] * (-979.575) (-979.894) (-974.340) [-976.877] -- 0:00:07
884000 -- (-974.933) (-977.299) (-979.315) [-974.130] * (-974.901) [-975.556] (-976.151) (-976.554) -- 0:00:07
884500 -- (-975.598) (-977.361) [-975.747] (-973.922) * (-974.528) (-978.976) [-975.916] (-977.125) -- 0:00:07
885000 -- (-974.516) (-979.654) [-976.368] (-974.833) * (-980.401) (-978.490) (-975.211) [-976.790] -- 0:00:07
Average standard deviation of split frequencies: 0.006729
885500 -- (-974.982) [-975.019] (-975.287) (-976.476) * (-976.744) [-974.277] (-975.275) (-976.653) -- 0:00:07
886000 -- (-984.527) (-976.013) [-974.468] (-976.153) * (-974.987) [-977.262] (-977.720) (-976.281) -- 0:00:07
886500 -- (-983.883) (-975.619) [-977.509] (-978.607) * (-976.837) (-975.276) (-975.328) [-975.249] -- 0:00:07
887000 -- (-977.518) [-976.153] (-977.464) (-974.838) * (-978.015) (-975.339) (-976.752) [-976.203] -- 0:00:07
887500 -- [-977.586] (-974.969) (-976.025) (-974.190) * (-976.994) [-974.948] (-975.637) (-976.874) -- 0:00:07
888000 -- (-976.164) [-979.295] (-979.485) (-977.811) * (-976.770) (-975.502) [-974.216] (-974.568) -- 0:00:07
888500 -- (-975.636) (-975.668) [-980.455] (-974.677) * (-977.448) (-976.397) [-975.092] (-974.390) -- 0:00:07
889000 -- [-974.102] (-975.317) (-975.514) (-978.154) * [-977.296] (-977.599) (-974.430) (-978.577) -- 0:00:06
889500 -- [-975.902] (-979.772) (-978.516) (-976.789) * (-975.718) [-976.349] (-977.276) (-978.655) -- 0:00:06
890000 -- (-976.748) (-977.252) (-977.189) [-979.294] * (-978.123) (-974.527) [-977.106] (-976.768) -- 0:00:06
Average standard deviation of split frequencies: 0.006781
890500 -- (-979.382) (-977.012) [-976.197] (-977.400) * (-975.207) [-976.702] (-976.103) (-978.716) -- 0:00:06
891000 -- (-975.074) (-975.982) [-974.791] (-976.428) * [-975.769] (-976.205) (-975.591) (-978.245) -- 0:00:06
891500 -- (-974.565) (-978.405) (-976.312) [-975.573] * [-975.662] (-977.556) (-974.616) (-977.209) -- 0:00:06
892000 -- (-976.189) (-976.615) (-975.253) [-976.965] * (-978.046) [-977.557] (-976.325) (-975.650) -- 0:00:06
892500 -- (-976.431) (-975.849) [-978.316] (-975.164) * (-975.450) (-977.436) [-978.425] (-975.539) -- 0:00:06
893000 -- [-976.252] (-975.206) (-978.680) (-975.119) * (-977.813) [-974.381] (-975.987) (-976.780) -- 0:00:06
893500 -- [-976.805] (-976.178) (-978.509) (-977.620) * (-976.167) (-976.452) (-976.604) [-974.913] -- 0:00:06
894000 -- (-976.181) (-976.422) [-979.981] (-976.255) * (-979.270) (-975.859) [-979.594] (-975.108) -- 0:00:06
894500 -- (-975.231) [-974.114] (-978.093) (-979.681) * [-974.900] (-974.422) (-975.642) (-974.679) -- 0:00:06
895000 -- (-977.621) (-975.409) (-974.488) [-978.231] * [-974.077] (-975.073) (-975.529) (-977.552) -- 0:00:06
Average standard deviation of split frequencies: 0.006708
895500 -- (-978.422) (-974.806) [-974.712] (-976.677) * (-974.352) (-978.983) (-976.392) [-976.154] -- 0:00:06
896000 -- (-976.003) (-976.352) (-974.735) [-975.470] * (-974.208) (-975.142) [-975.690] (-978.446) -- 0:00:06
896500 -- (-976.876) [-977.248] (-974.722) (-975.542) * (-975.065) [-974.472] (-975.986) (-978.748) -- 0:00:06
897000 -- [-977.755] (-977.377) (-975.237) (-975.882) * (-975.790) [-975.887] (-980.010) (-974.556) -- 0:00:06
897500 -- (-978.698) (-975.738) (-975.979) [-976.385] * [-976.246] (-974.205) (-978.444) (-978.282) -- 0:00:06
898000 -- (-977.631) (-984.812) [-976.466] (-974.773) * (-975.190) [-978.466] (-977.129) (-977.802) -- 0:00:06
898500 -- [-978.027] (-976.675) (-974.809) (-977.246) * (-974.864) (-977.110) (-975.035) [-979.350] -- 0:00:06
899000 -- [-977.053] (-979.961) (-979.059) (-975.042) * (-976.078) (-976.531) (-977.102) [-977.973] -- 0:00:06
899500 -- (-976.503) (-980.610) (-979.047) [-974.640] * [-976.753] (-975.476) (-976.887) (-976.287) -- 0:00:06
900000 -- (-977.729) [-976.904] (-975.781) (-976.111) * (-976.003) (-976.725) (-975.996) [-974.554] -- 0:00:06
Average standard deviation of split frequencies: 0.006313
900500 -- (-975.220) (-976.909) [-974.845] (-977.747) * (-975.175) (-976.636) [-976.904] (-982.919) -- 0:00:06
901000 -- (-977.529) [-979.019] (-979.689) (-974.895) * (-976.776) (-981.490) (-982.489) [-978.283] -- 0:00:06
901500 -- (-975.327) (-975.261) (-975.309) [-974.343] * (-976.915) [-976.742] (-976.204) (-975.078) -- 0:00:06
902000 -- (-977.246) (-974.931) (-975.941) [-975.619] * [-974.527] (-986.711) (-978.508) (-978.461) -- 0:00:06
902500 -- (-977.773) (-974.899) [-974.625] (-978.126) * (-978.715) (-975.886) (-975.500) [-975.249] -- 0:00:06
903000 -- [-976.334] (-975.602) (-974.459) (-977.222) * (-976.978) (-982.625) (-975.021) [-980.946] -- 0:00:06
903500 -- (-980.041) [-975.075] (-979.484) (-975.182) * [-975.673] (-978.557) (-977.295) (-974.055) -- 0:00:06
904000 -- (-975.995) (-975.123) [-975.529] (-975.194) * (-975.898) (-976.051) (-977.740) [-974.024] -- 0:00:06
904500 -- (-975.674) [-974.779] (-975.175) (-976.094) * (-980.837) [-974.283] (-978.227) (-974.216) -- 0:00:06
905000 -- (-975.464) (-974.624) [-976.432] (-975.839) * (-978.574) (-976.163) (-976.569) [-974.805] -- 0:00:05
Average standard deviation of split frequencies: 0.006611
905500 -- (-974.846) (-974.599) [-975.431] (-975.524) * (-975.862) (-977.115) (-974.587) [-976.330] -- 0:00:05
906000 -- (-974.400) (-974.587) (-976.328) [-977.389] * [-977.154] (-977.064) (-974.698) (-974.816) -- 0:00:05
906500 -- (-974.527) (-976.677) (-980.924) [-975.049] * (-977.765) (-974.110) (-974.472) [-974.508] -- 0:00:05
907000 -- [-974.843] (-979.894) (-977.786) (-976.910) * [-975.949] (-979.411) (-977.461) (-976.107) -- 0:00:05
907500 -- (-975.827) [-975.373] (-974.012) (-976.307) * (-975.812) (-975.794) [-978.056] (-974.557) -- 0:00:05
908000 -- (-980.412) (-975.225) (-973.880) [-974.030] * (-980.310) [-976.296] (-975.684) (-976.038) -- 0:00:05
908500 -- (-976.498) [-977.901] (-973.886) (-976.210) * (-980.759) [-975.778] (-975.445) (-976.412) -- 0:00:05
909000 -- (-975.600) (-974.348) [-974.417] (-976.768) * [-978.167] (-976.594) (-974.312) (-978.022) -- 0:00:05
909500 -- [-977.746] (-975.769) (-974.311) (-977.674) * (-974.350) [-976.079] (-974.506) (-975.694) -- 0:00:05
910000 -- [-976.638] (-977.156) (-978.754) (-974.743) * (-979.342) (-976.514) [-978.457] (-976.652) -- 0:00:05
Average standard deviation of split frequencies: 0.006577
910500 -- (-976.499) [-977.155] (-976.584) (-975.675) * [-975.206] (-977.052) (-978.717) (-977.282) -- 0:00:05
911000 -- (-975.919) (-976.457) [-976.124] (-975.405) * (-977.213) [-974.495] (-977.857) (-975.605) -- 0:00:05
911500 -- (-975.122) (-976.473) [-978.114] (-976.098) * [-976.582] (-973.955) (-976.586) (-974.192) -- 0:00:05
912000 -- (-977.227) [-977.456] (-975.554) (-976.414) * [-976.767] (-977.661) (-977.289) (-979.732) -- 0:00:05
912500 -- [-974.945] (-974.852) (-978.751) (-975.142) * (-974.932) [-976.487] (-978.950) (-979.360) -- 0:00:05
913000 -- (-975.914) [-974.458] (-985.592) (-976.768) * (-974.356) [-978.228] (-979.617) (-974.492) -- 0:00:05
913500 -- [-974.211] (-976.801) (-978.322) (-981.060) * (-977.748) [-974.583] (-974.947) (-975.857) -- 0:00:05
914000 -- (-975.863) (-974.627) (-977.083) [-977.804] * (-975.541) [-978.282] (-975.249) (-974.438) -- 0:00:05
914500 -- (-982.263) (-977.488) [-974.467] (-978.181) * (-977.550) (-974.857) [-975.136] (-975.585) -- 0:00:05
915000 -- [-977.210] (-976.845) (-976.136) (-976.297) * (-975.087) [-975.058] (-974.918) (-975.916) -- 0:00:05
Average standard deviation of split frequencies: 0.006599
915500 -- (-975.340) (-974.329) [-976.659] (-980.992) * (-977.702) (-974.679) (-977.622) [-974.718] -- 0:00:05
916000 -- (-975.128) (-975.322) [-975.685] (-979.080) * (-975.857) (-974.933) [-978.320] (-975.092) -- 0:00:05
916500 -- (-974.850) (-982.184) (-975.009) [-976.556] * (-978.799) (-975.955) [-975.237] (-977.134) -- 0:00:05
917000 -- (-975.643) (-976.570) [-975.691] (-976.164) * (-975.467) (-975.346) (-975.506) [-974.734] -- 0:00:05
917500 -- (-976.300) [-977.119] (-979.929) (-979.291) * (-977.586) (-976.324) (-975.291) [-977.379] -- 0:00:05
918000 -- (-977.121) (-980.632) (-978.447) [-978.716] * (-974.741) [-977.631] (-976.517) (-977.209) -- 0:00:05
918500 -- (-977.654) (-978.702) (-978.888) [-974.496] * (-978.243) (-977.195) (-978.028) [-978.422] -- 0:00:05
919000 -- [-978.425] (-978.149) (-978.169) (-974.946) * [-981.634] (-983.091) (-979.290) (-980.656) -- 0:00:05
919500 -- [-981.694] (-976.618) (-975.287) (-976.097) * (-975.026) [-979.770] (-976.395) (-977.439) -- 0:00:05
920000 -- (-976.416) (-979.532) (-976.448) [-975.354] * (-975.450) (-974.657) [-974.613] (-974.942) -- 0:00:05
Average standard deviation of split frequencies: 0.006686
920500 -- [-975.283] (-979.024) (-975.979) (-978.100) * (-975.946) (-974.059) (-975.198) [-975.993] -- 0:00:05
921000 -- [-974.933] (-981.169) (-976.891) (-981.074) * (-978.583) (-975.188) [-978.088] (-975.843) -- 0:00:04
921500 -- [-976.987] (-980.216) (-975.611) (-974.592) * (-975.687) [-974.961] (-976.151) (-978.992) -- 0:00:04
922000 -- (-975.690) (-977.860) [-976.081] (-974.917) * (-974.736) (-975.798) [-975.600] (-977.129) -- 0:00:04
922500 -- (-976.490) [-978.583] (-985.192) (-974.692) * (-977.104) (-978.600) (-975.108) [-975.728] -- 0:00:04
923000 -- (-974.557) (-976.061) (-982.417) [-974.999] * (-980.487) [-978.322] (-976.683) (-977.157) -- 0:00:04
923500 -- (-977.834) (-975.769) (-976.753) [-976.822] * (-977.946) (-978.092) (-974.078) [-975.827] -- 0:00:04
924000 -- [-975.523] (-974.042) (-974.922) (-974.442) * (-977.628) (-974.541) (-974.356) [-975.967] -- 0:00:04
924500 -- (-974.376) (-974.572) [-974.904] (-976.212) * (-974.237) (-974.234) (-975.634) [-974.087] -- 0:00:04
925000 -- [-975.012] (-975.973) (-976.543) (-979.178) * [-976.619] (-974.798) (-975.045) (-976.576) -- 0:00:04
Average standard deviation of split frequencies: 0.006558
925500 -- [-977.641] (-974.814) (-977.329) (-975.323) * [-981.480] (-977.020) (-975.362) (-975.883) -- 0:00:04
926000 -- (-975.851) [-974.691] (-975.940) (-978.024) * [-977.170] (-977.239) (-976.675) (-976.846) -- 0:00:04
926500 -- (-974.724) [-977.628] (-978.847) (-975.450) * (-977.887) [-979.084] (-975.472) (-974.922) -- 0:00:04
927000 -- (-974.826) (-976.135) (-974.738) [-974.958] * (-978.019) [-974.341] (-976.089) (-978.148) -- 0:00:04
927500 -- (-975.568) [-978.044] (-974.738) (-974.946) * (-977.255) (-975.059) (-975.993) [-973.760] -- 0:00:04
928000 -- [-976.038] (-974.571) (-977.542) (-975.972) * (-976.761) (-978.007) (-978.395) [-973.972] -- 0:00:04
928500 -- [-976.909] (-975.212) (-979.461) (-980.245) * (-974.610) (-977.248) (-974.489) [-974.244] -- 0:00:04
929000 -- [-976.111] (-976.739) (-975.184) (-977.628) * [-976.315] (-976.022) (-975.694) (-979.976) -- 0:00:04
929500 -- (-979.019) [-978.469] (-975.881) (-977.113) * (-976.042) (-975.601) (-978.111) [-980.338] -- 0:00:04
930000 -- (-975.001) (-982.039) [-974.783] (-976.603) * [-976.427] (-976.689) (-977.054) (-976.435) -- 0:00:04
Average standard deviation of split frequencies: 0.006555
930500 -- (-979.488) (-975.232) [-977.706] (-977.009) * (-975.287) (-975.755) [-976.066] (-976.803) -- 0:00:04
931000 -- (-974.291) (-978.786) (-978.532) [-977.627] * (-978.797) (-975.596) (-975.610) [-974.816] -- 0:00:04
931500 -- [-974.017] (-979.152) (-977.745) (-976.917) * [-975.328] (-975.072) (-975.206) (-975.220) -- 0:00:04
932000 -- [-973.993] (-977.426) (-980.670) (-974.347) * (-975.363) (-974.459) [-975.233] (-975.032) -- 0:00:04
932500 -- (-976.560) (-978.209) (-980.066) [-975.230] * [-974.857] (-978.258) (-974.220) (-976.480) -- 0:00:04
933000 -- (-975.647) (-975.589) (-978.716) [-976.250] * (-974.973) (-979.232) [-975.442] (-974.471) -- 0:00:04
933500 -- (-975.827) (-975.203) (-976.626) [-974.963] * (-974.615) (-977.893) (-974.867) [-975.185] -- 0:00:04
934000 -- (-976.496) [-978.587] (-975.831) (-975.222) * (-974.961) [-976.082] (-974.081) (-974.540) -- 0:00:04
934500 -- [-977.813] (-977.726) (-979.179) (-975.957) * (-975.812) [-976.064] (-974.076) (-974.517) -- 0:00:04
935000 -- (-975.142) [-978.283] (-976.035) (-977.577) * [-975.037] (-974.259) (-977.656) (-974.555) -- 0:00:04
Average standard deviation of split frequencies: 0.006725
935500 -- (-975.139) [-977.718] (-980.474) (-975.117) * (-978.465) (-975.198) [-974.587] (-975.373) -- 0:00:04
936000 -- (-974.800) (-978.647) [-975.396] (-976.695) * (-975.570) (-976.017) (-978.458) [-974.411] -- 0:00:04
936500 -- (-980.289) (-978.502) [-975.722] (-976.811) * (-974.990) (-978.912) [-975.735] (-974.700) -- 0:00:04
937000 -- (-976.620) (-976.314) (-977.129) [-976.110] * (-978.630) (-976.181) [-976.543] (-974.952) -- 0:00:03
937500 -- [-978.057] (-975.498) (-976.301) (-975.224) * (-976.539) [-976.083] (-974.094) (-977.095) -- 0:00:03
938000 -- (-974.919) (-975.454) [-977.258] (-974.758) * (-974.627) [-976.499] (-975.495) (-975.760) -- 0:00:03
938500 -- (-979.650) (-975.812) [-975.018] (-976.472) * (-974.654) [-976.815] (-978.315) (-978.649) -- 0:00:03
939000 -- [-974.795] (-976.807) (-977.864) (-977.023) * (-978.744) (-975.925) [-977.734] (-975.716) -- 0:00:03
939500 -- (-976.590) (-976.048) [-976.031] (-976.511) * (-975.219) [-975.207] (-976.771) (-978.532) -- 0:00:03
940000 -- (-974.350) (-976.252) (-976.635) [-975.051] * (-976.661) (-975.140) [-978.183] (-981.610) -- 0:00:03
Average standard deviation of split frequencies: 0.006751
940500 -- (-975.229) (-977.759) (-975.107) [-976.600] * [-973.869] (-980.294) (-975.610) (-976.061) -- 0:00:03
941000 -- (-976.156) (-979.389) (-976.254) [-978.034] * (-973.819) (-977.041) [-975.462] (-977.574) -- 0:00:03
941500 -- [-975.936] (-982.123) (-979.702) (-976.348) * (-974.407) (-976.603) [-974.483] (-977.554) -- 0:00:03
942000 -- (-975.924) [-974.510] (-977.034) (-982.305) * [-977.656] (-975.918) (-974.894) (-975.432) -- 0:00:03
942500 -- (-980.066) (-974.553) [-978.296] (-975.842) * (-975.487) (-976.298) [-975.364] (-975.374) -- 0:00:03
943000 -- (-975.400) [-974.606] (-979.283) (-977.954) * (-975.620) (-980.799) [-974.114] (-975.894) -- 0:00:03
943500 -- (-977.606) (-975.757) [-974.249] (-980.390) * [-978.790] (-977.515) (-974.763) (-975.479) -- 0:00:03
944000 -- (-974.074) [-974.961] (-974.665) (-976.991) * [-974.798] (-974.846) (-980.435) (-976.026) -- 0:00:03
944500 -- (-975.294) (-975.109) (-975.053) [-980.743] * (-976.390) (-980.302) [-974.795] (-975.743) -- 0:00:03
945000 -- [-976.046] (-975.380) (-975.477) (-976.100) * (-976.770) (-975.766) [-977.782] (-974.813) -- 0:00:03
Average standard deviation of split frequencies: 0.006830
945500 -- (-974.398) [-975.574] (-977.323) (-976.060) * (-978.860) (-975.851) (-977.063) [-976.238] -- 0:00:03
946000 -- [-976.681] (-975.982) (-977.655) (-977.314) * (-975.788) (-974.798) [-975.727] (-975.480) -- 0:00:03
946500 -- (-977.284) (-978.083) (-975.841) [-976.866] * [-976.667] (-979.049) (-977.461) (-977.092) -- 0:00:03
947000 -- [-977.804] (-976.068) (-975.293) (-978.138) * [-977.850] (-979.416) (-983.242) (-976.854) -- 0:00:03
947500 -- (-981.346) (-977.218) (-976.564) [-975.335] * (-976.572) (-975.824) (-979.333) [-975.583] -- 0:00:03
948000 -- [-975.437] (-974.329) (-976.704) (-977.549) * [-976.125] (-978.435) (-979.089) (-975.258) -- 0:00:03
948500 -- [-975.764] (-975.537) (-977.013) (-976.283) * (-977.427) [-976.231] (-975.741) (-974.645) -- 0:00:03
949000 -- (-975.619) (-975.929) (-975.308) [-976.134] * [-975.777] (-976.182) (-975.777) (-974.808) -- 0:00:03
949500 -- (-976.838) [-974.073] (-974.239) (-975.041) * [-975.421] (-976.353) (-975.455) (-976.077) -- 0:00:03
950000 -- (-976.167) (-977.962) (-975.143) [-974.821] * [-974.754] (-975.914) (-975.221) (-978.049) -- 0:00:03
Average standard deviation of split frequencies: 0.006855
950500 -- (-974.643) [-973.840] (-975.415) (-975.051) * (-979.025) (-977.184) (-978.092) [-974.128] -- 0:00:03
951000 -- [-975.546] (-980.662) (-976.604) (-975.002) * [-979.996] (-976.717) (-979.992) (-975.016) -- 0:00:03
951500 -- (-974.071) (-978.925) (-976.642) [-974.991] * (-976.404) (-976.928) (-977.910) [-976.329] -- 0:00:03
952000 -- (-976.034) [-978.255] (-974.547) (-978.058) * (-977.728) (-974.418) (-981.023) [-975.473] -- 0:00:03
952500 -- (-974.735) (-974.880) [-974.648] (-977.104) * (-975.498) [-974.731] (-974.841) (-976.717) -- 0:00:02
953000 -- (-977.093) (-976.039) (-975.271) [-974.823] * (-974.902) (-975.084) (-978.772) [-976.076] -- 0:00:02
953500 -- (-975.535) (-976.102) [-974.299] (-976.642) * [-979.928] (-978.448) (-976.233) (-976.098) -- 0:00:02
954000 -- (-976.384) (-974.793) (-978.038) [-975.243] * (-981.842) (-977.298) [-975.442] (-976.056) -- 0:00:02
954500 -- (-976.539) (-981.366) [-976.953] (-977.407) * (-980.215) [-975.828] (-976.248) (-976.551) -- 0:00:02
955000 -- (-975.686) (-975.931) [-975.680] (-974.734) * (-979.270) (-979.648) [-974.540] (-977.357) -- 0:00:02
Average standard deviation of split frequencies: 0.007164
955500 -- (-975.363) (-976.584) [-976.984] (-974.303) * (-976.323) (-974.573) [-974.493] (-976.032) -- 0:00:02
956000 -- (-975.906) (-978.609) [-974.388] (-978.167) * (-977.640) (-974.921) (-976.015) [-975.223] -- 0:00:02
956500 -- (-976.088) [-973.737] (-975.272) (-977.374) * (-977.427) (-981.303) [-974.816] (-975.805) -- 0:00:02
957000 -- (-975.249) [-976.260] (-978.332) (-978.232) * [-974.703] (-976.254) (-977.591) (-974.523) -- 0:00:02
957500 -- (-976.423) (-976.869) [-979.337] (-975.244) * (-977.692) (-976.226) (-977.075) [-975.648] -- 0:00:02
958000 -- (-977.502) (-977.296) [-976.259] (-975.965) * (-978.187) (-975.293) (-975.792) [-976.840] -- 0:00:02
958500 -- (-976.989) [-977.581] (-974.181) (-977.043) * (-975.372) (-980.883) (-977.045) [-975.985] -- 0:00:02
959000 -- (-976.895) (-976.083) [-974.871] (-974.547) * (-975.163) (-978.525) (-975.029) [-974.710] -- 0:00:02
959500 -- [-975.768] (-978.766) (-979.652) (-974.606) * (-977.407) [-976.137] (-974.744) (-976.191) -- 0:00:02
960000 -- [-982.986] (-978.945) (-976.891) (-975.259) * (-980.502) [-974.266] (-975.447) (-976.735) -- 0:00:02
Average standard deviation of split frequencies: 0.007072
960500 -- (-981.197) (-974.502) (-979.210) [-978.403] * (-980.055) (-974.667) [-976.831] (-975.729) -- 0:00:02
961000 -- (-977.345) (-975.170) (-979.121) [-977.680] * (-977.891) (-975.650) (-980.462) [-977.347] -- 0:00:02
961500 -- [-974.898] (-976.557) (-976.723) (-977.474) * (-975.729) [-975.119] (-979.170) (-978.375) -- 0:00:02
962000 -- (-975.253) [-976.330] (-975.586) (-976.044) * (-979.484) (-975.754) (-975.891) [-974.534] -- 0:00:02
962500 -- [-974.616] (-974.944) (-974.080) (-974.598) * (-978.492) (-975.384) (-978.865) [-976.206] -- 0:00:02
963000 -- (-981.574) (-973.931) (-975.558) [-974.317] * [-977.361] (-974.838) (-976.539) (-977.133) -- 0:00:02
963500 -- (-984.328) (-974.767) [-974.995] (-976.549) * (-976.711) [-977.177] (-977.764) (-978.049) -- 0:00:02
964000 -- (-979.500) (-976.168) (-978.913) [-974.605] * (-975.852) (-979.381) (-975.182) [-974.488] -- 0:00:02
964500 -- (-980.655) [-974.454] (-979.628) (-976.418) * (-975.874) (-976.614) [-975.263] (-979.667) -- 0:00:02
965000 -- (-978.711) [-976.376] (-975.928) (-976.438) * [-974.596] (-974.668) (-975.913) (-978.902) -- 0:00:02
Average standard deviation of split frequencies: 0.006889
965500 -- (-982.568) (-975.811) [-975.597] (-977.282) * [-974.988] (-974.632) (-978.035) (-974.037) -- 0:00:02
966000 -- (-984.871) [-976.061] (-974.192) (-976.142) * (-974.483) [-974.978] (-976.274) (-974.680) -- 0:00:02
966500 -- (-982.380) (-975.210) (-976.360) [-975.867] * (-975.271) (-975.062) [-975.972] (-978.481) -- 0:00:02
967000 -- (-975.532) (-977.086) (-974.803) [-975.120] * (-976.547) (-975.285) (-977.052) [-975.555] -- 0:00:02
967500 -- [-977.945] (-978.640) (-977.186) (-979.599) * (-973.938) (-974.780) (-977.618) [-978.626] -- 0:00:02
968000 -- (-975.448) (-975.457) (-974.353) [-976.290] * (-975.523) (-975.048) [-975.682] (-979.591) -- 0:00:02
968500 -- (-974.966) [-974.588] (-976.292) (-975.796) * [-974.331] (-978.512) (-977.783) (-977.741) -- 0:00:01
969000 -- (-978.825) [-975.884] (-973.930) (-976.625) * (-976.332) (-978.226) (-975.354) [-977.438] -- 0:00:01
969500 -- (-978.591) [-976.569] (-975.368) (-976.074) * [-976.231] (-976.115) (-974.781) (-977.683) -- 0:00:01
970000 -- (-977.235) (-976.632) [-975.725] (-979.050) * (-978.451) (-976.817) (-976.676) [-974.801] -- 0:00:01
Average standard deviation of split frequencies: 0.007285
970500 -- [-977.721] (-976.581) (-975.127) (-977.156) * (-976.103) (-975.566) (-977.125) [-975.131] -- 0:00:01
971000 -- (-976.296) (-977.787) (-975.621) [-976.103] * (-976.332) [-975.131] (-975.043) (-975.792) -- 0:00:01
971500 -- (-975.643) [-976.795] (-979.051) (-976.508) * (-975.036) (-976.285) (-974.198) [-975.456] -- 0:00:01
972000 -- (-980.439) (-975.881) (-975.259) [-976.102] * (-976.789) (-975.061) [-973.991] (-975.551) -- 0:00:01
972500 -- (-977.305) (-977.565) (-978.129) [-976.815] * [-976.996] (-974.971) (-983.960) (-975.864) -- 0:00:01
973000 -- (-975.877) (-978.138) [-974.987] (-974.292) * (-974.530) [-974.960] (-975.188) (-976.429) -- 0:00:01
973500 -- (-975.864) [-974.806] (-983.667) (-974.886) * (-978.516) (-974.957) [-976.842] (-978.757) -- 0:00:01
974000 -- (-975.327) (-974.491) [-976.747] (-974.289) * (-976.271) (-977.351) (-976.554) [-976.031] -- 0:00:01
974500 -- (-976.362) [-981.730] (-976.272) (-977.364) * (-976.545) (-975.458) (-978.710) [-976.416] -- 0:00:01
975000 -- [-976.812] (-977.749) (-975.232) (-986.690) * (-976.557) (-974.601) [-977.197] (-974.502) -- 0:00:01
Average standard deviation of split frequencies: 0.007034
975500 -- (-976.888) (-979.897) (-978.967) [-983.724] * (-976.263) (-976.137) [-978.894] (-974.625) -- 0:00:01
976000 -- (-977.070) [-974.155] (-978.703) (-977.715) * [-976.464] (-982.547) (-974.919) (-977.830) -- 0:00:01
976500 -- (-976.238) (-974.748) [-979.382] (-981.394) * (-981.896) (-977.568) (-974.316) [-978.053] -- 0:00:01
977000 -- [-974.038] (-975.816) (-978.491) (-977.196) * (-977.677) [-975.762] (-975.386) (-980.185) -- 0:00:01
977500 -- (-976.074) (-975.189) (-976.090) [-977.783] * [-978.947] (-977.244) (-975.750) (-977.711) -- 0:00:01
978000 -- (-977.858) [-975.242] (-974.886) (-975.294) * (-975.891) (-974.619) (-977.885) [-978.686] -- 0:00:01
978500 -- (-975.799) [-979.397] (-976.420) (-974.559) * [-977.411] (-976.034) (-974.949) (-975.588) -- 0:00:01
979000 -- (-978.722) (-974.412) (-977.917) [-974.269] * (-978.625) (-976.485) [-975.514] (-974.115) -- 0:00:01
979500 -- (-974.827) (-975.998) (-975.526) [-975.922] * (-976.506) (-977.879) (-976.386) [-976.096] -- 0:00:01
980000 -- (-974.030) (-976.927) [-974.377] (-978.008) * (-975.699) (-974.086) (-975.295) [-975.090] -- 0:00:01
Average standard deviation of split frequencies: 0.007182
980500 -- (-978.051) (-974.925) (-975.168) [-977.727] * (-976.312) (-976.347) (-977.419) [-974.654] -- 0:00:01
981000 -- (-976.896) [-976.026] (-977.887) (-975.589) * (-974.962) (-974.143) (-976.832) [-974.649] -- 0:00:01
981500 -- [-976.385] (-981.501) (-980.841) (-975.396) * (-974.433) (-975.982) [-976.656] (-974.294) -- 0:00:01
982000 -- (-978.025) (-979.553) [-977.882] (-976.529) * (-974.294) (-977.613) [-975.855] (-974.186) -- 0:00:01
982500 -- (-982.078) (-979.701) (-980.401) [-975.031] * (-976.056) (-975.314) [-975.794] (-978.863) -- 0:00:01
983000 -- (-980.726) (-976.035) (-980.381) [-976.855] * (-976.095) (-975.555) (-978.699) [-975.596] -- 0:00:01
983500 -- (-977.552) (-976.176) [-975.750] (-979.577) * (-975.772) [-976.106] (-981.478) (-975.917) -- 0:00:01
984000 -- (-976.407) (-976.644) [-973.993] (-975.573) * (-975.937) (-976.146) [-974.742] (-977.350) -- 0:00:01
984500 -- (-974.430) (-976.896) (-977.319) [-975.882] * (-975.295) (-974.428) [-980.403] (-976.517) -- 0:00:00
985000 -- (-976.769) [-978.701] (-976.318) (-975.376) * (-975.109) (-975.260) [-977.055] (-975.460) -- 0:00:00
Average standard deviation of split frequencies: 0.007231
985500 -- (-976.241) (-974.578) (-976.334) [-976.674] * [-975.417] (-978.471) (-978.528) (-975.470) -- 0:00:00
986000 -- (-978.299) (-975.393) (-975.161) [-975.652] * (-975.902) (-975.062) [-975.202] (-975.628) -- 0:00:00
986500 -- (-978.331) (-974.754) (-976.675) [-974.132] * (-974.965) (-977.174) (-976.978) [-975.442] -- 0:00:00
987000 -- [-976.040] (-974.075) (-980.456) (-974.668) * (-975.283) [-977.644] (-976.402) (-977.083) -- 0:00:00
987500 -- (-974.496) [-975.299] (-979.195) (-975.370) * (-976.393) [-974.635] (-978.414) (-975.404) -- 0:00:00
988000 -- (-975.678) [-975.062] (-979.274) (-978.108) * [-976.431] (-975.549) (-978.831) (-975.200) -- 0:00:00
988500 -- [-974.001] (-974.321) (-975.729) (-975.981) * (-977.372) [-975.029] (-978.669) (-974.858) -- 0:00:00
989000 -- (-977.994) [-975.660] (-982.153) (-975.400) * (-976.356) (-976.598) (-977.693) [-976.590] -- 0:00:00
989500 -- (-982.298) [-974.916] (-977.883) (-976.299) * (-974.859) (-978.129) [-975.210] (-978.546) -- 0:00:00
990000 -- [-976.198] (-974.725) (-978.801) (-976.385) * (-974.372) [-974.910] (-977.647) (-974.927) -- 0:00:00
Average standard deviation of split frequencies: 0.007138
990500 -- [-976.995] (-978.974) (-976.313) (-977.364) * (-976.203) (-976.160) (-980.310) [-975.367] -- 0:00:00
991000 -- (-975.842) (-975.124) [-977.418] (-974.594) * (-975.995) [-977.415] (-976.413) (-975.031) -- 0:00:00
991500 -- (-977.714) (-976.988) (-976.478) [-975.863] * (-975.181) (-974.635) [-976.200] (-974.750) -- 0:00:00
992000 -- (-974.495) (-976.844) (-975.800) [-980.585] * [-975.735] (-974.393) (-977.859) (-976.025) -- 0:00:00
992500 -- [-974.491] (-979.784) (-976.889) (-976.840) * (-977.384) [-976.123] (-979.980) (-976.943) -- 0:00:00
993000 -- (-976.182) [-976.994] (-978.236) (-975.301) * (-974.786) (-976.749) [-974.877] (-977.174) -- 0:00:00
993500 -- (-977.642) (-979.084) [-979.579] (-975.532) * (-974.241) (-975.579) [-975.412] (-978.138) -- 0:00:00
994000 -- (-974.734) (-977.133) [-976.765] (-974.862) * (-974.546) (-975.252) [-975.669] (-977.957) -- 0:00:00
994500 -- (-977.060) (-977.351) [-975.390] (-979.067) * [-975.290] (-979.142) (-980.619) (-978.160) -- 0:00:00
995000 -- (-979.708) (-977.525) [-978.174] (-975.711) * (-978.091) (-975.592) [-981.574] (-980.068) -- 0:00:00
Average standard deviation of split frequencies: 0.006877
995500 -- (-974.860) (-978.695) [-978.243] (-975.270) * (-975.865) (-977.231) (-977.380) [-978.886] -- 0:00:00
996000 -- (-977.111) (-981.151) [-977.519] (-974.831) * (-975.445) [-977.879] (-974.359) (-974.625) -- 0:00:00
996500 -- (-975.264) (-974.991) (-976.659) [-975.582] * (-974.692) [-975.229] (-976.861) (-974.701) -- 0:00:00
997000 -- (-975.686) (-974.981) [-976.433] (-976.269) * (-975.188) [-981.375] (-981.569) (-975.895) -- 0:00:00
997500 -- (-979.044) (-974.444) (-975.291) [-977.113] * (-974.661) [-975.647] (-976.968) (-977.998) -- 0:00:00
998000 -- (-976.094) [-975.902] (-975.062) (-973.994) * (-974.306) [-976.889] (-976.631) (-974.442) -- 0:00:00
998500 -- (-975.008) (-976.409) (-973.979) [-976.820] * (-976.171) (-979.078) [-975.114] (-976.059) -- 0:00:00
999000 -- (-974.712) [-976.256] (-976.001) (-977.935) * (-976.230) [-979.765] (-975.200) (-974.473) -- 0:00:00
999500 -- (-977.104) [-977.116] (-978.250) (-975.530) * (-975.343) (-978.490) [-976.125] (-978.483) -- 0:00:00
1000000 -- [-974.444] (-978.266) (-976.865) (-975.567) * (-975.279) [-978.337] (-976.297) (-975.992) -- 0:00:00
Average standard deviation of split frequencies: 0.006389
Analysis completed in 1 mins 3 seconds
Analysis used 61.72 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -973.73
Likelihood of best state for "cold" chain of run 2 was -973.73
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.3 % ( 35 %) Dirichlet(Pi{all})
29.4 % ( 31 %) Slider(Pi{all})
79.0 % ( 53 %) Multiplier(Alpha{1,2})
78.0 % ( 46 %) Multiplier(Alpha{3})
20.4 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.2 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 67 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.9 % ( 28 %) Dirichlet(Pi{all})
29.4 % ( 20 %) Slider(Pi{all})
79.0 % ( 59 %) Multiplier(Alpha{1,2})
77.4 % ( 47 %) Multiplier(Alpha{3})
20.7 % ( 32 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166791 0.82 0.67
3 | 166622 166843 0.84
4 | 166209 166922 166613
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166648 0.82 0.67
3 | 166324 167017 0.84
4 | 166964 166513 166534
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -975.53
| 1 2 |
| 1 1 1 2 |
| * 2 2 |
| 2 21 21 1 1 1 1 2 2 2 1 1 2 1 |
|21 2 *2 2 1 21 1 1 1 2 1122 1 * |
| 21 2 22 11 2 2 2 111 1 * * 2 2 1 |
| 1 2 12 2 *211 12 1 2 11 |
| 1 2 12 22 1 2 21 2 *1|
| 2 2 1 2 2 2 2|
|1 1 2 2 2 1 |
| 1 1 1 1 2 1 1 |
| 2 |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -977.42
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -975.43 -979.31
2 -975.48 -979.03
--------------------------------------
TOTAL -975.46 -979.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896100 0.091966 0.378443 1.495609 0.862402 1311.24 1375.78 1.000
r(A<->C){all} 0.169628 0.020811 0.000102 0.459708 0.134936 88.14 168.37 1.000
r(A<->G){all} 0.168587 0.019693 0.000033 0.445014 0.133978 303.28 330.89 1.000
r(A<->T){all} 0.167250 0.018532 0.000022 0.440501 0.132336 173.70 202.96 1.000
r(C<->G){all} 0.152619 0.016326 0.000191 0.406673 0.120580 183.70 283.58 1.000
r(C<->T){all} 0.171185 0.023075 0.000111 0.472217 0.126519 153.36 176.61 1.000
r(G<->T){all} 0.170730 0.020194 0.000078 0.451599 0.134247 214.25 262.20 1.000
pi(A){all} 0.152386 0.000177 0.127938 0.179020 0.152255 1237.35 1271.65 1.000
pi(C){all} 0.288959 0.000264 0.259240 0.322369 0.288615 1275.00 1371.76 1.000
pi(G){all} 0.334150 0.000305 0.299972 0.369283 0.333776 1072.46 1286.73 1.000
pi(T){all} 0.224506 0.000247 0.192267 0.252944 0.224455 946.42 1058.33 1.000
alpha{1,2} 0.429031 0.246419 0.000208 1.386995 0.258346 1067.90 1208.24 1.000
alpha{3} 0.462271 0.245375 0.000284 1.470481 0.296265 1164.94 1236.36 1.000
pinvar{all} 0.997767 0.000007 0.992777 0.999995 0.998560 1016.24 1097.42 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .**...
9 -- ...**.
10 -- ..****
11 -- .***.*
12 -- .**.**
13 -- ...*.*
14 -- .*.***
15 -- .****.
16 -- .*.*..
17 -- .*...*
18 -- ..*.*.
19 -- ..*..*
20 -- ..**..
21 -- .*..*.
22 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 453 0.150899 0.006124 0.146569 0.155230 2
8 446 0.148568 0.002827 0.146569 0.150566 2
9 439 0.146236 0.009893 0.139241 0.153231 2
10 437 0.145570 0.007066 0.140573 0.150566 2
11 435 0.144903 0.002355 0.143238 0.146569 2
12 429 0.142905 0.008009 0.137242 0.148568 2
13 429 0.142905 0.008951 0.136576 0.149234 2
14 425 0.141572 0.008009 0.135909 0.147235 2
15 424 0.141239 0.005653 0.137242 0.145237 2
16 422 0.140573 0.003769 0.137908 0.143238 2
17 422 0.140573 0.006595 0.135909 0.145237 2
18 421 0.140240 0.009893 0.133245 0.147235 2
19 418 0.139241 0.005653 0.135243 0.143238 2
20 414 0.137908 0.007537 0.132578 0.143238 2
21 408 0.135909 0.000942 0.135243 0.136576 2
22 291 0.096935 0.008951 0.090606 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096986 0.009547 0.000037 0.293630 0.067005 1.000 2
length{all}[2] 0.098705 0.009721 0.000002 0.291237 0.070552 1.000 2
length{all}[3] 0.103084 0.010493 0.000076 0.310478 0.072246 1.000 2
length{all}[4] 0.098573 0.009663 0.000021 0.302128 0.068220 1.000 2
length{all}[5] 0.103034 0.011006 0.000151 0.305076 0.071596 1.000 2
length{all}[6] 0.096482 0.009890 0.000039 0.281693 0.067944 1.000 2
length{all}[7] 0.097613 0.010087 0.000096 0.279305 0.070205 1.002 2
length{all}[8] 0.103980 0.010927 0.000015 0.308185 0.075818 0.999 2
length{all}[9] 0.105186 0.011192 0.000342 0.310611 0.073222 1.001 2
length{all}[10] 0.095143 0.007990 0.000589 0.269068 0.066932 1.000 2
length{all}[11] 0.095375 0.008623 0.001021 0.300861 0.065763 0.998 2
length{all}[12] 0.097007 0.007609 0.000135 0.283327 0.071085 0.998 2
length{all}[13] 0.094535 0.008689 0.000006 0.281435 0.065694 0.998 2
length{all}[14] 0.094941 0.008373 0.000460 0.264371 0.063701 0.999 2
length{all}[15] 0.097114 0.009388 0.000090 0.304265 0.069498 1.000 2
length{all}[16] 0.103289 0.011131 0.000312 0.327541 0.070890 0.998 2
length{all}[17] 0.103695 0.009398 0.000109 0.289080 0.069834 0.999 2
length{all}[18] 0.094497 0.009761 0.000013 0.285977 0.062895 1.002 2
length{all}[19] 0.093882 0.009373 0.000001 0.291920 0.061120 1.000 2
length{all}[20] 0.097263 0.009379 0.000030 0.289193 0.063978 0.998 2
length{all}[21] 0.101181 0.011036 0.000088 0.318759 0.065350 1.008 2
length{all}[22] 0.110033 0.012568 0.000075 0.327276 0.074315 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006389
Maximum standard deviation of split frequencies = 0.009893
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 723
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 241 / 241 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 241 / 241 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.014739 0.015586 0.099770 0.036784 0.056863 0.070095 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1004.049880
Iterating by ming2
Initial: fx= 1004.049880
x= 0.01474 0.01559 0.09977 0.03678 0.05686 0.07009 0.30000 1.30000
1 h-m-p 0.0000 0.0001 579.7961 ++ 983.230938 m 0.0001 13 | 1/8
2 h-m-p 0.0011 0.0108 30.1809 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 530.0719 ++ 982.232128 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0132 24.9271 ---------.. | 2/8
5 h-m-p 0.0000 0.0001 473.2671 ++ 962.179042 m 0.0001 73 | 3/8
6 h-m-p 0.0018 0.0169 19.8683 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 410.7604 ++ 947.817141 m 0.0001 105 | 4/8
8 h-m-p 0.0024 0.0327 11.9109 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 336.0725 ++ 941.469262 m 0.0001 137 | 5/8
10 h-m-p 0.0019 0.0705 6.8535 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 237.5620 ++ 934.303111 m 0.0001 169 | 6/8
12 h-m-p 0.1531 8.0000 0.0000 +++ 934.303111 m 8.0000 181 | 6/8
13 h-m-p 0.5692 8.0000 0.0001 ++ 934.303111 m 8.0000 194 | 6/8
14 h-m-p 0.0046 2.3086 0.2487 ------Y 934.303111 0 0.0000 213 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 ----C 934.303111 0 0.0000 230 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 ---C 934.303111 0 0.0001 246
Out..
lnL = -934.303111
247 lfun, 247 eigenQcodon, 1482 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099311 0.058492 0.020016 0.021066 0.012827 0.048178 0.300416 0.865004 0.143200
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.277585
np = 9
lnL0 = -994.407991
Iterating by ming2
Initial: fx= 994.407991
x= 0.09931 0.05849 0.02002 0.02107 0.01283 0.04818 0.30042 0.86500 0.14320
1 h-m-p 0.0000 0.0001 552.7524 ++ 977.101995 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 314.5610 ++ 968.814816 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 459.7472 ++ 967.997370 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 1285.7136 ++ 949.460830 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 16088.7462 ++ 946.102745 m 0.0000 62 | 5/9
6 h-m-p 0.0003 0.0018 35.2356 ++ 944.493751 m 0.0018 74 | 6/9
7 h-m-p 0.0177 0.4607 2.4472 -------------.. | 6/9
8 h-m-p 0.0000 0.0002 230.2393 +++ 934.303120 m 0.0002 110 | 7/9
9 h-m-p 0.8420 8.0000 0.0000 ++ 934.303120 m 8.0000 122 | 7/9
10 h-m-p 0.0160 8.0000 0.0306 +++++ 934.303114 m 8.0000 139 | 7/9
11 h-m-p 0.4028 2.0138 0.1913 ++ 934.303111 m 2.0138 153 | 8/9
12 h-m-p 1.6000 8.0000 0.0390 ++ 934.303111 m 8.0000 167 | 8/9
13 h-m-p 0.1576 0.7881 0.7021 ---------C 934.303111 0 0.0000 189 | 8/9
14 h-m-p 0.0004 0.1926 2.3184 +++++ 934.303110 m 0.1926 205 | 9/9
15 h-m-p 0.0160 8.0000 0.0000 N 934.303110 0 0.0160 217 | 9/9
16 h-m-p 0.0160 8.0000 0.0000 N 934.303110 0 0.0160 229
Out..
lnL = -934.303110
230 lfun, 690 eigenQcodon, 2760 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063678 0.098617 0.091430 0.026389 0.099847 0.058897 0.000100 1.719579 0.294245 0.331517 1.479960
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.170100
np = 11
lnL0 = -1034.000439
Iterating by ming2
Initial: fx= 1034.000439
x= 0.06368 0.09862 0.09143 0.02639 0.09985 0.05890 0.00011 1.71958 0.29424 0.33152 1.47996
1 h-m-p 0.0000 0.0000 532.3145 ++ 1033.318919 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 380.3975 +++ 997.917768 m 0.0003 31 | 2/11
3 h-m-p 0.0001 0.0003 223.4724 ++ 966.829882 m 0.0003 45 | 3/11
4 h-m-p 0.0006 0.0030 62.5467 ++ 942.889710 m 0.0030 59 | 4/11
5 h-m-p 0.0000 0.0000 685.2517 ++ 941.962092 m 0.0000 73 | 5/11
6 h-m-p 0.0004 0.0018 15.4898 ----------.. | 5/11
7 h-m-p 0.0000 0.0000 404.0289 ++ 935.758809 m 0.0000 109 | 6/11
8 h-m-p 0.0160 8.0000 2.5237 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 336.1868 ++ 934.417569 m 0.0000 148 | 7/11
10 h-m-p 0.0160 8.0000 0.7283 -------------.. | 7/11
11 h-m-p 0.0000 0.0000 238.8036 ++ 934.303111 m 0.0000 191 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 Y 934.303111 0 0.0040 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 C 934.303111 0 0.0160 222
Out..
lnL = -934.303111
223 lfun, 892 eigenQcodon, 4014 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -934.319055 S = -934.300977 -0.006930
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:02
did 20 / 56 patterns 0:02
did 30 / 56 patterns 0:02
did 40 / 56 patterns 0:02
did 50 / 56 patterns 0:02
did 56 / 56 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099609 0.095672 0.069152 0.105207 0.066656 0.105840 0.000100 1.131558 1.795128
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.946904
np = 9
lnL0 = -1058.443782
Iterating by ming2
Initial: fx= 1058.443782
x= 0.09961 0.09567 0.06915 0.10521 0.06666 0.10584 0.00011 1.13156 1.79513
1 h-m-p 0.0000 0.0000 538.0075 ++ 1057.993549 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0208 54.2682 +++++ 1028.797974 m 0.0208 29 | 2/9
3 h-m-p 0.0001 0.0004 371.8267 ++ 981.825594 m 0.0004 41 | 3/9
4 h-m-p 0.0002 0.0010 13.0799 ++ 976.808917 m 0.0010 53 | 4/9
5 h-m-p 0.0000 0.0002 79.4697 ++ 974.324999 m 0.0002 65 | 5/9
6 h-m-p 0.0001 0.0003 61.8472 ++ 967.151804 m 0.0003 77 | 6/9
7 h-m-p 0.0004 0.0022 43.4032 ++ 962.853819 m 0.0022 89 | 7/9
8 h-m-p 0.0625 8.0000 0.9646 --------------.. | 7/9
9 h-m-p 0.0000 0.0006 210.8387 +++ 934.303110 m 0.0006 128 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ---Y 934.303110 0 0.0063 143 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 --Y 934.303110 0 0.0003 158
Out..
lnL = -934.303110
159 lfun, 1749 eigenQcodon, 9540 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.078478 0.030376 0.077471 0.045239 0.065830 0.046982 0.000100 0.900000 0.491354 1.535319 1.300736
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.645731
np = 11
lnL0 = -1011.971062
Iterating by ming2
Initial: fx= 1011.971062
x= 0.07848 0.03038 0.07747 0.04524 0.06583 0.04698 0.00011 0.90000 0.49135 1.53532 1.30074
1 h-m-p 0.0000 0.0000 524.1228 ++ 1011.300670 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 225.3197 ++++ 971.915694 m 0.0009 32 | 2/11
3 h-m-p 0.0000 0.0000 1895.9922 ++ 954.579155 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0004 44.6970 ++ 954.098437 m 0.0004 60 | 4/11
5 h-m-p 0.0000 0.0002 133.8304 ++ 944.740262 m 0.0002 74 | 5/11
6 h-m-p 0.0000 0.0004 1160.2096 +++ 936.619597 m 0.0004 89 | 6/11
7 h-m-p 0.0000 0.0000 69905.7316 ++ 936.431222 m 0.0000 103 | 7/11
8 h-m-p 0.0007 0.0377 19.0492 -----------.. | 7/11
9 h-m-p 0.0000 0.0000 236.4262 ++ 934.303111 m 0.0000 140 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 934.303111 m 8.0000 154 | 8/11
11 h-m-p 0.4315 8.0000 0.0000 -Y 934.303111 0 0.0270 172 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 934.303111 m 8.0000 192 | 8/11
13 h-m-p 0.0156 7.8183 0.0908 +++++ 934.303111 m 7.8183 212 | 9/11
14 h-m-p 0.2651 1.6780 0.6689 ---------Y 934.303111 0 0.0000 238 | 9/11
15 h-m-p 0.0160 8.0000 0.0007 -------C 934.303111 0 0.0000 261 | 9/11
16 h-m-p 0.0160 8.0000 0.0000 -----Y 934.303111 0 0.0000 282
Out..
lnL = -934.303111
283 lfun, 3396 eigenQcodon, 18678 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -934.329854 S = -934.301684 -0.012415
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:10
did 20 / 56 patterns 0:10
did 30 / 56 patterns 0:10
did 40 / 56 patterns 0:10
did 50 / 56 patterns 0:10
did 56 / 56 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=241
NC_011896_1_WP_010907672_1_333_MLBR_RS01620 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
NC_002677_1_NP_301348_1_220_ispD MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV
**************************************************
NC_011896_1_WP_010907672_1_333_MLBR_RS01620 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
NC_002677_1_NP_301348_1_220_ispD VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800 VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA
**************************************************
NC_011896_1_WP_010907672_1_333_MLBR_RS01620 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
NC_002677_1_NP_301348_1_220_ispD TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800 TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS
**************************************************
NC_011896_1_WP_010907672_1_333_MLBR_RS01620 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
NC_002677_1_NP_301348_1_220_ispD DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800 DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF
**************************************************
NC_011896_1_WP_010907672_1_333_MLBR_RS01620 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
NC_002677_1_NP_301348_1_220_ispD TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800 TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
*****************************************
>NC_011896_1_WP_010907672_1_333_MLBR_RS01620 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC TGGCGAAGAAGATTCTGCGCCGG >NC_002677_1_NP_301348_1_220_ispD ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC TGGCGAAGAAGATTCTGCGCCGG >NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC TGGCGAAGAAGATTCTGCGCCGG >NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC TGGCGAAGAAGATTCTGCGCCGG >NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC TGGCGAAGAAGATTCTGCGCCGG >NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800 ATGGCTGTGGCAACGGGCACTGTAGTTGCAGTGGTCCCGGCCGCCGGGGC GGGGAAGCGGCTAGCGGCCGGCATTCCGAAGGCATTCTGTGAACTTGACG GGCGTACGCTTGTCGAACGTGCTGTCGTTGGCTTGCTGGAATCTGGCGTT GTTGACCATGTTGTGGTGGCGGTGCCTGCTGATCGCATTGCCCAGACCCA GTGGGTGCTATCCCAACGGCTAGCCAATTCGGCGGGTCAACACGCCACAG TTGTGGCCGGCGGGGCCGACCGCACCAAATCGGTGTGTCAGGCTCTTGCG ACCCTTCCCGCCCCGTCAAGGGTGGGCGCACCCGAGTTTATATTGGTGCA TGATGCCGCGCGGGCGCTGACACCAGCACGGTTAATCGTGCGGGTGGTTG ATGCTTTGCGTGCTGGTCATACCGCGGTCGTTCCAGCGCTGCCACTGTCT GACACCATTAAAGCCGTGGACGCCAACGGAATGGTTCTTGGCACTCCGGC GCGGGTCGGCTTGCGGGCGGTGCAGACCCCGCAGGGGTTTGCTACCGAGC TGCTATGGTGCGCTTATCAGCGTGGCCCCCATCTTGATGCCGTCGATTTC ACCGACGATGCTTCCCTTGTCGAACATCTCGGTGGCCAGGTTCAGGTGGT CGCCGGCGATCCACTGGCGTTCAAGATCACCACTCAGTTGGATCTGCTGC TGGCGAAGAAGATTCTGCGCCGG
>NC_011896_1_WP_010907672_1_333_MLBR_RS01620 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR >NC_002677_1_NP_301348_1_220_ispD MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR >NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR >NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR >NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR >NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800 MAVATGTVVAVVPAAGAGKRLAAGIPKAFCELDGRTLVERAVVGLLESGV VDHVVVAVPADRIAQTQWVLSQRLANSAGQHATVVAGGADRTKSVCQALA TLPAPSRVGAPEFILVHDAARALTPARLIVRVVDALRAGHTAVVPALPLS DTIKAVDANGMVLGTPARVGLRAVQTPQGFATELLWCAYQRGPHLDAVDF TDDASLVEHLGGQVQVVAGDPLAFKITTQLDLLLAKKILRR
#NEXUS
[ID: 0305485028]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907672_1_333_MLBR_RS01620
NC_002677_1_NP_301348_1_220_ispD
NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795
NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835
NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720
NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907672_1_333_MLBR_RS01620,
2 NC_002677_1_NP_301348_1_220_ispD,
3 NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795,
4 NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835,
5 NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720,
6 NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06700477,2:0.07055187,3:0.07224632,4:0.06821954,5:0.07159569,6:0.06794355);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06700477,2:0.07055187,3:0.07224632,4:0.06821954,5:0.07159569,6:0.06794355);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -975.43 -979.31
2 -975.48 -979.03
--------------------------------------
TOTAL -975.46 -979.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/ispD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896100 0.091966 0.378443 1.495609 0.862402 1311.24 1375.78 1.000
r(A<->C){all} 0.169628 0.020811 0.000102 0.459708 0.134936 88.14 168.37 1.000
r(A<->G){all} 0.168587 0.019693 0.000033 0.445014 0.133978 303.28 330.89 1.000
r(A<->T){all} 0.167250 0.018532 0.000022 0.440501 0.132336 173.70 202.96 1.000
r(C<->G){all} 0.152619 0.016326 0.000191 0.406673 0.120580 183.70 283.58 1.000
r(C<->T){all} 0.171185 0.023075 0.000111 0.472217 0.126519 153.36 176.61 1.000
r(G<->T){all} 0.170730 0.020194 0.000078 0.451599 0.134247 214.25 262.20 1.000
pi(A){all} 0.152386 0.000177 0.127938 0.179020 0.152255 1237.35 1271.65 1.000
pi(C){all} 0.288959 0.000264 0.259240 0.322369 0.288615 1275.00 1371.76 1.000
pi(G){all} 0.334150 0.000305 0.299972 0.369283 0.333776 1072.46 1286.73 1.000
pi(T){all} 0.224506 0.000247 0.192267 0.252944 0.224455 946.42 1058.33 1.000
alpha{1,2} 0.429031 0.246419 0.000208 1.386995 0.258346 1067.90 1208.24 1.000
alpha{3} 0.462271 0.245375 0.000284 1.470481 0.296265 1164.94 1236.36 1.000
pinvar{all} 0.997767 0.000007 0.992777 0.999995 0.998560 1016.24 1097.42 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/ispD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 241
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 2 2 2 2 2 2
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 7 7 7 7 7 7 | Pro CCT 1 1 1 1 1 1 | His CAT 5 5 5 5 5 5 | Arg CGT 4 4 4 4 4 4
CTC 1 1 1 1 1 1 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 4 4 4 4 4 4 | CCA 4 4 4 4 4 4 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 10 10 10 10 10 10 | CCG 5 5 5 5 5 5 | CAG 9 9 9 9 9 9 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 9 9 9 9 9 9 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 10 10 10 10 10 10 | Ala GCT 9 9 9 9 9 9 | Asp GAT 8 8 8 8 8 8 | Gly GGT 3 3 3 3 3 3
GTC 8 8 8 8 8 8 | GCC 14 14 14 14 14 14 | GAC 6 6 6 6 6 6 | GGC 11 11 11 11 11 11
GTA 1 1 1 1 1 1 | GCA 5 5 5 5 5 5 | Glu GAA 4 4 4 4 4 4 | GGA 1 1 1 1 1 1
GTG 15 15 15 15 15 15 | GCG 13 13 13 13 13 13 | GAG 2 2 2 2 2 2 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907672_1_333_MLBR_RS01620
position 1: T:0.09959 C:0.27801 A:0.14523 G:0.47718
position 2: T:0.31535 C:0.31950 A:0.19502 G:0.17012
position 3: T:0.25726 C:0.26971 A:0.11618 G:0.35685
Average T:0.22407 C:0.28907 A:0.15214 G:0.33472
#2: NC_002677_1_NP_301348_1_220_ispD
position 1: T:0.09959 C:0.27801 A:0.14523 G:0.47718
position 2: T:0.31535 C:0.31950 A:0.19502 G:0.17012
position 3: T:0.25726 C:0.26971 A:0.11618 G:0.35685
Average T:0.22407 C:0.28907 A:0.15214 G:0.33472
#3: NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795
position 1: T:0.09959 C:0.27801 A:0.14523 G:0.47718
position 2: T:0.31535 C:0.31950 A:0.19502 G:0.17012
position 3: T:0.25726 C:0.26971 A:0.11618 G:0.35685
Average T:0.22407 C:0.28907 A:0.15214 G:0.33472
#4: NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835
position 1: T:0.09959 C:0.27801 A:0.14523 G:0.47718
position 2: T:0.31535 C:0.31950 A:0.19502 G:0.17012
position 3: T:0.25726 C:0.26971 A:0.11618 G:0.35685
Average T:0.22407 C:0.28907 A:0.15214 G:0.33472
#5: NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720
position 1: T:0.09959 C:0.27801 A:0.14523 G:0.47718
position 2: T:0.31535 C:0.31950 A:0.19502 G:0.17012
position 3: T:0.25726 C:0.26971 A:0.11618 G:0.35685
Average T:0.22407 C:0.28907 A:0.15214 G:0.33472
#6: NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800
position 1: T:0.09959 C:0.27801 A:0.14523 G:0.47718
position 2: T:0.31535 C:0.31950 A:0.19502 G:0.17012
position 3: T:0.25726 C:0.26971 A:0.11618 G:0.35685
Average T:0.22407 C:0.28907 A:0.15214 G:0.33472
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 12
TTC 18 | TCC 12 | TAC 0 | TGC 6
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 42 | Pro P CCT 6 | His H CAT 30 | Arg R CGT 24
CTC 6 | CCC 18 | CAC 6 | CGC 18
CTA 24 | CCA 24 | Gln Q CAA 12 | CGA 0
CTG 60 | CCG 30 | CAG 54 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 54 | AAC 6 | AGC 0
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 60 | Ala A GCT 54 | Asp D GAT 48 | Gly G GGT 18
GTC 48 | GCC 84 | GAC 36 | GGC 66
GTA 6 | GCA 30 | Glu E GAA 24 | GGA 6
GTG 90 | GCG 78 | GAG 12 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09959 C:0.27801 A:0.14523 G:0.47718
position 2: T:0.31535 C:0.31950 A:0.19502 G:0.17012
position 3: T:0.25726 C:0.26971 A:0.11618 G:0.35685
Average T:0.22407 C:0.28907 A:0.15214 G:0.33472
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -934.303111 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300416 1.300736
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907672_1_333_MLBR_RS01620: 0.000004, NC_002677_1_NP_301348_1_220_ispD: 0.000004, NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795: 0.000004, NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835: 0.000004, NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720: 0.000004, NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30042
omega (dN/dS) = 1.30074
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 499.6 223.4 1.3007 0.0000 0.0000 0.0 0.0
7..2 0.000 499.6 223.4 1.3007 0.0000 0.0000 0.0 0.0
7..3 0.000 499.6 223.4 1.3007 0.0000 0.0000 0.0 0.0
7..4 0.000 499.6 223.4 1.3007 0.0000 0.0000 0.0 0.0
7..5 0.000 499.6 223.4 1.3007 0.0000 0.0000 0.0 0.0
7..6 0.000 499.6 223.4 1.3007 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -934.303110 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907672_1_333_MLBR_RS01620: 0.000004, NC_002677_1_NP_301348_1_220_ispD: 0.000004, NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795: 0.000004, NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835: 0.000004, NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720: 0.000004, NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -934.303111 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.718778 0.158931 0.000001 1.464006
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907672_1_333_MLBR_RS01620: 0.000004, NC_002677_1_NP_301348_1_220_ispD: 0.000004, NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795: 0.000004, NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835: 0.000004, NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720: 0.000004, NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.71878 0.15893 0.12229
w: 0.00000 1.00000 1.46401
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.5 219.5 0.3380 0.0000 0.0000 0.0 0.0
7..2 0.000 503.5 219.5 0.3380 0.0000 0.0000 0.0 0.0
7..3 0.000 503.5 219.5 0.3380 0.0000 0.0000 0.0 0.0
7..4 0.000 503.5 219.5 0.3380 0.0000 0.0000 0.0 0.0
7..5 0.000 503.5 219.5 0.3380 0.0000 0.0000 0.0 0.0
7..6 0.000 503.5 219.5 0.3380 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907672_1_333_MLBR_RS01620)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907672_1_333_MLBR_RS01620)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -934.303110 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.782132
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907672_1_333_MLBR_RS01620: 0.000004, NC_002677_1_NP_301348_1_220_ispD: 0.000004, NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795: 0.000004, NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835: 0.000004, NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720: 0.000004, NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.78213
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 503.5 219.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -934.303111 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.789110 0.005000 1.753257 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907672_1_333_MLBR_RS01620: 0.000004, NC_002677_1_NP_301348_1_220_ispD: 0.000004, NZ_LVXE01000066_1_WP_010907672_1_2462_A3216_RS12795: 0.000004, NZ_LYPH01000071_1_WP_010907672_1_2457_A8144_RS11835: 0.000004, NZ_CP029543_1_WP_010907672_1_334_DIJ64_RS01720: 0.000004, NZ_AP014567_1_WP_010907672_1_350_JK2ML_RS01800: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.78911 p = 0.00500 q = 1.75326
(p1 = 0.21089) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07891 0.07891 0.07891 0.07891 0.07891 0.07891 0.07891 0.07891 0.07891 0.07891 0.21089
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 503.5 219.5 0.2109 0.0000 0.0000 0.0 0.0
7..2 0.000 503.5 219.5 0.2109 0.0000 0.0000 0.0 0.0
7..3 0.000 503.5 219.5 0.2109 0.0000 0.0000 0.0 0.0
7..4 0.000 503.5 219.5 0.2109 0.0000 0.0000 0.0 0.0
7..5 0.000 503.5 219.5 0.2109 0.0000 0.0000 0.0 0.0
7..6 0.000 503.5 219.5 0.2109 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907672_1_333_MLBR_RS01620)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:11
Model 1: NearlyNeutral -934.30311 Model 2: PositiveSelection -934.303111 Model 0: one-ratio -934.303111 Model 7: beta -934.30311 Model 8: beta&w>1 -934.303111 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 1.9999999949504854E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
