--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:00:48 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lipB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -960.80 -964.51
2 -960.73 -965.94
--------------------------------------
TOTAL -960.76 -965.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865234 0.086321 0.328548 1.454788 0.833379 1435.17 1449.10 1.000
r(A<->C){all} 0.169455 0.020431 0.000016 0.451708 0.130662 364.30 390.96 1.000
r(A<->G){all} 0.168210 0.020840 0.000033 0.467182 0.127915 151.15 166.38 1.000
r(A<->T){all} 0.129645 0.014397 0.000024 0.378183 0.093504 212.10 272.31 1.000
r(C<->G){all} 0.172446 0.020243 0.000008 0.456181 0.136488 243.53 279.37 1.005
r(C<->T){all} 0.138734 0.016294 0.000026 0.403007 0.100266 155.51 226.84 1.010
r(G<->T){all} 0.221510 0.023819 0.000028 0.525740 0.194500 124.02 239.71 1.000
pi(A){all} 0.186343 0.000202 0.157136 0.212604 0.186300 1242.99 1276.20 1.000
pi(C){all} 0.340647 0.000305 0.306976 0.375705 0.340429 1056.40 1192.00 1.000
pi(G){all} 0.300136 0.000294 0.268114 0.333155 0.299848 1289.35 1302.00 1.000
pi(T){all} 0.172874 0.000203 0.145854 0.200270 0.172177 1254.13 1303.04 1.000
alpha{1,2} 0.221034 0.063450 0.004801 0.578018 0.157725 1191.84 1346.42 1.001
alpha{3} 0.397749 0.215608 0.000114 1.389900 0.230739 1178.38 1219.26 1.000
pinvar{all} 0.994574 0.000019 0.986051 0.999887 0.995732 1272.76 1277.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -925.131064
Model 2: PositiveSelection -924.887114
Model 0: one-ratio -924.887091
Model 7: beta -925.131064
Model 8: beta&w>1 -924.887105
Model 0 vs 1 0.48794599999996535
Model 2 vs 1 0.4879000000000815
Model 8 vs 7 0.48791800000003605
>C1
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C2
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C3
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C4
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C5
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C6
MDSIRSSPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=235
C1 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C2 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C3 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C4 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C5 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C6 MDSIRSSPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
****** *******************************************
C1 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C2 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C3 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C4 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C5 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C6 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
**************************************************
C1 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C2 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C3 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C4 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C5 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C6 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
**************************************************
C1 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C2 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C3 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C4 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C5 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C6 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
**************************************************
C1 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C2 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C3 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C4 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C5 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C6 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
***********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 235 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 235 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7050]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7050]--->[7050]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.490 Mb, Max= 30.785 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C2 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C3 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C4 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C5 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
C6 MDSIRSSPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
****** *******************************************
C1 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C2 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C3 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C4 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C5 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
C6 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
**************************************************
C1 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C2 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C3 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C4 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C5 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
C6 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
**************************************************
C1 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C2 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C3 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C4 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C5 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
C6 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
**************************************************
C1 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C2 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C3 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C4 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C5 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
C6 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
***********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.57 C1 C6 99.57
TOP 5 0 99.57 C6 C1 99.57
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.57 C2 C6 99.57
TOP 5 1 99.57 C6 C2 99.57
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.57 C3 C6 99.57
TOP 5 2 99.57 C6 C3 99.57
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.57 C4 C6 99.57
TOP 5 3 99.57 C6 C4 99.57
BOT 4 5 99.57 C5 C6 99.57
TOP 5 4 99.57 C6 C5 99.57
AVG 0 C1 * 99.91
AVG 1 C2 * 99.91
AVG 2 C3 * 99.91
AVG 3 C4 * 99.91
AVG 4 C5 * 99.91
AVG 5 C6 * 99.57
TOT TOT * 99.86
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
C2 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
C3 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
C4 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
C5 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
C6 ATGGATTCCATCCGGTCGAGCCCGACCGCGATCGATGTCCGCCAGCTAGG
******************* ******************************
C1 CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
C2 CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
C3 CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
C4 CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
C5 CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
C6 CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
**************************************************
C1 CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
C2 CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
C3 CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
C4 CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
C5 CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
C6 CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
**************************************************
C1 GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
C2 GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
C3 GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
C4 GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
C5 GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
C6 GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
**************************************************
C1 GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
C2 GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
C3 GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
C4 GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
C5 GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
C6 GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
**************************************************
C1 GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
C2 GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
C3 GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
C4 GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
C5 GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
C6 GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
**************************************************
C1 CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
C2 CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
C3 CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
C4 CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
C5 CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
C6 CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
**************************************************
C1 GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
C2 GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
C3 GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
C4 GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
C5 GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
C6 GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
**************************************************
C1 GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
C2 GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
C3 GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
C4 GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
C5 GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
C6 GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
**************************************************
C1 ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
C2 ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
C3 ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
C4 ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
C5 ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
C6 ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
**************************************************
C1 TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
C2 TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
C3 TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
C4 TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
C5 TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
C6 TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
**************************************************
C1 GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
C2 GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
C3 GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
C4 GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
C5 GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
C6 GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
**************************************************
C1 GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
C2 GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
C3 GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
C4 GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
C5 GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
C6 GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
**************************************************
C1 CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
C2 CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
C3 CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
C4 CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
C5 CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
C6 CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
**************************************************
C1 CACTG
C2 CACTG
C3 CACTG
C4 CACTG
C5 CACTG
C6 CACTG
*****
>C1
ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
CACTG
>C2
ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
CACTG
>C3
ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
CACTG
>C4
ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
CACTG
>C5
ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG
CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
CACTG
>C6
ATGGATTCCATCCGGTCGAGCCCGACCGCGATCGATGTCCGCCAGCTAGG
CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG
CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA
GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC
GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT
GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG
CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA
GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG
GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT
ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA
TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA
GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC
GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA
CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA
CACTG
>C1
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C2
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C3
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C4
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C5
MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
>C6
MDSIRSSPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 705 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791549
Setting output file names to "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 541588176
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0033211629
Seed = 583644941
Swapseed = 1579791549
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1581.226357 -- -24.965149
Chain 2 -- -1581.226574 -- -24.965149
Chain 3 -- -1581.226664 -- -24.965149
Chain 4 -- -1581.225114 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1581.225024 -- -24.965149
Chain 2 -- -1581.225114 -- -24.965149
Chain 3 -- -1581.226357 -- -24.965149
Chain 4 -- -1581.226574 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1581.226] (-1581.227) (-1581.227) (-1581.225) * [-1581.225] (-1581.225) (-1581.226) (-1581.227)
500 -- (-974.552) (-979.158) [-973.728] (-986.280) * [-972.883] (-986.467) (-972.814) (-965.876) -- 0:00:00
1000 -- (-966.739) (-967.680) [-962.769] (-995.076) * [-964.653] (-974.108) (-965.890) (-972.326) -- 0:00:00
1500 -- (-978.995) [-967.037] (-972.158) (-966.169) * (-971.925) (-962.860) [-963.080] (-965.232) -- 0:11:05
2000 -- (-968.174) [-963.763] (-965.015) (-968.054) * [-977.476] (-967.073) (-966.846) (-967.279) -- 0:08:19
2500 -- (-964.493) [-960.730] (-972.056) (-967.637) * (-966.554) (-966.966) (-971.961) [-963.491] -- 0:06:39
3000 -- (-971.091) [-958.889] (-974.557) (-967.842) * (-967.411) (-963.783) [-963.441] (-970.829) -- 0:05:32
3500 -- (-961.898) (-968.630) [-960.686] (-965.697) * [-963.142] (-970.397) (-967.834) (-970.833) -- 0:04:44
4000 -- [-964.785] (-964.375) (-960.870) (-971.242) * [-964.357] (-968.102) (-965.506) (-965.394) -- 0:04:09
4500 -- (-969.922) [-965.380] (-968.737) (-963.875) * (-971.826) (-966.444) (-969.667) [-965.780] -- 0:03:41
5000 -- (-964.055) (-969.990) [-968.700] (-965.676) * [-970.259] (-966.538) (-962.863) (-968.092) -- 0:03:19
Average standard deviation of split frequencies: 0.069139
5500 -- (-968.423) (-964.585) [-974.176] (-972.773) * (-972.648) (-963.349) (-970.829) [-960.085] -- 0:03:00
6000 -- (-965.725) (-964.237) [-971.788] (-969.496) * (-970.911) (-969.875) [-961.081] (-967.090) -- 0:02:45
6500 -- (-962.219) (-963.133) [-965.026] (-959.619) * (-979.131) (-972.312) (-960.912) [-965.293] -- 0:02:32
7000 -- (-967.744) [-962.266] (-966.570) (-967.786) * (-972.097) [-963.972] (-964.540) (-968.653) -- 0:02:21
7500 -- (-967.287) (-964.078) (-968.805) [-960.265] * [-967.126] (-967.015) (-968.577) (-967.134) -- 0:02:12
8000 -- (-967.443) [-960.976] (-969.526) (-965.580) * (-967.781) [-967.955] (-966.600) (-970.887) -- 0:02:04
8500 -- (-961.690) (-965.945) [-965.426] (-968.259) * (-965.228) [-964.029] (-962.728) (-970.702) -- 0:01:56
9000 -- (-962.145) (-968.755) (-966.807) [-963.345] * (-960.245) (-962.373) (-963.405) [-967.781] -- 0:01:50
9500 -- (-961.542) (-963.228) [-973.408] (-964.183) * (-960.558) (-965.500) [-959.632] (-963.968) -- 0:01:44
10000 -- (-960.490) [-962.700] (-965.748) (-970.847) * (-959.643) [-965.116] (-968.581) (-968.400) -- 0:01:39
Average standard deviation of split frequencies: 0.083969
10500 -- (-963.720) (-971.987) [-964.516] (-970.667) * [-963.386] (-970.462) (-969.708) (-961.958) -- 0:01:34
11000 -- (-960.861) (-972.551) [-970.758] (-968.720) * (-962.629) (-963.472) [-964.321] (-964.771) -- 0:01:29
11500 -- (-963.398) [-966.340] (-965.748) (-965.184) * (-965.173) (-961.199) (-974.154) [-962.876] -- 0:01:25
12000 -- (-964.154) (-965.455) [-959.225] (-962.835) * (-961.203) (-965.636) [-963.094] (-972.643) -- 0:01:22
12500 -- [-961.085] (-964.518) (-964.193) (-962.168) * [-961.282] (-970.819) (-971.483) (-964.928) -- 0:01:19
13000 -- (-959.380) [-961.664] (-962.975) (-961.411) * (-961.586) [-966.511] (-964.414) (-970.194) -- 0:01:15
13500 -- (-960.301) [-965.301] (-965.822) (-967.905) * (-962.097) [-958.612] (-968.961) (-970.871) -- 0:01:13
14000 -- (-959.063) (-978.322) [-964.570] (-965.570) * (-962.046) (-964.755) [-968.692] (-966.480) -- 0:01:10
14500 -- (-960.403) (-976.389) [-964.140] (-964.155) * (-962.137) [-962.099] (-967.358) (-966.493) -- 0:01:07
15000 -- [-960.432] (-970.564) (-962.963) (-964.152) * (-962.617) (-967.937) [-967.852] (-968.151) -- 0:02:11
Average standard deviation of split frequencies: 0.070383
15500 -- [-965.752] (-978.560) (-966.372) (-963.513) * (-961.912) (-966.656) (-978.743) [-960.173] -- 0:02:07
16000 -- (-963.672) (-970.363) [-965.786] (-961.525) * (-965.846) [-965.759] (-961.144) (-969.544) -- 0:02:03
16500 -- (-961.037) (-970.157) [-969.154] (-963.186) * (-963.383) (-962.350) (-962.544) [-962.715] -- 0:01:59
17000 -- (-962.077) (-970.619) (-967.701) [-962.902] * (-960.708) (-971.262) (-959.602) [-963.811] -- 0:01:55
17500 -- (-960.111) (-979.614) [-961.906] (-960.543) * (-964.860) (-971.569) [-963.755] (-962.540) -- 0:01:52
18000 -- (-960.391) (-966.949) [-965.440] (-966.706) * (-965.450) [-968.214] (-961.248) (-967.466) -- 0:01:49
18500 -- (-964.124) (-971.209) [-970.412] (-959.394) * (-962.702) (-974.756) (-965.148) [-967.740] -- 0:01:46
19000 -- (-960.519) (-970.994) (-964.067) [-960.840] * (-963.895) (-966.545) [-961.550] (-968.192) -- 0:01:43
19500 -- (-961.586) (-978.488) (-967.591) [-960.024] * (-965.706) (-968.874) (-973.270) [-974.549] -- 0:01:40
20000 -- (-960.520) (-964.974) [-965.562] (-960.388) * (-964.912) (-975.144) [-965.922] (-983.969) -- 0:01:38
Average standard deviation of split frequencies: 0.051956
20500 -- (-964.287) (-969.255) (-965.059) [-962.987] * (-961.438) (-966.159) (-960.833) [-974.890] -- 0:01:35
21000 -- [-960.127] (-966.839) (-971.563) (-962.111) * (-963.374) (-969.526) (-961.743) [-965.025] -- 0:01:33
21500 -- (-959.784) (-966.841) [-969.455] (-962.538) * (-963.155) [-963.315] (-959.686) (-970.197) -- 0:01:31
22000 -- [-960.176] (-971.142) (-970.717) (-963.316) * [-961.757] (-959.215) (-961.198) (-968.561) -- 0:01:28
22500 -- [-962.165] (-972.367) (-959.404) (-964.189) * (-961.255) (-961.048) (-960.555) [-964.784] -- 0:01:26
23000 -- (-960.319) (-979.754) [-971.203] (-963.961) * (-961.280) (-958.364) (-960.689) [-962.534] -- 0:01:24
23500 -- [-963.242] (-967.302) (-962.235) (-963.203) * (-961.687) (-959.542) [-962.454] (-970.234) -- 0:01:23
24000 -- (-966.924) (-972.090) [-960.993] (-962.129) * [-963.333] (-968.080) (-960.794) (-966.893) -- 0:01:21
24500 -- (-960.659) [-970.042] (-972.243) (-963.647) * (-960.420) (-960.353) [-958.293] (-964.859) -- 0:01:19
25000 -- (-962.370) (-967.331) (-963.341) [-962.494] * (-961.727) (-960.746) (-959.805) [-962.132] -- 0:01:18
Average standard deviation of split frequencies: 0.045804
25500 -- (-959.277) (-962.432) [-967.014] (-966.436) * (-958.980) (-962.465) (-961.923) [-961.215] -- 0:01:16
26000 -- (-962.335) [-961.023] (-968.949) (-964.573) * (-960.003) (-960.826) [-959.852] (-964.699) -- 0:01:14
26500 -- (-962.309) [-961.895] (-970.334) (-962.604) * (-958.869) [-960.430] (-959.185) (-966.585) -- 0:01:13
27000 -- (-962.451) (-971.973) (-971.854) [-962.136] * (-962.032) (-962.322) [-959.015] (-967.724) -- 0:01:12
27500 -- (-963.089) (-966.621) [-966.925] (-965.344) * (-960.107) (-958.949) (-959.971) [-961.622] -- 0:01:10
28000 -- (-960.968) [-964.260] (-962.921) (-965.113) * (-962.031) (-961.159) (-960.224) [-967.267] -- 0:01:09
28500 -- (-960.456) [-966.507] (-967.457) (-963.286) * [-964.041] (-962.375) (-961.326) (-963.533) -- 0:01:08
29000 -- (-960.817) (-966.569) [-965.530] (-959.926) * [-959.653] (-961.723) (-959.789) (-962.553) -- 0:01:06
29500 -- (-959.999) [-970.660] (-969.956) (-963.085) * (-959.892) (-962.537) (-964.956) [-966.720] -- 0:01:38
30000 -- (-961.754) (-975.578) (-966.798) [-960.903] * (-964.012) [-959.035] (-962.952) (-969.540) -- 0:01:37
Average standard deviation of split frequencies: 0.043041
30500 -- (-961.875) [-968.877] (-971.850) (-959.362) * [-961.399] (-963.073) (-961.386) (-961.726) -- 0:01:35
31000 -- (-964.383) (-968.501) (-972.843) [-962.266] * (-961.198) (-963.954) (-964.430) [-967.489] -- 0:01:33
31500 -- (-964.180) [-965.304] (-965.747) (-962.072) * (-959.815) (-964.333) (-963.694) [-966.430] -- 0:01:32
32000 -- (-962.583) (-967.428) [-965.102] (-959.550) * (-964.794) (-964.552) (-963.291) [-965.197] -- 0:01:30
32500 -- [-960.812] (-970.720) (-962.453) (-963.820) * (-959.659) (-963.506) [-961.610] (-966.547) -- 0:01:29
33000 -- (-959.496) (-965.875) (-966.155) [-962.493] * (-965.010) (-962.075) (-960.045) [-963.223] -- 0:01:27
33500 -- (-963.815) [-974.013] (-975.979) (-959.864) * (-966.601) [-960.643] (-959.772) (-967.542) -- 0:01:26
34000 -- (-963.584) [-970.211] (-974.790) (-959.560) * (-963.387) (-960.944) [-958.504] (-962.261) -- 0:01:25
34500 -- (-964.321) [-976.195] (-962.239) (-959.641) * (-963.926) (-961.169) [-960.979] (-972.916) -- 0:01:23
35000 -- (-964.564) (-966.220) [-963.067] (-962.286) * (-967.388) (-960.799) (-960.642) [-965.842] -- 0:01:22
Average standard deviation of split frequencies: 0.041903
35500 -- (-961.297) (-969.600) (-965.189) [-959.244] * (-963.900) (-960.002) (-964.847) [-964.152] -- 0:01:21
36000 -- (-961.018) (-969.127) [-964.270] (-964.339) * (-963.895) (-965.248) [-960.043] (-961.503) -- 0:01:20
36500 -- (-960.799) (-971.370) (-968.337) [-961.939] * (-966.771) (-959.605) [-960.685] (-967.152) -- 0:01:19
37000 -- [-961.977] (-966.217) (-975.482) (-963.920) * (-963.159) (-962.012) [-965.188] (-973.426) -- 0:01:18
37500 -- (-963.940) (-966.616) [-963.527] (-962.815) * [-965.126] (-960.232) (-961.795) (-964.917) -- 0:01:17
38000 -- (-965.155) (-973.280) (-971.887) [-959.322] * (-961.429) [-963.545] (-965.905) (-971.562) -- 0:01:15
38500 -- (-965.284) (-975.584) [-966.996] (-960.540) * (-959.388) (-963.253) (-958.640) [-964.045] -- 0:01:14
39000 -- (-967.401) (-970.446) [-961.021] (-961.240) * (-959.749) (-966.188) [-962.816] (-965.755) -- 0:01:13
39500 -- (-961.660) (-976.427) [-962.872] (-959.648) * [-960.953] (-966.814) (-965.067) (-965.310) -- 0:01:12
40000 -- (-961.143) (-968.838) (-963.802) [-961.324] * (-959.461) (-974.982) [-960.796] (-966.156) -- 0:01:12
Average standard deviation of split frequencies: 0.043317
40500 -- [-959.935] (-962.400) (-971.582) (-961.926) * (-958.883) (-964.491) (-962.329) [-968.298] -- 0:01:11
41000 -- (-964.090) [-963.635] (-970.130) (-960.974) * [-961.531] (-962.247) (-962.611) (-966.461) -- 0:01:10
41500 -- (-961.433) [-964.311] (-977.311) (-967.504) * [-966.859] (-962.235) (-959.910) (-966.008) -- 0:01:09
42000 -- (-965.315) [-970.062] (-964.475) (-964.143) * (-963.209) (-962.472) [-959.817] (-965.653) -- 0:01:08
42500 -- (-960.766) (-964.253) [-966.794] (-965.525) * (-959.456) [-960.572] (-959.333) (-967.697) -- 0:01:07
43000 -- (-959.956) [-964.948] (-965.281) (-966.155) * (-962.020) (-964.474) (-962.101) [-964.630] -- 0:01:06
43500 -- (-960.413) (-963.194) [-961.965] (-965.826) * [-961.214] (-966.343) (-962.843) (-977.780) -- 0:01:05
44000 -- [-959.156] (-971.562) (-968.898) (-965.355) * (-962.683) (-964.274) (-960.210) [-967.036] -- 0:01:26
44500 -- (-959.990) (-967.866) [-964.194] (-962.769) * (-963.253) (-960.928) [-961.840] (-968.521) -- 0:01:25
45000 -- [-961.443] (-965.330) (-967.802) (-963.561) * [-960.641] (-964.600) (-964.768) (-967.922) -- 0:01:24
Average standard deviation of split frequencies: 0.042456
45500 -- (-963.473) (-963.662) [-963.709] (-962.262) * (-961.819) (-963.412) [-960.101] (-971.564) -- 0:01:23
46000 -- (-964.542) [-963.328] (-970.458) (-960.349) * (-961.067) (-961.997) (-961.083) [-963.951] -- 0:01:22
46500 -- (-966.314) (-961.734) (-972.357) [-961.751] * (-960.927) (-963.319) (-960.006) [-973.242] -- 0:01:22
47000 -- (-966.362) [-963.856] (-967.791) (-962.258) * (-959.835) (-964.599) (-960.909) [-967.587] -- 0:01:21
47500 -- (-966.255) (-962.464) [-963.307] (-965.346) * (-963.528) [-962.120] (-960.813) (-967.648) -- 0:01:20
48000 -- (-961.107) [-966.564] (-966.971) (-965.232) * [-961.658] (-962.457) (-960.265) (-962.097) -- 0:01:19
48500 -- (-968.254) (-975.751) [-966.336] (-962.017) * (-962.593) [-963.544] (-959.082) (-965.641) -- 0:01:18
49000 -- (-962.858) (-973.304) (-974.836) [-963.025] * (-963.578) (-963.283) [-959.372] (-970.565) -- 0:01:17
49500 -- (-960.182) [-969.481] (-967.940) (-966.610) * [-962.934] (-963.735) (-958.023) (-965.966) -- 0:01:16
50000 -- (-961.004) (-980.090) (-965.324) [-961.706] * (-962.658) (-963.603) (-965.259) [-965.480] -- 0:01:16
Average standard deviation of split frequencies: 0.041623
50500 -- [-958.226] (-965.009) (-962.200) (-960.894) * (-960.612) (-965.654) (-963.928) [-970.613] -- 0:01:15
51000 -- (-960.354) (-965.600) [-970.061] (-960.017) * (-962.771) [-963.220] (-959.905) (-968.004) -- 0:01:14
51500 -- (-964.671) [-967.752] (-967.311) (-961.438) * (-961.362) (-962.273) (-961.516) [-963.680] -- 0:01:13
52000 -- (-966.356) (-963.138) (-961.746) [-965.837] * [-961.885] (-960.233) (-962.645) (-963.585) -- 0:01:12
52500 -- (-963.873) (-968.946) [-965.678] (-965.404) * (-959.740) [-959.691] (-961.143) (-966.351) -- 0:01:12
53000 -- [-962.902] (-971.684) (-965.413) (-961.985) * (-962.223) (-960.314) [-962.939] (-967.482) -- 0:01:11
53500 -- [-961.749] (-964.960) (-967.392) (-965.940) * (-960.347) (-961.856) [-961.301] (-962.258) -- 0:01:10
54000 -- (-961.416) (-966.341) [-968.601] (-963.924) * (-962.148) (-962.214) (-961.039) [-964.683] -- 0:01:10
54500 -- (-961.130) (-973.140) [-967.307] (-963.923) * (-959.520) [-960.522] (-961.816) (-964.390) -- 0:01:09
55000 -- [-959.696] (-961.724) (-966.965) (-963.595) * (-959.682) (-960.115) (-963.190) [-966.362] -- 0:01:08
Average standard deviation of split frequencies: 0.028798
55500 -- (-962.606) (-965.319) [-965.748] (-961.239) * (-960.301) [-961.048] (-962.055) (-974.708) -- 0:01:08
56000 -- (-962.288) (-965.692) [-969.661] (-963.119) * [-959.011] (-962.188) (-965.418) (-968.658) -- 0:01:07
56500 -- [-960.247] (-965.931) (-969.473) (-965.032) * (-961.775) [-959.073] (-963.255) (-971.470) -- 0:01:06
57000 -- (-961.573) (-964.219) (-965.967) [-960.129] * (-962.283) [-960.384] (-959.362) (-973.384) -- 0:01:06
57500 -- [-963.414] (-967.636) (-966.480) (-960.833) * [-962.960] (-961.520) (-963.740) (-971.872) -- 0:01:05
58000 -- (-962.612) (-960.898) (-976.541) [-959.804] * (-962.585) [-960.170] (-964.938) (-971.868) -- 0:01:21
58500 -- (-962.703) (-964.350) (-980.005) [-962.294] * [-960.442] (-962.701) (-963.926) (-968.729) -- 0:01:20
59000 -- (-965.717) (-964.719) (-960.384) [-960.849] * (-964.631) (-965.131) (-966.274) [-965.241] -- 0:01:19
59500 -- (-965.706) (-963.793) [-962.779] (-964.148) * (-962.152) (-962.723) [-965.362] (-966.283) -- 0:01:19
60000 -- (-964.721) (-962.656) (-959.993) [-962.595] * (-963.687) (-966.326) [-963.374] (-973.197) -- 0:01:18
Average standard deviation of split frequencies: 0.030673
60500 -- (-963.241) [-959.454] (-963.064) (-962.085) * (-959.926) (-963.475) [-963.658] (-967.017) -- 0:01:17
61000 -- (-960.717) (-963.882) (-965.044) [-961.880] * (-958.926) [-960.235] (-964.201) (-976.404) -- 0:01:16
61500 -- (-964.891) [-960.202] (-965.889) (-963.803) * (-959.464) (-962.429) (-966.341) [-973.222] -- 0:01:16
62000 -- (-963.680) (-959.682) (-966.666) [-961.732] * (-959.515) (-961.535) (-968.896) [-962.874] -- 0:01:15
62500 -- [-964.530] (-964.865) (-963.036) (-964.757) * [-962.345] (-961.675) (-963.555) (-970.555) -- 0:01:15
63000 -- (-961.286) [-962.819] (-963.212) (-962.500) * (-961.391) (-964.573) [-963.436] (-977.845) -- 0:01:14
63500 -- (-964.831) [-961.073] (-962.829) (-965.054) * (-961.639) [-959.686] (-962.582) (-963.829) -- 0:01:13
64000 -- (-964.038) [-960.551] (-963.313) (-960.283) * (-965.372) (-965.384) (-961.115) [-964.290] -- 0:01:13
64500 -- [-961.224] (-960.998) (-961.233) (-961.345) * (-962.788) (-961.566) [-963.500] (-974.832) -- 0:01:12
65000 -- [-960.521] (-963.099) (-965.830) (-961.127) * (-963.332) [-959.845] (-963.728) (-972.162) -- 0:01:11
Average standard deviation of split frequencies: 0.029998
65500 -- (-962.850) (-963.476) (-963.129) [-960.997] * (-959.607) (-962.914) [-963.447] (-977.834) -- 0:01:11
66000 -- (-963.231) (-964.653) [-959.577] (-960.805) * (-959.860) (-961.039) (-960.016) [-978.921] -- 0:01:10
66500 -- (-962.096) [-961.708] (-963.785) (-962.845) * [-960.502] (-962.229) (-964.930) (-974.175) -- 0:01:10
67000 -- (-962.355) (-960.751) [-961.414] (-961.706) * [-958.967] (-966.202) (-963.559) (-969.911) -- 0:01:09
67500 -- (-966.365) (-962.917) (-962.345) [-962.882] * (-961.091) [-960.670] (-959.375) (-968.590) -- 0:01:09
68000 -- (-963.572) [-962.311] (-959.503) (-962.820) * (-961.381) (-959.764) (-960.084) [-967.625] -- 0:01:08
68500 -- (-961.491) (-963.095) [-963.378] (-961.253) * [-965.245] (-963.202) (-959.084) (-964.417) -- 0:01:07
69000 -- [-961.677] (-967.716) (-964.092) (-963.435) * (-960.525) [-961.131] (-961.192) (-966.193) -- 0:01:07
69500 -- (-961.919) [-967.258] (-960.690) (-964.156) * (-962.796) [-961.234] (-960.931) (-975.472) -- 0:01:06
70000 -- (-966.052) (-960.887) (-958.835) [-961.423] * [-960.218] (-961.380) (-962.905) (-968.236) -- 0:01:06
Average standard deviation of split frequencies: 0.027954
70500 -- (-961.983) (-964.937) [-963.252] (-964.266) * (-961.681) [-960.477] (-959.644) (-968.531) -- 0:01:05
71000 -- [-960.729] (-963.965) (-963.486) (-963.641) * [-960.198] (-958.185) (-967.334) (-972.648) -- 0:01:05
71500 -- [-959.147] (-960.352) (-960.093) (-964.270) * [-959.845] (-963.204) (-962.054) (-973.845) -- 0:01:04
72000 -- (-961.952) [-961.337] (-959.957) (-961.964) * (-962.173) [-964.661] (-962.540) (-960.503) -- 0:01:04
72500 -- (-961.419) [-961.536] (-963.011) (-961.636) * (-964.373) (-964.025) (-960.723) [-961.484] -- 0:01:16
73000 -- (-961.356) (-959.514) (-962.395) [-963.079] * (-960.493) (-960.560) [-960.161] (-964.425) -- 0:01:16
73500 -- [-965.466] (-960.641) (-963.510) (-962.775) * (-963.824) (-964.062) [-962.983] (-959.909) -- 0:01:15
74000 -- (-962.497) (-963.336) [-959.269] (-962.631) * [-960.836] (-962.181) (-963.749) (-962.657) -- 0:01:15
74500 -- [-962.056] (-965.805) (-963.551) (-962.567) * (-964.022) [-959.575] (-963.230) (-961.935) -- 0:01:14
75000 -- (-966.273) (-970.186) (-961.482) [-960.601] * (-965.981) [-961.980] (-961.100) (-960.091) -- 0:01:14
Average standard deviation of split frequencies: 0.030034
75500 -- (-961.258) (-967.589) [-959.792] (-962.001) * (-962.442) [-959.812] (-960.882) (-960.396) -- 0:01:13
76000 -- (-963.579) (-961.475) [-962.256] (-963.412) * [-960.690] (-960.915) (-960.401) (-962.767) -- 0:01:12
76500 -- (-964.791) [-961.732] (-960.183) (-964.197) * [-960.544] (-960.317) (-967.256) (-962.958) -- 0:01:12
77000 -- (-963.187) [-965.459] (-963.949) (-962.915) * [-961.401] (-961.473) (-966.421) (-961.035) -- 0:01:11
77500 -- (-967.991) [-961.074] (-961.018) (-964.028) * [-959.547] (-963.330) (-968.731) (-961.157) -- 0:01:11
78000 -- (-964.614) (-961.102) [-959.707] (-961.106) * (-960.114) (-967.731) [-960.219] (-963.030) -- 0:01:10
78500 -- (-962.118) [-960.737] (-961.443) (-963.227) * [-962.120] (-961.195) (-960.654) (-963.711) -- 0:01:10
79000 -- (-959.958) [-960.208] (-960.687) (-964.654) * (-962.010) (-962.396) (-962.699) [-962.562] -- 0:01:09
79500 -- (-961.593) (-959.300) [-961.146] (-963.743) * (-963.957) [-960.766] (-962.130) (-961.212) -- 0:01:09
80000 -- (-961.549) (-962.041) (-967.168) [-963.490] * (-962.660) [-959.959] (-966.586) (-960.629) -- 0:01:09
Average standard deviation of split frequencies: 0.030142
80500 -- [-962.879] (-960.448) (-961.016) (-962.544) * (-963.418) (-965.671) [-962.764] (-959.635) -- 0:01:08
81000 -- (-962.233) (-961.832) (-960.866) [-963.218] * (-962.858) [-967.257] (-961.507) (-964.361) -- 0:01:08
81500 -- (-961.870) (-962.383) [-963.559] (-965.629) * (-962.916) [-961.467] (-960.300) (-963.725) -- 0:01:07
82000 -- (-969.243) (-959.381) (-962.723) [-959.869] * (-964.120) [-961.552] (-961.308) (-959.359) -- 0:01:07
82500 -- (-962.550) (-960.719) (-964.177) [-959.460] * (-961.310) (-961.625) (-960.318) [-959.212] -- 0:01:06
83000 -- (-965.755) (-961.296) [-960.227] (-961.421) * [-959.766] (-965.196) (-959.247) (-959.905) -- 0:01:06
83500 -- [-963.581] (-959.490) (-964.434) (-959.895) * [-959.501] (-965.545) (-959.261) (-960.615) -- 0:01:05
84000 -- (-962.714) [-960.531] (-964.115) (-960.510) * (-961.299) (-964.600) [-960.245] (-959.565) -- 0:01:05
84500 -- [-961.007] (-959.076) (-964.995) (-961.307) * (-960.930) (-963.427) [-960.052] (-961.204) -- 0:01:05
85000 -- (-963.722) (-962.400) (-965.379) [-960.577] * [-962.299] (-963.146) (-959.998) (-958.853) -- 0:01:04
Average standard deviation of split frequencies: 0.028273
85500 -- (-962.949) [-960.612] (-962.929) (-961.722) * [-959.811] (-965.922) (-960.282) (-960.477) -- 0:01:04
86000 -- (-963.173) [-959.825] (-965.839) (-961.606) * (-962.111) [-965.328] (-961.128) (-962.022) -- 0:01:03
86500 -- [-962.833] (-964.195) (-966.223) (-960.853) * (-965.824) (-965.188) (-961.939) [-962.146] -- 0:01:03
87000 -- (-960.190) [-963.023] (-961.552) (-961.099) * [-961.142] (-968.126) (-961.209) (-968.696) -- 0:01:02
87500 -- [-959.964] (-961.170) (-961.768) (-962.124) * (-960.229) [-963.818] (-960.174) (-968.822) -- 0:01:13
88000 -- (-963.962) [-959.873] (-961.555) (-960.116) * (-960.856) (-962.774) [-965.554] (-965.559) -- 0:01:12
88500 -- [-962.213] (-959.591) (-962.114) (-963.030) * [-958.934] (-966.989) (-959.324) (-961.451) -- 0:01:12
89000 -- [-962.228] (-961.188) (-962.129) (-962.688) * (-959.767) (-963.780) (-960.432) [-963.652] -- 0:01:11
89500 -- [-961.388] (-966.486) (-964.738) (-964.359) * [-960.231] (-963.725) (-960.689) (-964.677) -- 0:01:11
90000 -- [-959.376] (-963.243) (-964.335) (-963.569) * (-961.557) (-965.814) [-960.025] (-963.550) -- 0:01:10
Average standard deviation of split frequencies: 0.026818
90500 -- (-961.837) [-968.739] (-967.848) (-961.915) * (-959.944) [-964.050] (-965.352) (-966.185) -- 0:01:10
91000 -- [-962.737] (-962.777) (-965.324) (-960.278) * (-959.510) (-963.930) [-960.987] (-963.860) -- 0:01:09
91500 -- (-960.020) [-962.006] (-964.101) (-965.445) * [-962.361] (-965.055) (-960.848) (-960.959) -- 0:01:09
92000 -- [-961.530] (-962.822) (-963.643) (-961.990) * (-968.583) [-960.746] (-959.995) (-963.648) -- 0:01:09
92500 -- [-961.166] (-963.076) (-964.898) (-961.549) * [-961.771] (-963.004) (-961.979) (-962.367) -- 0:01:08
93000 -- [-961.201] (-965.278) (-964.240) (-960.143) * (-960.792) (-963.636) (-961.847) [-961.568] -- 0:01:08
93500 -- (-965.433) (-964.225) (-964.711) [-962.673] * (-962.023) (-958.637) (-964.453) [-960.186] -- 0:01:07
94000 -- (-963.219) (-959.714) (-965.813) [-963.599] * [-965.322] (-961.180) (-961.127) (-961.813) -- 0:01:07
94500 -- [-963.570] (-968.565) (-969.304) (-964.299) * (-963.998) [-963.428] (-960.307) (-962.603) -- 0:01:07
95000 -- [-960.091] (-966.316) (-963.297) (-960.593) * (-963.858) (-964.904) (-960.962) [-961.438] -- 0:01:06
Average standard deviation of split frequencies: 0.027654
95500 -- (-960.765) [-963.609] (-966.325) (-965.336) * (-963.111) (-964.501) [-963.726] (-962.657) -- 0:01:06
96000 -- [-960.009] (-968.047) (-965.095) (-964.289) * (-960.313) [-962.457] (-963.522) (-961.589) -- 0:01:05
96500 -- (-961.435) (-963.553) (-966.593) [-959.882] * (-961.343) [-963.827] (-961.875) (-960.875) -- 0:01:05
97000 -- [-961.356] (-961.088) (-964.273) (-962.765) * (-964.063) [-964.491] (-963.628) (-964.815) -- 0:01:05
97500 -- [-961.464] (-961.223) (-962.472) (-961.318) * (-962.897) (-965.511) [-962.697] (-965.572) -- 0:01:04
98000 -- (-962.400) [-961.887] (-966.850) (-960.411) * (-965.896) (-963.782) [-961.689] (-960.182) -- 0:01:04
98500 -- (-962.939) (-965.910) [-966.820] (-963.738) * (-963.902) (-966.153) [-959.001] (-960.227) -- 0:01:04
99000 -- (-960.924) (-962.754) [-963.077] (-963.505) * (-963.261) (-963.154) (-960.045) [-962.594] -- 0:01:03
99500 -- (-963.369) (-960.387) (-965.698) [-962.112] * (-960.666) [-963.164] (-961.721) (-965.046) -- 0:01:03
100000 -- [-960.586] (-961.202) (-960.977) (-962.178) * (-963.022) (-960.070) [-962.236] (-962.759) -- 0:01:02
Average standard deviation of split frequencies: 0.028343
100500 -- (-960.127) [-960.043] (-962.791) (-963.245) * (-961.832) (-961.369) [-960.941] (-965.809) -- 0:01:02
101000 -- (-960.711) [-958.688] (-961.441) (-960.224) * (-961.982) (-963.793) [-959.979] (-962.726) -- 0:01:02
101500 -- (-965.019) [-959.824] (-963.611) (-963.709) * (-963.254) (-963.775) [-959.247] (-962.321) -- 0:01:01
102000 -- [-964.686] (-963.429) (-964.321) (-963.765) * (-961.453) [-960.068] (-959.746) (-961.685) -- 0:01:01
102500 -- (-962.605) [-959.807] (-965.033) (-961.855) * (-961.375) (-963.480) (-963.244) [-963.339] -- 0:01:01
103000 -- (-960.021) (-967.140) [-963.809] (-961.166) * [-961.998] (-965.665) (-963.299) (-961.385) -- 0:01:09
103500 -- (-962.385) [-959.559] (-960.425) (-959.819) * [-963.578] (-965.466) (-961.491) (-960.235) -- 0:01:09
104000 -- (-962.381) (-960.997) [-962.854] (-962.903) * (-965.471) [-964.665] (-961.218) (-961.229) -- 0:01:08
104500 -- [-961.009] (-963.082) (-964.438) (-961.362) * [-965.899] (-969.686) (-960.626) (-962.238) -- 0:01:08
105000 -- (-961.018) (-963.524) [-964.482] (-963.469) * (-965.435) (-963.625) (-960.332) [-960.007] -- 0:01:08
Average standard deviation of split frequencies: 0.025513
105500 -- (-960.816) [-959.491] (-962.556) (-963.162) * [-959.046] (-966.604) (-962.117) (-962.228) -- 0:01:07
106000 -- (-960.761) (-962.551) [-964.020] (-961.016) * (-964.739) (-962.292) [-961.890] (-966.213) -- 0:01:07
106500 -- (-961.293) (-961.935) [-960.598] (-960.502) * (-964.707) (-961.422) [-960.457] (-964.915) -- 0:01:07
107000 -- (-963.819) (-961.452) [-961.945] (-965.120) * (-963.686) (-961.825) (-963.039) [-964.992] -- 0:01:06
107500 -- (-963.634) (-961.974) (-961.844) [-967.035] * (-969.212) [-961.487] (-961.729) (-962.940) -- 0:01:06
108000 -- (-966.347) [-962.797] (-960.676) (-959.394) * (-965.618) (-961.977) [-960.848] (-964.863) -- 0:01:06
108500 -- (-963.177) (-962.432) (-965.280) [-960.811] * (-963.460) (-961.298) (-961.012) [-962.021] -- 0:01:05
109000 -- (-963.883) (-960.065) [-964.328] (-961.243) * [-965.901] (-962.057) (-962.299) (-964.007) -- 0:01:05
109500 -- [-964.453] (-963.373) (-965.985) (-959.080) * [-965.157] (-962.885) (-963.659) (-961.012) -- 0:01:05
110000 -- (-966.781) (-960.171) (-964.271) [-962.842] * (-965.041) (-962.008) (-962.566) [-961.272] -- 0:01:04
Average standard deviation of split frequencies: 0.024437
110500 -- (-966.758) [-958.654] (-962.869) (-960.456) * (-964.750) (-964.309) [-961.682] (-964.193) -- 0:01:04
111000 -- (-965.804) [-962.174] (-961.256) (-964.298) * (-965.533) (-966.418) (-960.039) [-961.316] -- 0:01:04
111500 -- (-960.876) (-960.750) (-961.502) [-963.676] * (-963.472) (-959.906) [-961.074] (-961.544) -- 0:01:03
112000 -- (-960.966) [-963.600] (-961.139) (-962.335) * [-964.318] (-960.833) (-961.051) (-963.839) -- 0:01:03
112500 -- (-961.786) [-959.325] (-961.400) (-959.813) * (-963.288) (-964.006) (-962.043) [-964.593] -- 0:01:03
113000 -- (-962.433) [-965.990] (-961.815) (-961.881) * (-962.794) [-960.843] (-959.813) (-961.440) -- 0:01:02
113500 -- (-961.370) (-970.083) (-961.745) [-961.493] * [-962.459] (-962.111) (-963.386) (-961.513) -- 0:01:02
114000 -- (-963.540) (-964.955) (-965.197) [-962.077] * (-964.347) (-964.594) (-962.690) [-961.522] -- 0:01:02
114500 -- (-964.944) (-962.861) [-964.450] (-965.857) * (-961.387) (-964.561) [-964.623] (-961.075) -- 0:01:01
115000 -- (-965.509) [-962.294] (-962.501) (-966.204) * (-967.843) [-961.495] (-964.096) (-965.390) -- 0:01:01
Average standard deviation of split frequencies: 0.028661
115500 -- (-962.283) [-961.227] (-959.403) (-959.946) * (-962.583) (-964.664) [-963.172] (-966.317) -- 0:01:01
116000 -- (-965.595) [-963.514] (-960.077) (-959.900) * (-966.624) [-962.169] (-964.460) (-965.296) -- 0:01:00
116500 -- (-962.153) [-962.537] (-959.861) (-964.371) * (-962.125) (-967.023) [-964.209] (-963.096) -- 0:01:00
117000 -- (-963.195) (-963.634) [-960.417] (-964.851) * (-961.348) (-962.881) (-961.322) [-965.202] -- 0:01:00
117500 -- (-963.261) [-961.249] (-960.266) (-962.174) * (-960.939) (-959.854) [-961.885] (-966.553) -- 0:01:00
118000 -- (-960.107) [-958.712] (-962.583) (-964.114) * [-960.889] (-966.571) (-962.362) (-960.763) -- 0:01:07
118500 -- [-959.468] (-964.048) (-965.659) (-961.856) * (-961.130) [-963.460] (-959.834) (-959.790) -- 0:01:06
119000 -- [-962.381] (-962.159) (-961.302) (-960.592) * (-959.257) (-962.459) (-962.139) [-960.860] -- 0:01:06
119500 -- (-961.466) (-960.704) (-962.793) [-961.841] * (-961.833) (-963.802) [-963.222] (-961.302) -- 0:01:06
120000 -- [-959.641] (-963.822) (-960.072) (-964.042) * (-963.554) (-963.223) (-960.605) [-962.673] -- 0:01:06
Average standard deviation of split frequencies: 0.027758
120500 -- (-961.378) [-959.446] (-961.884) (-964.647) * (-960.539) (-963.037) [-961.535] (-963.845) -- 0:01:05
121000 -- (-961.800) [-961.447] (-959.983) (-965.481) * (-962.041) (-963.526) (-961.559) [-964.156] -- 0:01:05
121500 -- (-961.799) [-960.902] (-965.968) (-965.737) * (-962.015) (-964.305) [-964.086] (-961.848) -- 0:01:05
122000 -- (-960.415) (-963.339) (-961.143) [-964.729] * (-962.638) (-965.613) [-966.681] (-963.243) -- 0:01:04
122500 -- (-961.820) (-962.698) [-961.464] (-965.250) * (-963.991) (-965.365) (-961.378) [-961.259] -- 0:01:04
123000 -- [-963.101] (-962.113) (-958.863) (-964.364) * (-961.472) (-967.265) (-962.903) [-961.234] -- 0:01:04
123500 -- (-960.339) (-960.763) [-960.003] (-966.763) * (-963.585) (-965.637) [-958.926] (-963.972) -- 0:01:03
124000 -- [-959.195] (-960.447) (-959.978) (-961.858) * [-964.612] (-967.036) (-959.942) (-964.323) -- 0:01:03
124500 -- (-961.890) (-960.345) (-964.377) [-960.383] * (-967.508) (-966.043) [-961.146] (-964.919) -- 0:01:03
125000 -- (-959.863) (-959.273) [-965.053] (-963.440) * (-963.333) (-964.926) [-959.497] (-961.032) -- 0:01:03
Average standard deviation of split frequencies: 0.028355
125500 -- (-964.054) [-958.895] (-962.618) (-966.768) * (-964.788) (-963.688) (-961.051) [-960.393] -- 0:01:02
126000 -- [-961.982] (-962.834) (-960.370) (-963.806) * (-964.678) (-962.572) (-964.983) [-960.337] -- 0:01:02
126500 -- (-962.818) [-962.154] (-961.903) (-962.694) * (-962.753) (-964.034) [-962.899] (-960.514) -- 0:01:02
127000 -- (-961.147) (-961.961) (-960.397) [-962.009] * [-964.435] (-961.297) (-966.390) (-961.245) -- 0:01:01
127500 -- (-960.922) (-960.816) (-959.864) [-962.586] * (-960.699) (-965.035) (-962.108) [-964.601] -- 0:01:01
128000 -- (-962.593) (-963.924) [-960.087] (-960.638) * (-964.265) (-961.882) [-965.291] (-962.276) -- 0:01:01
128500 -- (-964.050) (-961.726) (-963.445) [-959.366] * (-963.417) (-962.439) (-962.099) [-961.649] -- 0:01:01
129000 -- (-961.840) (-964.204) (-960.746) [-961.295] * (-961.274) (-961.274) [-960.994] (-962.366) -- 0:01:00
129500 -- [-961.402] (-967.617) (-960.960) (-962.571) * (-966.514) (-961.289) (-960.393) [-961.915] -- 0:01:00
130000 -- (-960.761) (-965.576) (-960.639) [-967.409] * (-964.748) (-962.806) (-963.358) [-960.601] -- 0:01:00
Average standard deviation of split frequencies: 0.026336
130500 -- (-961.046) [-961.883] (-963.926) (-961.802) * (-965.428) (-960.984) [-960.919] (-959.388) -- 0:00:59
131000 -- (-960.797) (-959.122) (-959.967) [-961.382] * (-961.880) [-961.796] (-963.494) (-962.300) -- 0:00:59
131500 -- (-961.024) (-961.506) [-963.791] (-963.012) * (-963.853) [-961.402] (-961.223) (-960.959) -- 0:00:59
132000 -- [-964.012] (-964.749) (-965.979) (-965.457) * (-963.946) (-963.111) (-963.805) [-961.700] -- 0:00:59
132500 -- [-962.831] (-961.811) (-969.580) (-964.859) * (-961.031) [-960.598] (-960.355) (-961.785) -- 0:01:05
133000 -- (-963.494) [-962.404] (-962.591) (-965.545) * (-964.087) (-966.508) (-961.773) [-962.897] -- 0:01:05
133500 -- (-963.524) (-961.143) [-960.823] (-961.269) * (-968.932) (-961.931) (-963.972) [-961.660] -- 0:01:04
134000 -- (-962.919) [-958.789] (-962.994) (-959.862) * (-963.996) (-962.851) (-961.068) [-959.471] -- 0:01:04
134500 -- [-964.495] (-960.535) (-960.217) (-960.278) * (-961.641) (-961.323) (-960.557) [-960.619] -- 0:01:04
135000 -- (-965.869) (-963.214) [-961.002] (-961.219) * (-962.002) [-960.656] (-960.913) (-965.979) -- 0:01:04
Average standard deviation of split frequencies: 0.027730
135500 -- [-959.598] (-963.937) (-961.548) (-961.546) * (-964.496) [-959.984] (-963.511) (-961.428) -- 0:01:03
136000 -- (-959.385) (-959.995) (-962.424) [-963.823] * (-961.269) (-963.361) [-967.190] (-963.200) -- 0:01:03
136500 -- (-960.076) (-960.818) (-960.071) [-960.580] * (-963.025) (-962.949) [-960.540] (-961.420) -- 0:01:03
137000 -- (-959.798) (-959.874) [-962.129] (-964.967) * (-969.740) (-965.404) [-960.755] (-962.583) -- 0:01:02
137500 -- (-963.019) [-962.159] (-963.081) (-968.308) * [-963.693] (-960.758) (-960.687) (-965.345) -- 0:01:02
138000 -- (-963.425) [-963.381] (-963.600) (-963.805) * (-964.253) (-960.262) [-963.034] (-964.710) -- 0:01:02
138500 -- [-960.575] (-962.061) (-961.150) (-962.921) * [-961.187] (-963.824) (-960.661) (-965.800) -- 0:01:02
139000 -- (-965.708) (-961.220) [-962.881] (-964.463) * (-965.863) [-963.128] (-961.936) (-964.343) -- 0:01:01
139500 -- (-959.904) (-963.116) [-964.548] (-962.130) * (-962.435) (-964.831) (-961.442) [-963.695] -- 0:01:01
140000 -- (-959.596) [-963.444] (-963.531) (-960.768) * [-964.500] (-961.905) (-960.091) (-966.190) -- 0:01:01
Average standard deviation of split frequencies: 0.025972
140500 -- (-960.902) (-962.372) [-962.930] (-959.964) * (-962.286) (-961.846) [-961.750] (-963.382) -- 0:01:01
141000 -- (-963.282) [-960.538] (-964.717) (-962.604) * (-963.129) (-965.671) [-958.712] (-964.057) -- 0:01:00
141500 -- (-964.519) (-966.211) (-961.531) [-960.649] * (-961.176) [-962.551] (-959.307) (-964.667) -- 0:01:00
142000 -- (-960.625) (-962.604) (-962.462) [-965.081] * (-964.073) [-963.046] (-962.664) (-970.598) -- 0:01:00
142500 -- [-959.868] (-964.850) (-962.955) (-960.567) * (-965.123) (-964.206) [-962.777] (-966.670) -- 0:01:00
143000 -- [-962.671] (-964.496) (-962.165) (-964.906) * [-958.785] (-962.480) (-962.503) (-960.590) -- 0:00:59
143500 -- (-963.609) (-964.802) (-959.633) [-961.384] * (-960.483) (-964.691) (-961.444) [-962.401] -- 0:00:59
144000 -- (-962.341) (-963.859) [-962.633] (-963.713) * (-959.474) (-962.478) [-960.634] (-964.823) -- 0:00:59
144500 -- (-961.793) (-966.274) (-963.171) [-962.049] * (-960.124) (-965.859) [-963.145] (-966.778) -- 0:00:59
145000 -- (-961.914) (-964.067) [-962.611] (-971.004) * [-960.424] (-962.574) (-963.584) (-961.661) -- 0:00:58
Average standard deviation of split frequencies: 0.023893
145500 -- [-961.347] (-963.938) (-962.537) (-961.349) * [-961.886] (-962.936) (-963.458) (-964.532) -- 0:00:58
146000 -- (-961.498) (-960.847) (-960.932) [-968.303] * [-960.665] (-965.322) (-961.381) (-963.316) -- 0:00:58
146500 -- [-962.936] (-962.514) (-959.061) (-963.921) * (-963.217) (-962.162) (-963.626) [-961.981] -- 0:00:58
147000 -- [-962.126] (-959.117) (-959.195) (-961.948) * (-963.268) (-962.374) [-963.121] (-960.589) -- 0:01:03
147500 -- [-961.300] (-963.863) (-963.942) (-961.413) * (-961.473) (-965.454) [-966.915] (-963.597) -- 0:01:03
148000 -- [-961.956] (-963.312) (-961.433) (-964.366) * [-961.446] (-962.836) (-966.925) (-959.422) -- 0:01:03
148500 -- (-962.492) (-965.149) [-962.101] (-960.536) * (-961.614) [-962.845] (-966.127) (-966.902) -- 0:01:03
149000 -- (-959.458) [-965.859] (-962.184) (-960.579) * (-963.567) (-966.139) [-964.718] (-961.268) -- 0:01:02
149500 -- (-960.185) (-962.607) (-960.608) [-960.373] * (-963.336) (-963.610) (-963.340) [-960.186] -- 0:01:02
150000 -- [-959.261] (-962.313) (-959.801) (-961.985) * (-959.881) (-964.448) [-963.856] (-964.659) -- 0:01:02
Average standard deviation of split frequencies: 0.021902
150500 -- (-960.521) (-960.138) [-962.828] (-968.703) * (-962.165) (-961.964) (-960.900) [-961.766] -- 0:01:02
151000 -- (-959.717) [-962.358] (-960.310) (-964.348) * (-964.688) (-966.403) [-964.116] (-964.196) -- 0:01:01
151500 -- (-960.074) (-969.519) [-961.428] (-960.146) * (-962.322) (-960.418) (-963.145) [-960.364] -- 0:01:01
152000 -- (-960.665) (-964.697) [-960.880] (-961.722) * (-961.817) [-962.800] (-962.877) (-959.951) -- 0:01:01
152500 -- (-963.178) (-961.585) (-964.172) [-959.690] * (-960.257) (-961.747) (-961.574) [-961.518] -- 0:01:01
153000 -- (-960.327) [-962.450] (-961.111) (-961.129) * (-960.511) (-965.318) (-961.846) [-960.196] -- 0:01:00
153500 -- (-963.736) (-960.812) (-959.937) [-963.670] * [-961.701] (-963.261) (-961.620) (-964.623) -- 0:01:00
154000 -- [-960.725] (-966.571) (-961.718) (-962.016) * (-961.528) (-964.721) [-964.433] (-960.244) -- 0:01:00
154500 -- (-964.928) (-963.967) [-962.709] (-961.747) * (-962.514) [-964.183] (-970.392) (-964.722) -- 0:01:00
155000 -- (-961.929) (-964.836) [-963.226] (-961.530) * (-961.664) [-964.622] (-970.158) (-963.921) -- 0:00:59
Average standard deviation of split frequencies: 0.021757
155500 -- [-962.703] (-964.302) (-961.192) (-964.109) * (-963.079) [-968.032] (-962.284) (-960.427) -- 0:00:59
156000 -- (-966.245) (-962.977) [-961.543] (-961.563) * (-962.248) (-964.542) [-963.820] (-961.324) -- 0:00:59
156500 -- (-960.253) [-961.795] (-961.525) (-963.340) * (-963.606) (-963.230) [-963.742] (-961.065) -- 0:00:59
157000 -- [-961.237] (-961.191) (-960.915) (-963.394) * (-963.582) [-960.666] (-963.709) (-959.394) -- 0:00:59
157500 -- (-961.985) [-963.292] (-959.431) (-964.566) * (-964.442) [-961.563] (-963.794) (-961.364) -- 0:00:58
158000 -- [-961.268] (-964.234) (-960.714) (-965.425) * (-964.849) (-963.881) (-967.398) [-959.715] -- 0:00:58
158500 -- (-959.363) (-962.523) [-965.592] (-964.258) * (-962.016) [-959.629] (-961.834) (-966.174) -- 0:00:58
159000 -- [-959.461] (-959.233) (-961.160) (-960.960) * [-965.446] (-960.878) (-963.228) (-960.424) -- 0:00:58
159500 -- (-960.683) [-965.194] (-960.684) (-960.303) * (-962.075) [-963.394] (-962.375) (-962.313) -- 0:00:57
160000 -- [-960.029] (-964.673) (-965.128) (-961.699) * [-962.077] (-960.951) (-960.858) (-962.391) -- 0:00:57
Average standard deviation of split frequencies: 0.021565
160500 -- (-962.375) (-963.425) [-966.385] (-961.601) * (-961.404) [-962.040] (-961.808) (-959.832) -- 0:00:57
161000 -- (-962.952) (-963.177) [-962.446] (-965.682) * (-960.439) [-961.113] (-961.355) (-961.593) -- 0:00:57
161500 -- (-964.280) (-968.037) [-963.101] (-965.633) * (-963.624) (-961.940) (-963.204) [-962.551] -- 0:00:57
162000 -- (-963.151) (-968.488) (-962.246) [-965.471] * (-965.514) (-960.024) [-960.023] (-960.806) -- 0:00:56
162500 -- (-962.907) [-964.964] (-965.007) (-964.462) * [-964.106] (-961.695) (-961.791) (-962.707) -- 0:01:01
163000 -- (-960.765) (-962.743) [-961.220] (-961.229) * (-965.402) [-962.780] (-965.207) (-962.310) -- 0:01:01
163500 -- (-960.026) (-960.247) (-958.901) [-961.803] * (-962.395) (-967.213) [-964.043] (-964.840) -- 0:01:01
164000 -- [-961.855] (-962.539) (-961.807) (-961.409) * (-964.459) (-960.976) (-965.127) [-959.663] -- 0:01:01
164500 -- [-961.333] (-962.579) (-962.639) (-960.389) * (-962.719) (-964.954) (-965.003) [-960.747] -- 0:01:00
165000 -- (-961.643) (-961.849) [-963.797] (-967.402) * [-961.151] (-960.629) (-960.123) (-961.766) -- 0:01:00
Average standard deviation of split frequencies: 0.020446
165500 -- (-964.928) (-960.014) (-962.246) [-963.001] * [-961.074] (-960.573) (-960.262) (-962.780) -- 0:01:00
166000 -- (-965.351) (-959.002) (-959.315) [-962.075] * [-961.318] (-960.292) (-959.689) (-963.408) -- 0:01:00
166500 -- (-962.294) [-960.838] (-962.177) (-962.049) * [-962.790] (-964.636) (-960.060) (-964.312) -- 0:01:00
167000 -- [-960.170] (-962.305) (-959.524) (-966.483) * (-963.552) (-959.189) [-962.247] (-969.960) -- 0:00:59
167500 -- (-963.814) [-960.377] (-959.444) (-967.549) * (-963.839) [-959.472] (-962.177) (-967.783) -- 0:00:59
168000 -- [-960.419] (-962.368) (-960.512) (-963.671) * (-963.023) (-961.223) [-965.159] (-961.804) -- 0:00:59
168500 -- [-960.363] (-963.237) (-959.572) (-961.718) * [-962.723] (-960.414) (-964.001) (-961.737) -- 0:00:59
169000 -- (-960.568) [-962.654] (-962.770) (-963.217) * (-962.630) [-960.664] (-964.969) (-963.337) -- 0:00:59
169500 -- (-962.637) [-964.304] (-962.397) (-961.538) * [-962.365] (-959.879) (-962.428) (-962.891) -- 0:00:58
170000 -- (-960.410) (-965.262) (-960.879) [-963.475] * (-963.314) (-967.005) (-960.844) [-962.009] -- 0:00:58
Average standard deviation of split frequencies: 0.020302
170500 -- (-960.570) [-963.324] (-962.834) (-961.014) * (-960.676) (-963.404) [-966.913] (-964.320) -- 0:00:58
171000 -- [-961.128] (-964.856) (-963.296) (-960.524) * (-959.612) (-958.401) [-962.489] (-966.126) -- 0:00:58
171500 -- (-961.599) (-967.475) (-960.196) [-963.199] * (-959.919) [-962.877] (-962.674) (-965.701) -- 0:00:57
172000 -- [-960.431] (-965.714) (-961.408) (-964.137) * (-959.832) (-959.329) [-959.978] (-966.728) -- 0:00:57
172500 -- (-966.629) (-961.238) (-963.875) [-961.915] * [-960.781] (-965.708) (-966.670) (-959.350) -- 0:00:57
173000 -- (-960.735) (-962.457) (-966.774) [-963.615] * (-963.714) (-967.756) [-965.091] (-960.084) -- 0:00:57
173500 -- [-961.711] (-963.913) (-962.029) (-963.042) * [-961.473] (-963.765) (-963.379) (-964.685) -- 0:00:57
174000 -- (-959.132) (-967.632) (-961.440) [-960.792] * (-965.167) [-961.533] (-963.807) (-961.041) -- 0:00:56
174500 -- (-961.387) (-962.874) (-966.293) [-959.563] * (-961.618) (-960.622) (-963.486) [-963.008] -- 0:00:56
175000 -- (-965.359) (-963.367) [-960.027] (-961.024) * (-965.524) (-963.116) [-961.637] (-961.740) -- 0:00:56
Average standard deviation of split frequencies: 0.020222
175500 -- (-962.960) (-968.325) [-962.943] (-964.000) * [-964.946] (-967.556) (-965.340) (-966.083) -- 0:00:56
176000 -- (-961.853) (-964.027) (-960.016) [-960.667] * (-962.992) (-965.538) [-961.898] (-960.748) -- 0:00:56
176500 -- (-960.038) (-964.025) [-961.553] (-962.898) * (-963.679) (-960.987) [-961.471] (-962.621) -- 0:00:55
177000 -- (-960.158) (-962.504) [-959.130] (-960.715) * (-966.619) (-961.820) (-960.774) [-963.482] -- 0:00:55
177500 -- [-961.063] (-960.134) (-960.493) (-960.749) * (-960.556) (-961.878) [-960.615] (-961.007) -- 0:01:00
178000 -- (-960.434) (-960.058) [-959.891] (-963.159) * (-962.360) (-963.687) [-962.337] (-960.731) -- 0:01:00
178500 -- [-958.999] (-962.859) (-959.909) (-962.895) * (-961.065) (-964.021) (-960.976) [-963.797] -- 0:00:59
179000 -- (-962.558) (-960.141) [-962.369] (-962.373) * (-962.857) (-963.890) (-963.544) [-963.872] -- 0:00:59
179500 -- (-963.168) [-959.907] (-961.373) (-963.958) * (-962.640) [-961.112] (-961.161) (-962.265) -- 0:00:59
180000 -- (-961.405) [-958.957] (-962.553) (-962.029) * [-959.808] (-958.835) (-962.197) (-968.519) -- 0:00:59
Average standard deviation of split frequencies: 0.019700
180500 -- [-960.836] (-961.715) (-960.127) (-961.871) * (-966.049) [-960.392] (-960.212) (-964.581) -- 0:00:59
181000 -- (-960.490) (-960.902) (-960.096) [-961.534] * (-965.166) (-962.844) [-961.005] (-964.535) -- 0:00:58
181500 -- (-963.424) (-962.122) (-960.084) [-962.688] * [-961.301] (-962.900) (-962.968) (-963.867) -- 0:00:58
182000 -- (-961.627) (-962.452) [-958.894] (-960.975) * (-964.873) [-960.854] (-961.519) (-963.737) -- 0:00:58
182500 -- (-961.761) (-962.806) [-961.328] (-961.734) * (-961.271) (-966.180) (-963.165) [-964.174] -- 0:00:58
183000 -- (-962.957) (-964.757) (-963.100) [-963.730] * [-962.642] (-961.018) (-962.500) (-966.293) -- 0:00:58
183500 -- (-959.861) (-966.548) [-966.698] (-962.075) * (-964.793) (-963.474) [-960.855] (-960.914) -- 0:00:57
184000 -- [-959.415] (-960.430) (-969.305) (-962.636) * (-960.002) (-963.389) (-963.385) [-961.979] -- 0:00:57
184500 -- [-963.283] (-963.037) (-963.608) (-963.606) * [-963.547] (-959.546) (-962.234) (-961.358) -- 0:00:57
185000 -- (-962.009) (-961.321) [-963.455] (-960.925) * (-962.854) [-963.037] (-961.871) (-964.643) -- 0:00:57
Average standard deviation of split frequencies: 0.018707
185500 -- [-959.114] (-963.642) (-963.704) (-964.625) * (-964.119) (-968.588) (-961.385) [-961.903] -- 0:00:57
186000 -- [-966.225] (-962.334) (-962.300) (-963.985) * (-961.350) (-965.930) (-963.170) [-961.719] -- 0:00:56
186500 -- [-966.126] (-964.249) (-960.349) (-964.884) * (-964.773) [-961.549] (-960.482) (-962.049) -- 0:00:56
187000 -- (-965.168) (-961.511) [-960.516] (-962.677) * (-962.245) [-963.714] (-963.157) (-960.271) -- 0:00:56
187500 -- [-964.775] (-962.014) (-962.204) (-964.257) * (-960.798) [-960.520] (-959.467) (-962.396) -- 0:00:56
188000 -- (-960.732) (-964.139) [-960.289] (-960.995) * (-963.998) (-961.987) (-961.118) [-961.736] -- 0:00:56
188500 -- [-961.243] (-965.007) (-967.186) (-965.783) * [-961.696] (-961.028) (-965.527) (-960.223) -- 0:00:55
189000 -- (-961.801) (-965.279) (-961.463) [-962.440] * (-960.536) (-964.680) [-960.559] (-960.220) -- 0:00:55
189500 -- (-961.564) [-960.883] (-961.285) (-962.412) * (-964.332) (-961.228) [-962.593] (-963.215) -- 0:00:55
190000 -- (-962.208) (-962.370) (-961.684) [-959.607] * (-968.504) (-958.406) [-960.053] (-963.619) -- 0:00:55
Average standard deviation of split frequencies: 0.017437
190500 -- (-961.301) (-960.321) [-959.363] (-961.992) * (-964.324) (-961.609) [-960.842] (-962.152) -- 0:00:55
191000 -- (-962.905) (-961.701) [-963.541] (-960.851) * (-965.322) [-965.066] (-961.718) (-963.285) -- 0:00:55
191500 -- (-963.181) (-963.479) (-965.951) [-961.844] * (-965.521) [-962.143] (-960.251) (-967.879) -- 0:00:54
192000 -- (-962.043) (-964.355) (-960.348) [-962.303] * (-964.254) [-961.117] (-962.823) (-963.855) -- 0:00:54
192500 -- (-963.579) (-962.787) [-960.108] (-965.665) * [-964.020] (-959.891) (-962.883) (-963.825) -- 0:00:58
193000 -- (-962.373) (-962.685) [-961.270] (-962.263) * (-965.008) [-963.047] (-960.671) (-961.304) -- 0:00:58
193500 -- [-960.128] (-964.050) (-960.008) (-971.447) * [-964.467] (-964.489) (-963.690) (-960.889) -- 0:00:58
194000 -- (-959.802) (-962.935) (-960.133) [-960.774] * (-963.409) (-961.730) [-961.752] (-967.196) -- 0:00:58
194500 -- [-960.380] (-964.139) (-960.942) (-965.101) * [-961.078] (-966.316) (-960.911) (-967.253) -- 0:00:57
195000 -- [-961.992] (-962.187) (-960.139) (-962.530) * (-961.865) [-962.121] (-963.347) (-967.548) -- 0:00:57
Average standard deviation of split frequencies: 0.017237
195500 -- (-970.396) (-961.557) (-959.624) [-961.389] * (-963.377) (-964.264) (-960.244) [-962.206] -- 0:00:57
196000 -- (-961.957) (-965.915) (-959.511) [-962.455] * (-962.157) (-963.975) [-960.876] (-963.987) -- 0:00:57
196500 -- [-961.449] (-965.592) (-961.480) (-960.793) * (-963.605) [-961.648] (-959.787) (-966.445) -- 0:00:57
197000 -- (-965.169) [-964.774] (-960.799) (-963.006) * [-961.883] (-960.305) (-958.931) (-972.930) -- 0:00:57
197500 -- (-960.963) [-961.878] (-963.775) (-966.457) * [-961.114] (-959.215) (-962.895) (-964.527) -- 0:00:56
198000 -- (-962.951) [-962.041] (-961.283) (-968.540) * [-960.718] (-964.450) (-959.637) (-962.955) -- 0:00:56
198500 -- (-964.091) (-963.113) (-958.918) [-961.327] * (-961.815) (-964.545) (-963.568) [-962.546] -- 0:00:56
199000 -- (-964.543) (-965.681) (-960.901) [-962.511] * (-962.996) (-962.523) (-964.632) [-962.315] -- 0:00:56
199500 -- (-964.952) (-960.271) (-965.879) [-963.438] * [-961.102] (-962.209) (-963.907) (-963.394) -- 0:00:56
200000 -- (-967.284) [-965.572] (-959.699) (-963.979) * (-963.001) (-962.793) [-958.894] (-960.858) -- 0:00:55
Average standard deviation of split frequencies: 0.015009
200500 -- (-963.874) (-966.728) [-961.678] (-965.975) * [-962.221] (-967.841) (-968.366) (-963.561) -- 0:00:55
201000 -- (-963.772) (-965.803) (-960.896) [-961.050] * (-960.761) (-964.998) [-960.463] (-963.330) -- 0:00:55
201500 -- (-961.354) (-967.526) (-961.387) [-963.714] * (-962.181) (-961.865) (-960.654) [-961.763] -- 0:00:55
202000 -- (-961.567) [-965.638] (-965.695) (-961.296) * (-961.753) [-960.752] (-963.625) (-961.518) -- 0:00:55
202500 -- (-963.995) (-964.629) (-967.470) [-961.105] * (-959.824) (-961.718) (-962.177) [-959.629] -- 0:00:55
203000 -- (-960.837) (-959.267) (-961.684) [-962.005] * (-961.440) [-961.268] (-960.391) (-961.978) -- 0:00:54
203500 -- (-962.062) [-963.465] (-961.481) (-960.319) * (-961.075) [-959.471] (-959.708) (-963.811) -- 0:00:54
204000 -- [-960.791] (-964.527) (-964.211) (-960.799) * [-961.819] (-960.616) (-960.653) (-962.899) -- 0:00:54
204500 -- (-961.770) (-962.302) (-963.867) [-959.139] * (-959.621) [-963.828] (-960.656) (-967.609) -- 0:00:54
205000 -- (-965.447) [-962.192] (-963.676) (-966.006) * [-961.038] (-961.992) (-960.557) (-961.714) -- 0:00:54
Average standard deviation of split frequencies: 0.012967
205500 -- [-960.935] (-962.298) (-962.565) (-960.895) * (-959.435) (-961.822) (-962.694) [-962.471] -- 0:00:54
206000 -- [-963.107] (-960.638) (-966.110) (-961.052) * (-960.314) (-961.483) [-959.293] (-962.990) -- 0:00:53
206500 -- (-963.392) [-961.869] (-959.044) (-962.397) * (-959.656) (-967.529) [-962.139] (-962.678) -- 0:00:53
207000 -- (-961.375) [-962.689] (-959.276) (-964.482) * (-961.921) (-965.070) (-968.269) [-959.787] -- 0:00:53
207500 -- (-962.216) (-965.147) (-959.416) [-965.411] * (-960.495) (-963.838) [-963.828] (-963.286) -- 0:00:57
208000 -- [-959.675] (-961.341) (-961.110) (-961.090) * (-963.635) [-963.519] (-968.661) (-961.002) -- 0:00:57
208500 -- (-968.155) (-961.550) (-962.153) [-960.585] * (-963.150) (-961.719) (-961.800) [-961.796] -- 0:00:56
209000 -- (-961.143) (-962.434) (-963.893) [-963.512] * (-964.065) (-960.440) (-961.880) [-962.157] -- 0:00:56
209500 -- [-962.941] (-960.755) (-964.994) (-962.267) * (-960.886) [-962.243] (-962.705) (-964.223) -- 0:00:56
210000 -- (-963.201) (-962.298) [-962.096] (-959.645) * (-961.232) (-960.045) [-960.784] (-963.728) -- 0:00:56
Average standard deviation of split frequencies: 0.011313
210500 -- [-963.449] (-960.052) (-959.005) (-961.644) * (-959.564) (-962.157) [-960.870] (-965.394) -- 0:00:56
211000 -- (-962.169) (-960.184) [-961.200] (-962.694) * (-962.314) (-962.163) [-961.208] (-964.982) -- 0:00:56
211500 -- (-960.401) (-964.263) (-963.536) [-964.456] * (-963.666) (-962.862) [-961.232] (-962.454) -- 0:00:55
212000 -- (-960.827) (-960.735) [-961.580] (-963.124) * (-966.160) (-964.081) (-961.551) [-961.134] -- 0:00:55
212500 -- (-962.942) [-961.018] (-963.800) (-964.197) * (-963.368) (-963.527) (-961.881) [-962.123] -- 0:00:55
213000 -- (-961.721) (-963.226) (-963.549) [-959.503] * (-963.673) (-961.275) [-960.711] (-959.302) -- 0:00:55
213500 -- (-962.572) (-962.830) [-961.669] (-960.111) * (-958.612) (-962.250) [-960.364] (-961.482) -- 0:00:55
214000 -- (-961.363) (-965.744) [-966.535] (-961.995) * [-959.284] (-962.641) (-963.000) (-961.590) -- 0:00:55
214500 -- (-963.656) [-963.494] (-962.288) (-962.510) * (-961.159) (-962.065) [-961.875] (-961.771) -- 0:00:54
215000 -- [-962.200] (-961.605) (-962.374) (-960.402) * (-960.348) (-964.670) (-960.363) [-964.760] -- 0:00:54
Average standard deviation of split frequencies: 0.010912
215500 -- (-962.345) (-962.416) (-962.221) [-959.424] * (-962.362) (-963.326) (-960.452) [-961.868] -- 0:00:54
216000 -- (-960.225) [-962.034] (-960.407) (-962.084) * (-961.097) [-960.986] (-965.114) (-963.117) -- 0:00:54
216500 -- (-961.066) (-962.590) [-964.249] (-958.948) * (-961.206) (-961.896) [-962.399] (-963.134) -- 0:00:54
217000 -- (-961.327) (-961.907) (-966.644) [-962.179] * [-962.838] (-964.943) (-963.226) (-965.858) -- 0:00:54
217500 -- (-962.135) [-961.247] (-960.275) (-962.521) * (-962.764) (-961.612) (-961.178) [-961.621] -- 0:00:53
218000 -- (-961.728) (-961.562) [-960.867] (-959.327) * (-964.326) (-965.985) [-958.766] (-962.719) -- 0:00:53
218500 -- (-964.673) (-961.070) (-964.600) [-961.362] * (-966.485) (-964.465) (-960.480) [-962.895] -- 0:00:53
219000 -- [-963.712] (-960.302) (-964.013) (-962.204) * [-961.056] (-962.727) (-961.134) (-962.511) -- 0:00:53
219500 -- (-966.782) (-962.234) (-965.196) [-961.444] * (-964.501) (-962.685) (-969.789) [-963.646] -- 0:00:53
220000 -- (-962.998) (-962.761) (-961.997) [-961.691] * [-958.825] (-960.933) (-961.899) (-962.336) -- 0:00:56
Average standard deviation of split frequencies: 0.011435
220500 -- [-962.365] (-962.658) (-963.843) (-963.067) * [-961.412] (-966.687) (-960.038) (-961.383) -- 0:00:56
221000 -- (-964.379) (-961.238) (-965.623) [-962.089] * [-962.710] (-965.105) (-961.243) (-962.604) -- 0:00:56
221500 -- [-961.364] (-959.586) (-961.680) (-962.693) * (-960.707) (-966.309) [-958.753] (-961.670) -- 0:00:56
222000 -- (-963.311) (-961.879) (-962.645) [-960.191] * (-961.556) (-964.699) [-959.667] (-963.339) -- 0:00:56
222500 -- (-968.024) [-963.225] (-964.530) (-960.889) * [-963.394] (-965.569) (-958.535) (-960.726) -- 0:00:55
223000 -- (-961.422) (-964.100) (-967.712) [-962.217] * [-962.139] (-964.740) (-961.821) (-966.055) -- 0:00:55
223500 -- [-960.718] (-961.395) (-966.006) (-961.534) * (-961.280) [-959.891] (-959.405) (-964.899) -- 0:00:55
224000 -- [-962.972] (-963.792) (-965.089) (-962.175) * [-961.242] (-965.219) (-958.532) (-964.148) -- 0:00:55
224500 -- (-965.962) (-962.856) (-961.425) [-962.099] * (-965.191) (-962.392) (-960.772) [-965.076] -- 0:00:55
225000 -- (-970.205) (-965.594) [-964.910] (-961.883) * (-963.730) (-965.744) [-962.301] (-966.329) -- 0:00:55
Average standard deviation of split frequencies: 0.009448
225500 -- (-961.550) (-960.040) [-965.745] (-963.524) * [-961.803] (-961.204) (-968.153) (-964.869) -- 0:00:54
226000 -- [-961.214] (-959.558) (-959.547) (-963.971) * [-960.976] (-963.634) (-960.848) (-964.477) -- 0:00:54
226500 -- [-963.024] (-958.655) (-959.682) (-965.351) * [-962.755] (-961.012) (-960.057) (-963.386) -- 0:00:54
227000 -- (-961.094) (-962.063) (-961.831) [-960.571] * (-963.456) [-964.541] (-961.200) (-964.042) -- 0:00:54
227500 -- [-961.217] (-962.452) (-968.502) (-961.520) * [-966.041] (-961.342) (-961.455) (-967.159) -- 0:00:54
228000 -- [-959.489] (-960.951) (-962.780) (-960.523) * (-964.572) (-962.241) [-960.654] (-965.526) -- 0:00:54
228500 -- (-959.818) [-963.612] (-962.313) (-960.114) * (-962.739) (-961.729) [-959.879] (-965.761) -- 0:00:54
229000 -- (-961.929) (-962.093) [-962.898] (-960.206) * (-965.912) (-962.201) [-959.354] (-964.685) -- 0:00:53
229500 -- (-964.013) (-962.337) [-960.440] (-959.988) * (-963.469) (-963.466) (-961.684) [-964.656] -- 0:00:53
230000 -- (-963.357) (-963.714) (-969.796) [-962.364] * (-962.079) (-963.139) [-959.499] (-962.919) -- 0:00:53
Average standard deviation of split frequencies: 0.010098
230500 -- [-960.110] (-962.065) (-963.662) (-961.772) * [-963.997] (-960.963) (-963.699) (-962.958) -- 0:00:53
231000 -- (-965.623) (-964.767) [-960.652] (-961.517) * (-962.667) (-967.594) (-960.409) [-963.514] -- 0:00:53
231500 -- (-960.790) (-966.350) (-960.245) [-963.828] * (-963.055) (-963.903) [-959.720] (-964.469) -- 0:00:53
232000 -- [-960.258] (-959.266) (-961.608) (-964.195) * [-965.294] (-960.025) (-961.410) (-962.546) -- 0:00:52
232500 -- (-962.387) [-959.256] (-962.148) (-962.783) * (-964.080) (-961.419) [-963.887] (-968.349) -- 0:00:52
233000 -- (-962.888) [-959.642] (-963.279) (-968.023) * (-965.588) (-961.262) (-965.676) [-961.806] -- 0:00:52
233500 -- [-963.887] (-959.500) (-962.094) (-963.742) * (-963.298) (-959.622) (-963.922) [-962.848] -- 0:00:52
234000 -- (-967.481) [-960.559] (-962.878) (-963.232) * (-963.670) [-962.094] (-963.319) (-962.284) -- 0:00:52
234500 -- (-968.257) (-961.320) (-963.729) [-965.333] * (-964.821) (-960.550) (-962.257) [-962.729] -- 0:00:55
235000 -- (-964.677) [-961.484] (-967.676) (-961.658) * (-965.821) (-962.555) (-960.219) [-961.262] -- 0:00:55
Average standard deviation of split frequencies: 0.010692
235500 -- [-965.278] (-961.759) (-963.240) (-962.272) * (-960.702) (-960.728) [-961.171] (-965.661) -- 0:00:55
236000 -- (-960.601) (-960.355) (-963.528) [-962.948] * (-964.205) (-966.686) [-960.050] (-963.927) -- 0:00:55
236500 -- (-963.970) (-960.689) (-963.271) [-962.572] * [-959.441] (-962.463) (-962.233) (-966.743) -- 0:00:54
237000 -- (-959.490) [-958.853] (-963.020) (-964.872) * (-962.915) (-960.983) [-962.986] (-962.207) -- 0:00:54
237500 -- (-960.170) (-959.746) (-962.610) [-960.442] * (-962.704) (-966.083) [-960.798] (-962.134) -- 0:00:54
238000 -- (-961.092) (-961.785) (-964.530) [-961.635] * (-962.413) [-961.974] (-964.516) (-963.848) -- 0:00:54
238500 -- (-963.529) [-963.110] (-962.168) (-960.303) * (-961.202) (-960.730) (-963.047) [-959.356] -- 0:00:54
239000 -- (-964.273) (-969.609) (-963.824) [-964.833] * [-959.871] (-964.107) (-961.687) (-960.068) -- 0:00:54
239500 -- (-960.813) [-963.993] (-965.991) (-965.156) * [-963.737] (-967.351) (-961.740) (-965.361) -- 0:00:53
240000 -- (-969.246) (-966.314) [-961.627] (-962.633) * (-961.956) [-961.761] (-962.131) (-964.082) -- 0:00:53
Average standard deviation of split frequencies: 0.009794
240500 -- (-961.899) (-968.374) [-968.314] (-959.369) * [-962.758] (-958.937) (-963.529) (-965.952) -- 0:00:53
241000 -- (-962.838) (-960.065) [-961.857] (-959.871) * (-961.874) (-965.779) [-960.744] (-961.736) -- 0:00:53
241500 -- [-963.584] (-963.429) (-965.139) (-962.963) * (-962.262) (-961.179) [-962.596] (-963.989) -- 0:00:53
242000 -- [-959.739] (-964.386) (-960.642) (-962.397) * [-961.983] (-961.814) (-962.347) (-965.124) -- 0:00:53
242500 -- [-963.300] (-962.546) (-960.731) (-963.724) * [-963.209] (-960.347) (-961.259) (-964.600) -- 0:00:53
243000 -- (-959.210) [-961.203] (-963.896) (-963.955) * (-961.539) [-960.727] (-960.762) (-964.270) -- 0:00:52
243500 -- (-961.736) (-962.689) (-963.702) [-961.334] * [-960.520] (-963.616) (-965.829) (-961.678) -- 0:00:52
244000 -- (-961.544) [-961.406] (-961.040) (-966.713) * (-960.086) (-964.320) [-959.726] (-963.672) -- 0:00:52
244500 -- (-962.113) [-959.715] (-963.446) (-960.274) * [-967.669] (-964.205) (-961.101) (-964.835) -- 0:00:52
245000 -- (-961.102) (-960.636) [-960.815] (-959.896) * (-963.034) [-967.948] (-960.475) (-959.882) -- 0:00:52
Average standard deviation of split frequencies: 0.009018
245500 -- [-961.443] (-966.761) (-962.232) (-960.975) * (-961.992) (-961.335) (-961.616) [-963.152] -- 0:00:52
246000 -- (-960.586) (-961.721) [-960.868] (-961.695) * [-960.958] (-964.264) (-960.511) (-964.004) -- 0:00:52
246500 -- (-960.651) (-959.327) (-962.554) [-961.371] * [-962.326] (-966.042) (-961.535) (-964.873) -- 0:00:51
247000 -- (-965.534) (-961.845) (-962.623) [-961.052] * (-962.375) (-963.750) [-961.442] (-962.191) -- 0:00:51
247500 -- (-964.766) (-962.881) [-962.755] (-964.958) * (-962.127) (-962.701) [-958.351] (-960.772) -- 0:00:51
248000 -- (-963.350) (-961.806) [-962.950] (-961.380) * (-963.854) (-961.130) [-960.340] (-968.408) -- 0:00:51
248500 -- (-964.771) (-962.855) [-961.736] (-961.544) * (-962.827) (-962.196) [-961.051] (-965.504) -- 0:00:51
249000 -- (-965.210) (-964.946) [-962.521] (-962.910) * (-966.768) (-965.654) (-959.058) [-961.874] -- 0:00:51
249500 -- (-965.927) [-959.338] (-965.819) (-965.775) * (-964.121) (-960.869) [-960.199] (-965.906) -- 0:00:51
250000 -- [-961.972] (-960.067) (-964.431) (-961.183) * [-961.641] (-961.899) (-961.216) (-964.733) -- 0:00:54
Average standard deviation of split frequencies: 0.010177
250500 -- [-968.406] (-961.342) (-968.238) (-960.581) * (-966.779) (-962.335) (-964.017) [-961.047] -- 0:00:53
251000 -- [-964.295] (-960.024) (-965.345) (-961.078) * (-962.670) (-963.762) (-962.313) [-963.977] -- 0:00:53
251500 -- (-964.681) [-960.057] (-965.412) (-963.306) * (-961.923) (-962.793) (-963.465) [-963.492] -- 0:00:53
252000 -- (-959.265) [-962.851] (-963.522) (-962.805) * (-963.344) (-959.114) [-960.470] (-960.594) -- 0:00:53
252500 -- (-963.913) (-958.417) (-963.933) [-960.557] * (-962.240) [-959.436] (-960.958) (-961.235) -- 0:00:53
253000 -- (-962.136) (-964.806) [-961.662] (-964.631) * (-963.064) (-961.734) (-964.567) [-962.777] -- 0:00:53
253500 -- (-964.276) [-962.352] (-960.940) (-965.581) * [-967.098] (-963.667) (-967.911) (-961.732) -- 0:00:53
254000 -- (-967.610) (-959.953) (-962.997) [-960.055] * [-962.758] (-960.243) (-966.798) (-961.104) -- 0:00:52
254500 -- (-965.746) [-958.579] (-961.691) (-964.487) * (-961.790) [-959.751] (-961.799) (-964.962) -- 0:00:52
255000 -- (-965.190) [-961.226] (-963.465) (-969.475) * [-961.749] (-964.696) (-964.890) (-960.404) -- 0:00:52
Average standard deviation of split frequencies: 0.010724
255500 -- (-965.166) (-961.871) (-960.947) [-963.317] * (-965.042) (-960.525) (-963.221) [-960.419] -- 0:00:52
256000 -- (-963.784) [-960.303] (-965.255) (-964.932) * [-968.019] (-961.567) (-964.572) (-960.953) -- 0:00:52
256500 -- [-961.636] (-964.367) (-963.184) (-959.325) * [-963.102] (-960.745) (-964.329) (-960.605) -- 0:00:52
257000 -- (-964.011) (-962.672) [-962.468] (-960.630) * (-960.888) (-961.061) [-966.598] (-961.675) -- 0:00:52
257500 -- (-962.544) [-961.140] (-962.642) (-963.126) * (-960.711) (-960.920) [-960.157] (-963.938) -- 0:00:51
258000 -- [-962.154] (-959.265) (-963.289) (-963.055) * (-961.998) [-962.411] (-961.860) (-962.824) -- 0:00:51
258500 -- (-958.929) (-962.481) [-959.435] (-961.436) * [-962.981] (-961.872) (-965.678) (-960.842) -- 0:00:51
259000 -- (-961.234) (-961.787) [-961.551] (-958.559) * (-962.174) (-964.936) [-963.296] (-961.197) -- 0:00:51
259500 -- (-964.449) (-962.931) [-962.381] (-962.921) * (-964.577) (-960.578) (-964.934) [-960.175] -- 0:00:51
260000 -- [-962.016] (-960.227) (-962.297) (-959.756) * [-963.774] (-960.116) (-964.678) (-960.041) -- 0:00:51
Average standard deviation of split frequencies: 0.011064
260500 -- [-960.917] (-960.267) (-962.922) (-969.554) * [-960.806] (-964.475) (-963.469) (-961.514) -- 0:00:51
261000 -- (-960.317) (-963.541) (-959.482) [-960.647] * (-961.846) [-961.661] (-962.448) (-962.812) -- 0:00:50
261500 -- (-962.203) [-962.063] (-961.030) (-964.686) * [-962.955] (-962.506) (-964.116) (-962.798) -- 0:00:50
262000 -- [-968.457] (-962.020) (-959.924) (-962.243) * (-961.283) (-962.416) (-961.741) [-959.679] -- 0:00:50
262500 -- (-965.697) (-963.837) [-960.813] (-965.353) * (-964.138) [-962.569] (-962.492) (-960.418) -- 0:00:50
263000 -- (-964.494) (-961.963) [-963.560] (-961.672) * (-962.314) (-962.919) [-960.936] (-962.120) -- 0:00:50
263500 -- (-966.094) (-962.889) [-960.426] (-960.508) * (-963.520) [-963.539] (-964.551) (-960.964) -- 0:00:50
264000 -- (-961.646) (-960.195) [-961.121] (-965.928) * (-959.759) [-961.792] (-967.703) (-964.000) -- 0:00:50
264500 -- (-963.287) (-962.170) (-961.433) [-964.838] * [-959.191] (-961.813) (-965.457) (-964.216) -- 0:00:50
265000 -- (-962.947) [-962.501] (-962.045) (-964.424) * (-963.178) [-963.450] (-964.415) (-962.348) -- 0:00:49
Average standard deviation of split frequencies: 0.010633
265500 -- (-966.022) (-960.223) [-965.264] (-959.600) * (-964.247) [-959.880] (-962.959) (-960.926) -- 0:00:52
266000 -- (-962.783) [-961.645] (-965.047) (-963.355) * [-961.838] (-962.303) (-963.342) (-961.947) -- 0:00:52
266500 -- [-960.158] (-961.640) (-967.793) (-960.633) * [-961.783] (-964.212) (-965.963) (-962.755) -- 0:00:52
267000 -- (-962.658) [-963.279] (-962.144) (-962.271) * [-963.269] (-962.802) (-959.249) (-964.581) -- 0:00:52
267500 -- (-964.371) (-961.420) (-965.032) [-961.482] * (-961.356) [-966.400] (-960.825) (-964.591) -- 0:00:52
268000 -- (-963.629) [-962.276] (-965.136) (-959.918) * (-959.825) (-960.552) (-960.598) [-961.320] -- 0:00:51
268500 -- (-965.542) (-961.157) (-963.480) [-959.839] * (-962.933) (-960.338) [-960.480] (-963.119) -- 0:00:51
269000 -- (-961.267) [-965.123] (-962.643) (-960.734) * [-964.342] (-962.634) (-964.428) (-963.454) -- 0:00:51
269500 -- (-961.257) (-962.674) (-961.381) [-959.695] * (-965.607) [-960.779] (-962.478) (-964.600) -- 0:00:51
270000 -- (-960.913) [-961.880] (-963.000) (-963.067) * (-966.144) (-964.465) (-963.940) [-962.133] -- 0:00:51
Average standard deviation of split frequencies: 0.011577
270500 -- (-959.495) (-960.678) (-962.761) [-963.129] * (-960.410) (-965.592) (-963.416) [-963.457] -- 0:00:51
271000 -- (-964.652) [-963.631] (-963.489) (-962.094) * (-962.460) (-964.556) [-962.824] (-962.395) -- 0:00:51
271500 -- (-960.796) [-959.360] (-964.778) (-962.090) * (-962.336) (-965.472) [-964.051] (-963.301) -- 0:00:50
272000 -- (-961.503) [-961.619] (-962.866) (-965.309) * (-964.507) (-964.780) [-964.229] (-961.975) -- 0:00:50
272500 -- [-960.760] (-960.939) (-963.587) (-965.139) * (-964.851) [-962.436] (-964.042) (-963.183) -- 0:00:50
273000 -- (-963.704) [-964.495] (-963.343) (-962.461) * (-965.792) [-961.628] (-961.173) (-961.906) -- 0:00:50
273500 -- (-961.418) (-961.093) (-964.439) [-961.583] * (-960.827) (-963.191) (-962.451) [-961.919] -- 0:00:50
274000 -- [-965.826] (-960.773) (-965.390) (-961.775) * (-962.143) (-964.090) (-962.630) [-961.298] -- 0:00:50
274500 -- (-963.035) [-963.370] (-964.823) (-962.756) * (-960.248) (-962.227) [-962.890] (-960.197) -- 0:00:50
275000 -- (-962.778) (-965.204) (-969.430) [-961.230] * (-962.503) [-962.090] (-963.107) (-966.860) -- 0:00:50
Average standard deviation of split frequencies: 0.010248
275500 -- (-963.398) (-963.503) [-965.233] (-962.287) * (-962.248) (-960.413) [-960.762] (-962.907) -- 0:00:49
276000 -- (-963.455) (-965.862) [-966.117] (-961.691) * [-962.223] (-962.307) (-961.058) (-958.496) -- 0:00:49
276500 -- (-966.935) (-965.012) (-963.374) [-965.058] * (-963.027) (-965.141) (-961.109) [-959.492] -- 0:00:49
277000 -- [-963.115] (-965.963) (-967.825) (-960.087) * [-963.779] (-958.954) (-961.478) (-963.677) -- 0:00:49
277500 -- [-960.949] (-963.074) (-966.445) (-962.092) * (-962.852) (-968.240) (-960.656) [-961.317] -- 0:00:49
278000 -- (-962.565) (-963.794) [-961.243] (-963.381) * (-960.329) (-962.576) (-963.756) [-963.505] -- 0:00:49
278500 -- (-961.552) [-963.771] (-962.014) (-962.028) * (-963.710) (-962.841) (-962.137) [-960.528] -- 0:00:49
279000 -- [-963.516] (-964.993) (-964.887) (-964.669) * (-965.184) (-966.391) (-960.480) [-960.157] -- 0:00:49
279500 -- (-960.958) (-961.993) (-963.746) [-961.553] * (-962.156) (-963.211) (-961.864) [-960.277] -- 0:00:48
280000 -- (-964.847) [-960.273] (-961.853) (-963.452) * (-965.473) (-963.691) (-963.247) [-959.101] -- 0:00:48
Average standard deviation of split frequencies: 0.009448
280500 -- [-965.107] (-960.643) (-963.618) (-962.828) * (-963.921) (-962.453) [-963.770] (-961.806) -- 0:00:48
281000 -- (-962.756) [-959.356] (-963.362) (-961.788) * [-960.205] (-964.044) (-961.835) (-963.843) -- 0:00:51
281500 -- (-961.718) [-960.905] (-963.737) (-960.718) * (-962.359) (-959.320) (-960.642) [-960.465] -- 0:00:51
282000 -- (-963.417) [-962.540] (-965.032) (-963.758) * [-967.293] (-960.293) (-963.369) (-963.889) -- 0:00:50
282500 -- (-960.516) (-962.982) [-962.261] (-965.129) * (-959.959) (-962.552) (-963.797) [-963.399] -- 0:00:50
283000 -- (-960.490) [-959.569] (-963.407) (-964.458) * [-959.801] (-962.782) (-964.765) (-960.831) -- 0:00:50
283500 -- (-963.093) (-964.311) [-965.701] (-961.115) * (-961.319) (-961.220) (-959.785) [-963.588] -- 0:00:50
284000 -- (-961.753) (-961.956) (-963.733) [-961.379] * (-961.849) (-960.932) (-965.845) [-962.166] -- 0:00:50
284500 -- (-964.876) [-963.280] (-965.019) (-962.117) * (-965.167) (-963.454) (-963.449) [-960.569] -- 0:00:50
285000 -- (-961.600) [-966.221] (-961.538) (-960.335) * (-959.596) (-962.684) [-960.590] (-965.425) -- 0:00:50
Average standard deviation of split frequencies: 0.009581
285500 -- [-964.344] (-962.966) (-961.229) (-964.306) * [-959.643] (-960.590) (-964.139) (-960.314) -- 0:00:50
286000 -- (-962.761) (-962.562) (-959.761) [-960.448] * (-960.881) [-962.035] (-963.908) (-966.106) -- 0:00:49
286500 -- [-964.010] (-960.059) (-963.266) (-961.209) * (-962.386) [-959.356] (-960.076) (-964.056) -- 0:00:49
287000 -- (-966.350) (-961.890) [-963.056] (-962.624) * [-962.262] (-963.550) (-960.127) (-961.799) -- 0:00:49
287500 -- [-963.016] (-962.285) (-960.424) (-965.642) * (-962.970) (-962.935) (-964.868) [-962.798] -- 0:00:49
288000 -- [-962.084] (-961.768) (-965.328) (-965.819) * [-960.511] (-960.824) (-962.176) (-961.416) -- 0:00:49
288500 -- (-962.955) (-959.519) (-963.236) [-962.735] * (-963.979) (-959.636) (-961.673) [-963.519] -- 0:00:49
289000 -- (-961.369) [-965.901] (-963.650) (-967.732) * (-964.157) (-961.043) [-962.540] (-959.846) -- 0:00:49
289500 -- (-960.585) (-967.149) (-963.774) [-962.413] * (-959.251) [-965.046] (-963.863) (-963.133) -- 0:00:49
290000 -- (-961.521) (-964.174) [-965.859] (-965.474) * [-960.017] (-959.994) (-962.547) (-964.940) -- 0:00:48
Average standard deviation of split frequencies: 0.008819
290500 -- [-962.285] (-961.738) (-961.229) (-964.792) * (-963.367) [-962.668] (-962.147) (-962.576) -- 0:00:48
291000 -- (-969.930) (-964.906) (-964.981) [-968.040] * [-963.488] (-963.157) (-961.770) (-962.984) -- 0:00:48
291500 -- (-964.090) (-960.699) [-962.228] (-966.005) * [-962.430] (-961.667) (-961.289) (-962.932) -- 0:00:48
292000 -- (-960.422) [-960.990] (-963.771) (-968.693) * [-961.686] (-960.227) (-959.829) (-964.060) -- 0:00:48
292500 -- (-962.438) (-961.061) (-961.482) [-961.821] * [-968.718] (-964.468) (-962.546) (-964.437) -- 0:00:48
293000 -- [-959.714] (-961.243) (-965.771) (-964.422) * (-959.668) (-961.201) (-959.324) [-962.918] -- 0:00:48
293500 -- [-961.637] (-961.074) (-966.561) (-962.268) * (-962.021) (-965.436) [-967.119] (-964.669) -- 0:00:48
294000 -- (-960.157) (-962.503) [-963.068] (-964.436) * (-963.572) (-960.069) [-959.254] (-965.032) -- 0:00:48
294500 -- (-960.288) (-959.154) [-965.638] (-965.617) * (-960.315) (-963.396) (-959.405) [-961.051] -- 0:00:47
295000 -- (-959.364) (-960.204) (-965.201) [-967.074] * [-963.614] (-958.504) (-960.616) (-961.602) -- 0:00:47
Average standard deviation of split frequencies: 0.008361
295500 -- [-961.359] (-961.566) (-965.217) (-963.878) * (-965.102) (-960.590) (-962.018) [-961.050] -- 0:00:47
296000 -- (-963.893) (-964.522) (-960.934) [-961.825] * (-966.585) [-960.422] (-962.120) (-968.216) -- 0:00:47
296500 -- (-964.161) (-963.717) [-963.306] (-962.807) * (-964.776) [-960.360] (-961.608) (-964.988) -- 0:00:49
297000 -- [-959.804] (-964.593) (-963.350) (-966.487) * (-971.947) (-965.659) (-961.285) [-962.124] -- 0:00:49
297500 -- [-959.755] (-964.003) (-966.776) (-964.264) * [-962.198] (-961.812) (-966.150) (-962.123) -- 0:00:49
298000 -- (-964.528) (-963.968) (-961.955) [-961.589] * (-959.527) [-960.863] (-963.083) (-966.729) -- 0:00:49
298500 -- [-962.424] (-961.069) (-964.162) (-961.713) * (-960.457) [-961.238] (-967.188) (-963.184) -- 0:00:49
299000 -- (-961.623) (-960.386) [-962.674] (-969.338) * [-958.436] (-961.930) (-961.026) (-960.607) -- 0:00:49
299500 -- (-963.561) [-960.501] (-966.187) (-964.095) * (-961.725) (-961.596) [-961.295] (-963.806) -- 0:00:49
300000 -- (-961.996) [-960.335] (-959.951) (-966.398) * (-961.837) (-963.208) (-965.653) [-964.830] -- 0:00:48
Average standard deviation of split frequencies: 0.008133
300500 -- (-962.671) (-964.552) [-962.406] (-967.368) * (-960.952) (-963.450) [-961.222] (-964.384) -- 0:00:48
301000 -- (-961.243) [-966.540] (-962.430) (-964.356) * (-961.415) (-965.202) [-963.677] (-961.296) -- 0:00:48
301500 -- (-966.054) (-965.792) [-960.743] (-966.183) * (-960.624) (-962.751) [-964.221] (-963.403) -- 0:00:48
302000 -- (-962.548) (-965.496) [-963.040] (-961.267) * (-962.571) (-963.086) [-964.426] (-964.920) -- 0:00:48
302500 -- (-963.013) (-964.172) (-962.421) [-960.680] * (-960.282) (-960.957) [-963.235] (-958.920) -- 0:00:48
303000 -- (-961.104) (-964.969) (-961.462) [-962.857] * (-964.620) [-962.293] (-964.167) (-960.235) -- 0:00:48
303500 -- (-962.763) (-966.460) (-959.769) [-962.360] * (-965.995) (-962.863) (-961.509) [-961.701] -- 0:00:48
304000 -- (-959.823) (-962.250) [-962.091] (-962.366) * (-960.752) (-960.424) [-963.165] (-959.725) -- 0:00:48
304500 -- (-961.999) (-965.777) (-962.480) [-960.471] * (-962.588) (-963.594) [-961.011] (-960.955) -- 0:00:47
305000 -- (-971.849) [-960.704] (-962.658) (-960.334) * (-962.353) (-960.849) (-961.949) [-962.958] -- 0:00:47
Average standard deviation of split frequencies: 0.007895
305500 -- (-969.341) (-961.532) [-961.081] (-966.734) * (-963.450) [-960.518] (-961.908) (-960.491) -- 0:00:47
306000 -- (-959.856) (-967.871) (-962.791) [-962.592] * (-963.559) (-962.489) [-959.648] (-964.024) -- 0:00:47
306500 -- (-962.585) (-963.169) (-964.481) [-967.672] * (-963.344) (-962.153) [-971.760] (-961.546) -- 0:00:47
307000 -- (-961.275) [-963.169] (-963.238) (-964.303) * (-958.761) [-961.998] (-959.406) (-975.522) -- 0:00:47
307500 -- [-962.609] (-963.779) (-968.014) (-962.484) * [-960.035] (-965.028) (-958.713) (-964.891) -- 0:00:47
308000 -- (-960.509) [-962.063] (-967.099) (-963.315) * (-962.705) [-962.369] (-960.709) (-960.056) -- 0:00:47
308500 -- (-965.195) (-964.307) [-961.733] (-966.744) * [-960.628] (-960.196) (-962.518) (-959.489) -- 0:00:47
309000 -- (-966.828) [-961.231] (-960.960) (-967.211) * (-959.740) (-959.452) (-966.127) [-959.108] -- 0:00:46
309500 -- (-965.657) (-962.623) (-961.023) [-968.495] * [-960.877] (-960.769) (-962.815) (-958.447) -- 0:00:46
310000 -- (-964.653) (-961.712) [-960.233] (-963.477) * (-963.231) [-962.314] (-962.649) (-964.388) -- 0:00:46
Average standard deviation of split frequencies: 0.007113
310500 -- (-964.330) (-961.008) [-963.112] (-962.753) * (-964.367) [-959.526] (-963.285) (-960.087) -- 0:00:46
311000 -- [-961.146] (-964.542) (-959.879) (-962.266) * (-962.379) [-960.890] (-965.425) (-962.803) -- 0:00:46
311500 -- (-961.044) (-962.400) (-962.178) [-965.828] * [-960.954] (-961.122) (-965.234) (-965.677) -- 0:00:46
312000 -- (-959.045) (-964.760) [-960.826] (-961.159) * (-964.484) [-960.369] (-964.174) (-961.984) -- 0:00:48
312500 -- (-964.697) (-965.377) [-960.900] (-963.766) * (-961.118) (-965.325) [-962.327] (-961.204) -- 0:00:48
313000 -- [-962.964] (-961.132) (-958.805) (-967.617) * (-965.916) [-961.001] (-963.273) (-961.576) -- 0:00:48
313500 -- [-961.454] (-959.902) (-960.965) (-963.899) * [-966.909] (-960.276) (-961.943) (-961.540) -- 0:00:48
314000 -- (-961.893) (-962.233) [-962.570] (-964.119) * (-963.813) (-962.167) [-960.765] (-960.875) -- 0:00:48
314500 -- (-963.136) (-962.873) [-960.925] (-962.566) * (-962.385) (-960.797) (-961.759) [-963.471] -- 0:00:47
315000 -- [-961.933] (-962.603) (-962.289) (-962.516) * (-964.125) (-961.397) [-963.323] (-961.291) -- 0:00:47
Average standard deviation of split frequencies: 0.008018
315500 -- (-963.163) (-966.174) [-960.411] (-961.450) * (-963.075) [-962.075] (-963.653) (-963.285) -- 0:00:47
316000 -- (-961.703) (-961.831) (-960.393) [-962.877] * (-961.154) (-963.048) (-961.028) [-962.443] -- 0:00:47
316500 -- (-960.414) [-964.033] (-960.129) (-962.317) * (-962.489) (-960.137) [-960.799] (-960.811) -- 0:00:47
317000 -- [-959.682] (-964.043) (-961.735) (-960.122) * (-961.497) [-959.691] (-961.422) (-960.505) -- 0:00:47
317500 -- (-961.655) [-963.663] (-961.011) (-959.209) * [-961.841] (-959.979) (-960.618) (-967.128) -- 0:00:47
318000 -- [-961.390] (-963.323) (-960.002) (-961.932) * [-961.604] (-961.884) (-962.391) (-961.844) -- 0:00:47
318500 -- [-960.923] (-967.106) (-961.991) (-962.078) * (-961.155) [-963.324] (-964.554) (-961.907) -- 0:00:47
319000 -- (-962.746) (-965.759) [-960.880] (-964.804) * (-963.327) [-961.763] (-965.441) (-962.241) -- 0:00:46
319500 -- (-962.218) (-963.430) [-960.306] (-961.170) * (-960.786) (-967.881) [-962.648] (-965.068) -- 0:00:46
320000 -- (-962.759) (-963.686) (-964.469) [-961.301] * [-960.734] (-968.563) (-962.772) (-962.672) -- 0:00:46
Average standard deviation of split frequencies: 0.007626
320500 -- (-962.481) (-963.734) (-960.531) [-961.993] * (-959.688) (-963.207) [-961.033] (-962.360) -- 0:00:46
321000 -- (-968.053) (-965.690) (-960.655) [-960.103] * [-959.356] (-963.445) (-960.035) (-963.888) -- 0:00:46
321500 -- (-960.370) [-962.469] (-961.951) (-960.108) * [-962.945] (-964.820) (-962.286) (-961.466) -- 0:00:46
322000 -- (-959.602) (-963.138) [-959.350] (-964.162) * [-961.692] (-966.862) (-962.975) (-960.964) -- 0:00:46
322500 -- [-961.840] (-964.301) (-961.024) (-961.897) * (-962.593) (-967.413) [-961.682] (-963.732) -- 0:00:46
323000 -- [-958.992] (-964.362) (-960.300) (-969.472) * (-961.696) (-969.687) (-961.061) [-959.554] -- 0:00:46
323500 -- [-963.876] (-964.361) (-962.309) (-962.685) * (-962.844) (-967.818) [-962.452] (-961.709) -- 0:00:46
324000 -- [-960.635] (-966.085) (-960.124) (-964.578) * (-962.358) (-967.874) (-965.028) [-963.191] -- 0:00:45
324500 -- [-962.109] (-963.294) (-959.081) (-967.360) * (-970.814) (-960.060) (-965.219) [-959.895] -- 0:00:45
325000 -- (-965.883) (-961.455) [-961.897] (-961.524) * (-964.788) [-960.013] (-964.264) (-962.091) -- 0:00:45
Average standard deviation of split frequencies: 0.007953
325500 -- (-963.546) (-964.950) (-963.853) [-960.763] * (-962.386) (-959.863) (-962.421) [-959.703] -- 0:00:45
326000 -- (-963.640) (-960.598) (-959.533) [-959.910] * (-960.611) (-961.221) (-961.918) [-963.598] -- 0:00:45
326500 -- (-960.445) [-963.729] (-962.905) (-964.012) * (-959.305) (-960.025) (-963.324) [-961.657] -- 0:00:45
327000 -- [-961.792] (-963.340) (-958.993) (-960.146) * (-960.742) [-960.343] (-963.115) (-957.975) -- 0:00:47
327500 -- (-963.185) (-960.172) [-963.026] (-964.334) * (-960.258) [-960.231] (-961.168) (-963.270) -- 0:00:47
328000 -- (-960.535) (-960.123) (-963.891) [-964.004] * [-963.179] (-964.107) (-961.639) (-962.980) -- 0:00:47
328500 -- [-960.625] (-963.208) (-966.683) (-969.432) * (-960.588) (-963.399) (-960.700) [-961.513] -- 0:00:47
329000 -- (-962.695) (-959.525) (-968.887) [-960.107] * (-960.334) (-964.487) [-961.886] (-962.797) -- 0:00:46
329500 -- (-960.121) (-966.215) [-960.731] (-965.904) * [-960.680] (-963.425) (-967.504) (-965.286) -- 0:00:46
330000 -- (-961.851) (-965.099) [-963.567] (-963.025) * (-962.147) (-965.921) [-964.420] (-961.661) -- 0:00:46
Average standard deviation of split frequencies: 0.008019
330500 -- (-961.257) (-963.199) [-959.700] (-961.298) * [-959.834] (-967.977) (-959.193) (-963.355) -- 0:00:46
331000 -- (-968.841) (-959.974) [-963.563] (-962.012) * [-962.510] (-967.299) (-961.034) (-960.403) -- 0:00:46
331500 -- (-960.957) (-961.448) [-967.285] (-964.587) * [-961.913] (-963.972) (-961.915) (-962.811) -- 0:00:46
332000 -- [-962.471] (-960.710) (-964.168) (-966.775) * (-964.510) [-962.625] (-959.769) (-961.691) -- 0:00:46
332500 -- (-960.567) (-961.505) [-961.667] (-961.336) * (-960.840) (-961.843) [-960.527] (-960.780) -- 0:00:46
333000 -- [-960.793] (-962.024) (-961.435) (-966.049) * (-963.259) (-960.679) (-960.414) [-964.977] -- 0:00:46
333500 -- (-959.483) [-961.493] (-960.400) (-962.855) * (-962.490) (-961.662) [-963.138] (-960.265) -- 0:00:45
334000 -- (-964.357) (-959.033) (-963.319) [-960.324] * (-959.855) (-959.822) [-963.480] (-963.881) -- 0:00:45
334500 -- (-960.989) [-961.683] (-962.227) (-960.186) * (-962.886) [-962.367] (-963.348) (-966.676) -- 0:00:45
335000 -- [-962.303] (-960.371) (-965.117) (-963.194) * (-962.242) (-959.740) [-958.899] (-961.391) -- 0:00:45
Average standard deviation of split frequencies: 0.008243
335500 -- (-962.314) (-964.387) (-964.193) [-963.387] * (-966.453) (-959.573) [-961.276] (-963.027) -- 0:00:45
336000 -- [-960.973] (-966.019) (-966.989) (-959.817) * (-960.941) [-961.324] (-963.638) (-963.247) -- 0:00:45
336500 -- (-960.488) (-964.847) [-960.748] (-960.497) * (-961.936) (-960.932) (-963.126) [-961.355] -- 0:00:45
337000 -- (-961.917) [-961.990] (-963.585) (-961.968) * (-961.527) [-960.031] (-962.414) (-959.051) -- 0:00:45
337500 -- (-960.287) (-960.109) [-959.806] (-960.994) * (-962.326) [-959.403] (-965.866) (-960.676) -- 0:00:45
338000 -- [-961.884] (-960.812) (-962.314) (-962.833) * (-964.650) (-960.618) (-960.013) [-960.585] -- 0:00:45
338500 -- (-963.140) [-960.338] (-960.937) (-966.929) * (-964.914) (-960.594) [-961.634] (-959.666) -- 0:00:44
339000 -- [-962.217] (-962.805) (-961.048) (-968.211) * (-962.219) (-958.948) (-960.473) [-959.916] -- 0:00:44
339500 -- [-963.911] (-966.879) (-960.005) (-960.887) * (-961.514) [-961.361] (-963.825) (-962.180) -- 0:00:44
340000 -- (-960.468) (-964.184) [-960.518] (-965.244) * (-963.618) (-962.261) (-959.549) [-961.661] -- 0:00:44
Average standard deviation of split frequencies: 0.009594
340500 -- [-961.211] (-965.758) (-960.505) (-961.956) * (-959.292) (-960.563) [-959.538] (-968.144) -- 0:00:44
341000 -- [-964.067] (-962.526) (-961.593) (-961.079) * [-959.696] (-965.618) (-961.238) (-965.362) -- 0:00:44
341500 -- (-961.342) (-963.520) (-960.583) [-964.316] * (-960.167) [-958.915] (-960.527) (-964.442) -- 0:00:44
342000 -- (-961.401) [-962.839] (-959.806) (-962.513) * (-962.786) (-962.913) (-960.953) [-962.962] -- 0:00:44
342500 -- (-963.471) [-959.643] (-963.428) (-961.072) * (-961.048) (-962.700) [-961.100] (-963.394) -- 0:00:46
343000 -- (-962.773) [-961.036] (-960.658) (-960.502) * (-960.093) [-962.832] (-960.361) (-960.479) -- 0:00:45
343500 -- (-962.810) [-962.024] (-960.931) (-958.935) * [-961.617] (-959.703) (-961.194) (-962.003) -- 0:00:45
344000 -- (-961.079) (-967.654) (-962.923) [-961.955] * [-960.169] (-959.887) (-961.523) (-964.010) -- 0:00:45
344500 -- (-963.155) (-961.938) (-966.462) [-962.618] * (-961.976) (-959.045) (-961.895) [-959.650] -- 0:00:45
345000 -- (-960.375) (-963.568) (-961.351) [-960.182] * (-962.847) (-961.221) [-961.533] (-960.566) -- 0:00:45
Average standard deviation of split frequencies: 0.010419
345500 -- (-963.633) [-959.972] (-963.030) (-963.936) * (-961.564) (-963.707) (-963.733) [-963.862] -- 0:00:45
346000 -- (-961.872) [-959.545] (-960.844) (-963.226) * (-961.467) (-961.898) (-963.788) [-962.246] -- 0:00:45
346500 -- (-963.795) [-962.804] (-963.358) (-965.117) * [-961.882] (-967.074) (-965.493) (-961.187) -- 0:00:45
347000 -- (-962.243) (-962.097) (-962.182) [-959.984] * (-965.342) (-963.258) [-965.996] (-963.901) -- 0:00:45
347500 -- (-962.823) [-960.307] (-960.775) (-962.373) * (-963.663) (-966.637) [-966.756] (-963.059) -- 0:00:45
348000 -- (-964.213) (-962.275) (-963.818) [-961.871] * (-964.970) (-960.083) (-968.419) [-963.214] -- 0:00:44
348500 -- (-961.061) (-969.479) [-959.724] (-961.926) * (-961.822) (-964.081) [-961.932] (-962.395) -- 0:00:44
349000 -- [-960.647] (-966.643) (-959.501) (-961.041) * (-962.833) [-962.176] (-967.453) (-961.132) -- 0:00:44
349500 -- (-960.902) (-962.375) (-961.442) [-960.605] * (-966.543) (-962.803) (-961.243) [-962.862] -- 0:00:44
350000 -- (-961.197) (-961.460) [-960.894] (-964.874) * [-962.178] (-961.162) (-961.163) (-959.861) -- 0:00:44
Average standard deviation of split frequencies: 0.010670
350500 -- (-961.092) [-958.359] (-958.980) (-963.625) * (-965.439) (-962.937) [-963.917] (-960.430) -- 0:00:44
351000 -- (-960.513) [-960.494] (-960.378) (-961.311) * (-960.185) (-965.503) [-963.334] (-963.655) -- 0:00:44
351500 -- (-962.463) (-962.850) (-961.372) [-961.243] * [-963.157] (-960.896) (-960.771) (-964.540) -- 0:00:44
352000 -- (-961.996) [-959.776] (-962.345) (-965.034) * [-960.931] (-961.774) (-959.875) (-965.595) -- 0:00:44
352500 -- [-961.919] (-963.741) (-964.203) (-964.202) * (-961.674) [-961.110] (-962.908) (-962.966) -- 0:00:44
353000 -- (-961.950) [-962.958] (-961.362) (-960.131) * (-961.990) [-961.262] (-962.820) (-962.238) -- 0:00:43
353500 -- (-963.878) (-961.866) (-960.720) [-962.388] * (-966.563) (-962.856) [-961.178] (-962.951) -- 0:00:43
354000 -- [-960.703] (-962.150) (-960.437) (-961.840) * (-967.467) (-962.791) (-961.285) [-958.999] -- 0:00:43
354500 -- (-964.985) (-962.997) [-959.980] (-964.220) * (-966.642) (-963.455) [-962.063] (-964.935) -- 0:00:43
355000 -- [-962.804] (-963.836) (-961.981) (-966.464) * (-967.189) (-962.982) [-960.417] (-962.393) -- 0:00:43
Average standard deviation of split frequencies: 0.010152
355500 -- (-963.307) (-964.244) [-961.582] (-965.091) * (-961.397) (-961.061) (-962.127) [-964.535] -- 0:00:43
356000 -- [-961.269] (-963.715) (-961.856) (-962.772) * [-962.526] (-962.037) (-962.194) (-961.324) -- 0:00:43
356500 -- (-961.498) (-961.575) (-960.622) [-959.686] * [-959.879] (-965.907) (-961.763) (-960.898) -- 0:00:43
357000 -- (-964.184) [-963.520] (-962.533) (-961.824) * [-961.864] (-966.532) (-960.845) (-963.139) -- 0:00:43
357500 -- [-962.644] (-960.947) (-964.438) (-960.031) * (-964.465) [-961.205] (-964.795) (-961.361) -- 0:00:43
358000 -- (-961.857) [-959.984] (-962.395) (-965.912) * [-960.830] (-962.235) (-961.657) (-962.788) -- 0:00:44
358500 -- (-961.456) [-962.918] (-961.397) (-963.528) * (-968.190) [-962.132] (-963.353) (-962.291) -- 0:00:44
359000 -- (-963.487) (-963.713) [-959.651] (-964.374) * (-964.294) (-960.703) (-959.874) [-963.847] -- 0:00:44
359500 -- (-963.467) (-960.605) (-962.756) [-963.247] * (-963.393) (-974.265) (-962.174) [-959.921] -- 0:00:44
360000 -- (-961.832) [-963.352] (-964.496) (-960.656) * [-958.785] (-969.025) (-963.277) (-958.838) -- 0:00:44
Average standard deviation of split frequencies: 0.010282
360500 -- [-960.929] (-961.518) (-966.666) (-964.157) * (-959.658) (-963.269) (-961.793) [-958.806] -- 0:00:44
361000 -- (-961.546) (-963.204) [-959.267] (-961.100) * (-961.366) (-966.726) [-962.986] (-961.356) -- 0:00:44
361500 -- [-964.130] (-963.329) (-963.434) (-961.452) * [-963.411] (-964.513) (-967.684) (-958.699) -- 0:00:44
362000 -- (-962.207) (-962.289) [-958.708] (-962.016) * (-962.704) (-961.355) (-962.979) [-963.815] -- 0:00:44
362500 -- (-966.045) (-963.601) [-962.558] (-960.566) * [-965.428] (-963.572) (-965.003) (-962.440) -- 0:00:43
363000 -- (-963.728) [-960.222] (-959.793) (-962.565) * [-962.409] (-960.760) (-963.095) (-965.051) -- 0:00:43
363500 -- (-961.888) [-961.391] (-960.459) (-960.961) * (-965.388) [-965.184] (-963.185) (-963.151) -- 0:00:43
364000 -- (-968.148) (-962.684) [-961.324] (-962.505) * (-963.999) (-965.539) (-964.068) [-960.579] -- 0:00:43
364500 -- (-964.224) (-963.475) (-958.213) [-964.818] * (-964.588) (-960.658) (-962.662) [-962.115] -- 0:00:43
365000 -- (-961.460) (-964.102) [-959.527] (-962.107) * (-962.270) [-962.181] (-964.714) (-960.916) -- 0:00:43
Average standard deviation of split frequencies: 0.009740
365500 -- [-960.682] (-965.918) (-963.386) (-964.526) * (-965.873) [-962.642] (-969.905) (-962.923) -- 0:00:43
366000 -- (-964.235) (-964.248) [-960.438] (-963.495) * (-972.084) (-963.996) (-964.779) [-964.902] -- 0:00:43
366500 -- (-964.177) [-960.820] (-960.313) (-962.665) * (-969.114) (-963.081) [-964.097] (-964.581) -- 0:00:43
367000 -- (-962.505) (-965.058) (-961.204) [-964.452] * (-960.911) (-960.702) (-964.773) [-963.180] -- 0:00:43
367500 -- (-961.394) [-960.593] (-961.256) (-961.619) * (-959.961) [-960.961] (-963.004) (-959.506) -- 0:00:43
368000 -- (-962.234) [-959.728] (-963.360) (-962.682) * (-960.457) (-964.877) (-964.821) [-962.762] -- 0:00:42
368500 -- (-960.873) [-959.693] (-959.887) (-962.237) * (-962.461) (-961.625) (-970.005) [-961.806] -- 0:00:42
369000 -- (-963.532) (-960.226) (-960.433) [-961.479] * (-965.022) (-960.254) (-961.888) [-963.349] -- 0:00:42
369500 -- (-962.076) (-960.930) [-962.673] (-960.948) * [-962.203] (-959.665) (-962.628) (-963.790) -- 0:00:42
370000 -- (-964.510) [-960.680] (-960.205) (-960.448) * [-959.483] (-968.932) (-962.154) (-963.419) -- 0:00:42
Average standard deviation of split frequencies: 0.009379
370500 -- (-968.129) [-962.924] (-963.343) (-961.209) * [-961.122] (-963.193) (-963.263) (-965.148) -- 0:00:42
371000 -- [-966.893] (-961.177) (-965.581) (-961.775) * (-963.085) [-959.697] (-964.197) (-965.897) -- 0:00:42
371500 -- (-965.233) [-961.402] (-961.705) (-960.152) * (-965.151) (-959.614) (-963.388) [-960.034] -- 0:00:42
372000 -- (-965.103) (-962.396) (-962.656) [-964.857] * (-961.235) [-961.913] (-964.107) (-961.743) -- 0:00:42
372500 -- (-964.526) [-962.858] (-959.404) (-963.273) * (-961.243) (-960.750) (-965.266) [-960.138] -- 0:00:42
373000 -- (-962.507) [-963.202] (-960.047) (-960.567) * (-962.003) (-959.987) [-962.695] (-961.695) -- 0:00:42
373500 -- (-961.460) (-961.866) [-959.221] (-962.621) * (-963.120) (-960.473) (-962.365) [-960.449] -- 0:00:43
374000 -- [-960.726] (-964.104) (-961.863) (-961.986) * (-964.510) (-960.902) (-962.321) [-962.676] -- 0:00:43
374500 -- [-961.006] (-962.369) (-964.757) (-960.439) * [-965.626] (-961.142) (-962.474) (-960.154) -- 0:00:43
375000 -- [-962.173] (-961.780) (-962.263) (-960.729) * (-964.502) [-962.221] (-962.816) (-962.068) -- 0:00:43
Average standard deviation of split frequencies: 0.010113
375500 -- (-959.833) (-960.111) (-961.071) [-961.529] * (-967.500) [-960.070] (-966.463) (-962.514) -- 0:00:43
376000 -- (-962.781) [-960.406] (-964.502) (-964.295) * [-962.454] (-961.607) (-963.975) (-966.114) -- 0:00:43
376500 -- (-959.155) (-961.203) [-961.880] (-962.895) * [-960.532] (-961.968) (-962.690) (-964.283) -- 0:00:43
377000 -- [-960.739] (-961.316) (-967.690) (-965.502) * (-961.913) [-959.175] (-962.760) (-962.766) -- 0:00:42
377500 -- (-967.996) (-966.410) (-962.423) [-960.874] * (-960.021) (-960.341) [-961.066] (-963.412) -- 0:00:42
378000 -- [-960.845] (-967.182) (-961.896) (-961.458) * [-962.739] (-964.776) (-965.994) (-960.077) -- 0:00:42
378500 -- (-963.881) (-969.538) [-960.563] (-962.039) * [-960.752] (-963.255) (-963.592) (-963.674) -- 0:00:42
379000 -- (-961.385) (-965.262) (-963.404) [-963.457] * (-961.402) (-963.937) [-962.240] (-962.388) -- 0:00:42
379500 -- (-961.149) (-964.622) (-963.692) [-962.576] * [-960.244] (-964.918) (-964.884) (-962.967) -- 0:00:42
380000 -- [-961.338] (-963.046) (-961.401) (-968.073) * (-963.938) [-959.940] (-964.449) (-965.072) -- 0:00:42
Average standard deviation of split frequencies: 0.010485
380500 -- (-963.993) [-962.639] (-961.350) (-960.714) * (-963.116) [-960.140] (-964.323) (-962.606) -- 0:00:42
381000 -- [-962.183] (-963.265) (-962.366) (-962.599) * (-965.729) (-960.321) [-962.040] (-960.238) -- 0:00:42
381500 -- (-966.144) (-960.949) [-962.524] (-962.831) * (-961.741) (-962.784) (-966.490) [-960.930] -- 0:00:42
382000 -- [-966.596] (-961.948) (-958.734) (-962.235) * (-962.778) [-961.772] (-960.860) (-961.806) -- 0:00:42
382500 -- (-965.133) (-960.926) [-959.537] (-964.468) * (-960.333) (-961.049) [-959.805] (-961.604) -- 0:00:41
383000 -- (-966.137) [-965.539] (-958.788) (-965.135) * (-962.785) (-961.377) (-962.490) [-962.166] -- 0:00:41
383500 -- (-961.563) (-961.722) (-960.200) [-960.079] * [-962.654] (-961.535) (-960.287) (-963.724) -- 0:00:41
384000 -- (-961.672) (-962.556) (-965.281) [-961.522] * (-962.813) (-960.650) [-959.208] (-963.807) -- 0:00:41
384500 -- (-962.584) (-962.577) [-959.934] (-961.695) * (-960.163) (-961.829) [-959.588] (-963.262) -- 0:00:41
385000 -- (-961.241) (-960.005) (-965.187) [-962.765] * (-964.894) (-959.238) (-960.383) [-960.404] -- 0:00:41
Average standard deviation of split frequencies: 0.009236
385500 -- (-961.490) [-960.391] (-962.792) (-966.203) * [-966.215] (-963.366) (-961.120) (-965.781) -- 0:00:41
386000 -- (-963.140) (-961.815) [-961.685] (-967.688) * (-962.463) [-961.529] (-964.227) (-968.526) -- 0:00:41
386500 -- (-963.137) (-968.715) [-961.525] (-966.631) * (-963.425) (-960.330) [-966.449] (-963.281) -- 0:00:41
387000 -- (-962.290) (-965.111) [-960.274] (-964.665) * [-961.241] (-958.724) (-965.988) (-960.875) -- 0:00:41
387500 -- [-963.490] (-963.010) (-965.197) (-963.935) * (-964.543) [-961.215] (-961.507) (-961.479) -- 0:00:41
388000 -- (-960.914) (-964.123) (-962.115) [-964.043] * (-961.100) (-959.964) (-961.948) [-964.918] -- 0:00:41
388500 -- (-962.898) (-965.239) (-964.473) [-964.134] * (-963.573) (-960.043) [-961.400] (-967.035) -- 0:00:42
389000 -- (-963.091) (-965.661) [-966.194] (-962.429) * [-964.611] (-970.047) (-966.866) (-966.383) -- 0:00:42
389500 -- (-966.628) (-963.745) (-965.357) [-959.337] * (-969.864) (-968.532) [-962.172] (-968.148) -- 0:00:42
390000 -- (-965.985) [-960.790] (-962.908) (-968.305) * (-964.097) (-960.494) [-961.191] (-970.522) -- 0:00:42
Average standard deviation of split frequencies: 0.008522
390500 -- (-965.007) (-959.833) (-959.084) [-962.424] * (-967.957) (-962.593) (-964.944) [-963.640] -- 0:00:42
391000 -- (-960.907) [-960.382] (-960.763) (-961.307) * (-966.825) [-963.705] (-962.090) (-963.786) -- 0:00:42
391500 -- (-960.401) [-965.103] (-960.198) (-961.290) * (-960.119) (-962.111) (-960.008) [-966.173] -- 0:00:41
392000 -- (-962.991) (-963.391) (-959.829) [-959.804] * (-962.121) (-962.197) [-959.446] (-964.971) -- 0:00:41
392500 -- (-963.987) (-962.106) (-961.761) [-964.541] * (-960.697) [-959.655] (-960.794) (-967.208) -- 0:00:41
393000 -- (-960.933) [-962.119] (-963.611) (-964.416) * (-963.789) (-961.845) [-960.021] (-963.993) -- 0:00:41
393500 -- (-962.552) (-962.417) [-961.421] (-966.120) * (-963.783) (-960.488) [-961.169] (-963.384) -- 0:00:41
394000 -- (-961.110) [-963.785] (-961.920) (-962.760) * [-959.762] (-960.666) (-963.045) (-963.803) -- 0:00:41
394500 -- (-960.758) (-963.514) (-962.199) [-962.137] * (-961.773) (-958.552) (-960.759) [-960.197] -- 0:00:41
395000 -- (-962.649) (-973.356) [-962.451] (-963.640) * (-963.943) (-960.922) [-964.303] (-960.586) -- 0:00:41
Average standard deviation of split frequencies: 0.008110
395500 -- (-963.430) (-967.731) (-965.747) [-959.402] * [-958.674] (-960.007) (-963.931) (-963.442) -- 0:00:41
396000 -- (-961.563) (-965.075) (-963.264) [-958.873] * [-961.153] (-959.862) (-963.661) (-965.125) -- 0:00:41
396500 -- (-960.831) (-966.829) (-961.077) [-961.636] * [-960.634] (-961.830) (-962.384) (-967.150) -- 0:00:41
397000 -- (-963.049) (-968.261) (-960.857) [-962.065] * (-964.338) (-963.694) (-961.840) [-965.532] -- 0:00:41
397500 -- (-961.125) (-966.735) (-963.978) [-961.565] * (-961.805) [-959.280] (-961.599) (-962.384) -- 0:00:40
398000 -- (-964.215) (-962.370) [-959.883] (-964.200) * (-964.032) [-959.460] (-963.850) (-967.796) -- 0:00:40
398500 -- (-961.502) (-961.734) (-962.550) [-965.537] * (-967.077) [-959.228] (-960.194) (-967.839) -- 0:00:40
399000 -- (-962.653) [-961.606] (-964.310) (-966.790) * (-972.085) [-962.723] (-963.847) (-969.115) -- 0:00:40
399500 -- [-960.073] (-964.522) (-960.818) (-961.665) * (-964.618) (-962.652) [-961.820] (-966.591) -- 0:00:40
400000 -- [-963.148] (-965.172) (-960.544) (-959.228) * (-961.956) (-960.636) (-963.196) [-963.522] -- 0:00:40
Average standard deviation of split frequencies: 0.008383
400500 -- [-960.758] (-961.503) (-962.356) (-961.914) * (-968.514) [-960.530] (-962.355) (-967.785) -- 0:00:40
401000 -- (-960.824) [-962.453] (-962.467) (-959.624) * (-966.434) (-960.528) (-963.240) [-965.396] -- 0:00:40
401500 -- (-961.542) [-966.607] (-960.759) (-963.894) * [-962.356] (-962.739) (-961.630) (-964.928) -- 0:00:40
402000 -- [-959.157] (-960.907) (-960.265) (-960.941) * [-959.995] (-965.183) (-963.021) (-967.073) -- 0:00:40
402500 -- [-959.134] (-967.297) (-961.436) (-960.133) * (-962.202) (-963.995) [-963.362] (-964.518) -- 0:00:40
403000 -- (-961.877) (-963.418) [-961.258] (-964.252) * (-960.749) [-963.102] (-960.164) (-960.424) -- 0:00:39
403500 -- (-959.123) (-965.399) [-960.648] (-962.807) * (-960.318) [-962.187] (-961.605) (-962.424) -- 0:00:41
404000 -- (-962.781) [-960.783] (-959.074) (-960.092) * [-961.812] (-966.456) (-959.239) (-959.902) -- 0:00:41
404500 -- [-960.510] (-963.433) (-963.314) (-960.928) * (-959.993) [-960.409] (-961.368) (-962.311) -- 0:00:41
405000 -- (-961.393) (-961.441) (-959.853) [-961.029] * [-961.252] (-962.231) (-960.880) (-961.201) -- 0:00:41
Average standard deviation of split frequencies: 0.008742
405500 -- [-961.836] (-963.725) (-960.566) (-966.508) * (-960.074) (-963.208) [-960.110] (-961.761) -- 0:00:41
406000 -- (-964.259) [-961.733] (-960.098) (-966.873) * [-959.311] (-962.385) (-962.361) (-965.138) -- 0:00:40
406500 -- (-961.282) [-961.677] (-961.473) (-963.038) * (-961.075) (-962.792) [-962.908] (-960.928) -- 0:00:40
407000 -- (-962.978) [-960.445] (-963.681) (-965.408) * [-961.511] (-966.872) (-963.212) (-961.422) -- 0:00:40
407500 -- (-967.503) [-961.436] (-961.005) (-961.014) * (-961.014) (-963.765) [-966.108] (-959.781) -- 0:00:40
408000 -- (-960.728) (-958.293) (-961.696) [-961.895] * (-961.701) (-963.912) (-960.892) [-960.602] -- 0:00:40
408500 -- [-961.588] (-959.080) (-960.661) (-961.412) * (-959.763) [-961.177] (-960.549) (-963.260) -- 0:00:40
409000 -- [-959.595] (-963.938) (-961.160) (-960.134) * (-961.715) (-960.863) (-960.455) [-961.264] -- 0:00:40
409500 -- (-962.419) (-961.386) [-961.863] (-961.332) * (-963.392) (-960.286) [-961.508] (-960.729) -- 0:00:40
410000 -- (-962.049) [-961.826] (-961.169) (-961.942) * (-959.823) [-961.041] (-962.680) (-960.292) -- 0:00:40
Average standard deviation of split frequencies: 0.008538
410500 -- (-960.741) (-961.805) (-963.283) [-960.191] * (-962.915) (-963.398) [-964.945] (-961.264) -- 0:00:40
411000 -- (-965.439) (-968.091) (-962.810) [-962.447] * (-958.082) (-959.198) (-961.458) [-962.207] -- 0:00:40
411500 -- (-958.689) (-964.420) (-964.862) [-960.304] * (-959.841) [-959.429] (-961.296) (-963.842) -- 0:00:40
412000 -- (-960.864) (-963.329) (-961.226) [-963.241] * (-962.446) (-962.290) [-960.510] (-963.732) -- 0:00:39
412500 -- (-962.152) [-962.148] (-962.319) (-962.849) * (-964.639) (-963.751) (-963.062) [-965.324] -- 0:00:39
413000 -- [-962.234] (-961.814) (-964.615) (-960.914) * [-960.693] (-960.181) (-963.424) (-961.627) -- 0:00:39
413500 -- (-962.055) (-961.263) [-963.662] (-963.991) * (-962.144) (-964.863) (-961.498) [-964.797] -- 0:00:39
414000 -- (-961.159) (-962.927) (-962.686) [-961.231] * (-960.631) (-963.277) [-960.477] (-962.938) -- 0:00:39
414500 -- (-959.763) (-962.894) (-963.242) [-960.935] * (-960.753) [-960.508] (-966.035) (-964.444) -- 0:00:39
415000 -- (-960.645) [-962.090] (-962.815) (-964.052) * (-963.686) (-961.121) (-964.701) [-961.503] -- 0:00:39
Average standard deviation of split frequencies: 0.008865
415500 -- [-966.405] (-962.867) (-962.556) (-963.792) * (-960.118) (-961.636) (-964.241) [-963.833] -- 0:00:39
416000 -- [-962.144] (-960.598) (-965.040) (-959.591) * (-962.706) [-962.763] (-966.337) (-961.877) -- 0:00:39
416500 -- (-964.360) (-961.052) [-965.494] (-958.289) * (-963.483) (-966.175) [-959.605] (-961.079) -- 0:00:39
417000 -- [-960.758] (-966.405) (-962.509) (-959.253) * [-961.962] (-964.861) (-965.548) (-959.794) -- 0:00:39
417500 -- (-962.295) (-961.810) [-961.908] (-962.191) * [-962.392] (-963.277) (-962.789) (-964.241) -- 0:00:40
418000 -- (-962.794) (-960.127) [-961.243] (-963.533) * [-961.749] (-965.299) (-963.095) (-963.210) -- 0:00:40
418500 -- [-961.695] (-959.272) (-961.650) (-965.450) * (-960.453) (-964.782) [-959.773] (-963.463) -- 0:00:40
419000 -- (-963.105) (-963.060) (-963.558) [-960.187] * [-961.674] (-968.283) (-961.397) (-964.746) -- 0:00:40
419500 -- (-961.870) (-959.956) (-960.946) [-962.898] * [-958.769] (-963.906) (-960.268) (-962.737) -- 0:00:40
420000 -- (-961.700) (-963.762) [-965.977] (-964.086) * [-963.103] (-960.542) (-959.798) (-963.415) -- 0:00:40
Average standard deviation of split frequencies: 0.008240
420500 -- [-960.580] (-965.236) (-965.561) (-965.463) * (-963.889) (-964.617) [-962.116] (-960.762) -- 0:00:39
421000 -- [-961.700] (-961.739) (-963.786) (-963.671) * (-969.954) (-960.973) [-962.831] (-961.652) -- 0:00:39
421500 -- (-965.377) (-960.341) [-962.594] (-963.458) * [-960.734] (-963.986) (-962.357) (-960.696) -- 0:00:39
422000 -- (-959.797) (-958.493) (-965.320) [-967.652] * [-963.477] (-966.990) (-960.615) (-962.520) -- 0:00:39
422500 -- (-964.247) (-960.645) (-966.125) [-963.649] * (-963.756) [-960.269] (-961.624) (-962.862) -- 0:00:39
423000 -- (-961.948) (-959.264) (-962.958) [-961.928] * (-961.443) (-960.441) [-961.124] (-966.133) -- 0:00:39
423500 -- (-964.633) (-959.652) [-962.138] (-959.598) * (-960.764) (-960.408) [-960.040] (-962.838) -- 0:00:39
424000 -- (-960.745) [-959.235] (-962.660) (-963.087) * (-962.806) (-961.883) (-964.857) [-959.980] -- 0:00:39
424500 -- (-964.647) (-960.534) (-963.424) [-962.879] * (-964.970) (-962.186) (-964.326) [-959.412] -- 0:00:39
425000 -- (-962.171) (-962.753) (-962.910) [-961.782] * (-961.275) (-960.122) [-961.047] (-962.433) -- 0:00:39
Average standard deviation of split frequencies: 0.008137
425500 -- [-962.580] (-960.024) (-961.917) (-965.660) * (-962.289) (-962.457) (-960.185) [-960.980] -- 0:00:39
426000 -- [-960.962] (-960.725) (-962.453) (-962.470) * (-962.869) (-961.987) [-958.903] (-965.075) -- 0:00:39
426500 -- (-966.108) (-962.930) [-961.867] (-962.347) * (-958.187) (-962.138) [-961.482] (-964.930) -- 0:00:38
427000 -- (-968.086) (-960.349) [-960.553] (-963.641) * [-958.108] (-962.155) (-959.970) (-963.331) -- 0:00:38
427500 -- (-963.463) (-961.590) (-962.791) [-961.966] * (-961.387) (-965.631) [-958.663] (-966.544) -- 0:00:38
428000 -- (-963.276) (-961.124) (-960.734) [-959.553] * [-958.970] (-963.195) (-963.899) (-962.478) -- 0:00:38
428500 -- [-962.276] (-959.640) (-970.858) (-960.197) * [-959.774] (-960.590) (-965.717) (-964.578) -- 0:00:38
429000 -- (-961.759) (-959.645) (-964.464) [-959.416] * (-964.635) (-961.014) [-962.195] (-962.852) -- 0:00:38
429500 -- (-962.664) [-963.226] (-967.679) (-962.311) * [-962.047] (-962.268) (-962.029) (-962.258) -- 0:00:38
430000 -- (-963.556) (-964.934) [-964.490] (-963.996) * (-959.984) (-965.005) (-963.185) [-965.528] -- 0:00:38
Average standard deviation of split frequencies: 0.008628
430500 -- (-965.242) (-966.199) (-962.648) [-964.414] * (-961.485) (-964.288) [-961.985] (-962.392) -- 0:00:38
431000 -- (-968.444) [-962.986] (-962.311) (-959.744) * (-963.571) (-961.633) [-963.655] (-964.731) -- 0:00:38
431500 -- (-968.391) [-960.030] (-961.520) (-959.444) * (-964.756) (-966.492) [-963.647] (-963.973) -- 0:00:38
432000 -- (-961.229) [-961.627] (-963.438) (-962.026) * (-960.459) (-964.346) [-963.911] (-967.333) -- 0:00:39
432500 -- (-961.017) (-961.266) [-961.211] (-965.304) * (-960.009) (-962.223) [-961.875] (-962.608) -- 0:00:39
433000 -- (-960.966) (-958.940) [-961.991] (-960.444) * (-965.774) [-963.428] (-961.760) (-964.687) -- 0:00:39
433500 -- (-960.560) (-960.010) (-961.999) [-960.537] * (-960.113) (-961.069) (-962.546) [-961.082] -- 0:00:39
434000 -- [-960.965] (-963.810) (-961.521) (-961.841) * (-961.059) [-961.804] (-962.159) (-961.112) -- 0:00:39
434500 -- [-962.342] (-962.940) (-960.255) (-961.606) * [-961.176] (-963.866) (-957.707) (-962.527) -- 0:00:39
435000 -- (-964.036) [-961.246] (-963.305) (-959.725) * [-961.481] (-963.755) (-961.036) (-962.830) -- 0:00:38
Average standard deviation of split frequencies: 0.009286
435500 -- (-963.982) (-959.181) (-964.436) [-960.045] * (-962.390) (-960.380) [-961.647] (-960.955) -- 0:00:38
436000 -- (-966.190) [-962.827] (-961.393) (-966.461) * [-960.175] (-962.396) (-966.377) (-962.137) -- 0:00:38
436500 -- (-965.460) (-960.656) (-960.741) [-959.613] * (-961.628) (-960.692) (-964.456) [-962.086] -- 0:00:38
437000 -- (-962.572) (-966.464) (-961.320) [-960.259] * [-962.080] (-962.326) (-968.017) (-962.067) -- 0:00:38
437500 -- [-963.128] (-961.762) (-966.604) (-961.505) * (-965.342) (-961.543) (-970.186) [-961.916] -- 0:00:38
438000 -- (-964.394) (-960.410) (-965.871) [-964.154] * (-962.675) (-963.651) (-963.905) [-963.823] -- 0:00:38
438500 -- (-965.049) [-961.524] (-961.702) (-961.072) * [-964.281] (-962.848) (-962.949) (-961.392) -- 0:00:38
439000 -- [-961.505] (-964.361) (-964.460) (-963.545) * [-960.522] (-964.614) (-960.751) (-964.097) -- 0:00:38
439500 -- (-964.559) [-964.325] (-965.397) (-962.994) * (-961.163) (-958.612) (-961.653) [-960.702] -- 0:00:38
440000 -- (-962.791) (-962.077) (-962.295) [-959.627] * (-958.365) [-963.301] (-962.620) (-961.495) -- 0:00:38
Average standard deviation of split frequencies: 0.008558
440500 -- (-961.481) [-960.334] (-964.329) (-961.294) * [-958.881] (-967.547) (-962.772) (-962.093) -- 0:00:38
441000 -- (-959.063) (-961.517) (-965.993) [-958.894] * [-959.648] (-964.067) (-963.890) (-963.678) -- 0:00:38
441500 -- (-960.904) [-961.522] (-970.414) (-962.102) * [-962.449] (-965.171) (-963.014) (-961.477) -- 0:00:37
442000 -- (-963.468) [-961.963] (-962.162) (-961.377) * (-966.687) (-959.881) (-961.787) [-961.496] -- 0:00:37
442500 -- [-963.012] (-962.156) (-963.953) (-960.942) * (-965.507) (-958.856) [-959.618] (-961.425) -- 0:00:37
443000 -- (-960.182) (-962.172) (-963.328) [-961.025] * (-963.171) (-958.334) (-960.420) [-962.994] -- 0:00:37
443500 -- (-962.969) [-961.870] (-962.331) (-961.977) * (-962.283) [-961.854] (-962.003) (-965.513) -- 0:00:37
444000 -- (-963.720) [-962.210] (-960.890) (-963.414) * (-966.141) [-958.935] (-960.128) (-962.349) -- 0:00:37
444500 -- (-962.655) (-964.272) [-962.451] (-961.814) * (-965.461) [-961.662] (-961.846) (-963.094) -- 0:00:37
445000 -- (-960.400) (-962.290) [-959.963] (-960.612) * (-962.707) [-960.974] (-964.069) (-963.301) -- 0:00:37
Average standard deviation of split frequencies: 0.008891
445500 -- [-966.815] (-961.404) (-962.979) (-963.125) * (-964.011) (-962.004) [-962.801] (-963.010) -- 0:00:37
446000 -- (-963.066) (-962.907) (-965.729) [-963.795] * [-963.423] (-961.773) (-960.574) (-961.435) -- 0:00:37
446500 -- [-961.732] (-963.861) (-963.236) (-966.561) * (-960.230) [-961.118] (-960.217) (-961.767) -- 0:00:37
447000 -- (-962.700) (-962.225) (-964.803) [-965.102] * [-961.409] (-961.319) (-962.985) (-963.695) -- 0:00:38
447500 -- (-963.665) [-963.069] (-962.175) (-959.409) * (-964.178) (-959.769) [-962.820] (-962.907) -- 0:00:38
448000 -- [-960.869] (-965.028) (-964.822) (-959.200) * [-960.150] (-963.614) (-960.703) (-962.975) -- 0:00:38
448500 -- (-962.137) (-967.262) [-964.200] (-962.367) * (-962.869) (-962.077) (-961.202) [-962.176] -- 0:00:38
449000 -- (-966.639) (-961.839) (-961.098) [-963.814] * [-960.042] (-965.392) (-964.655) (-966.844) -- 0:00:38
449500 -- (-963.139) (-960.592) [-961.727] (-962.579) * (-959.317) [-960.515] (-959.503) (-961.557) -- 0:00:37
450000 -- [-960.980] (-961.997) (-959.142) (-963.474) * (-960.837) (-962.163) [-962.208] (-962.693) -- 0:00:37
Average standard deviation of split frequencies: 0.009937
450500 -- (-962.690) [-960.695] (-963.378) (-963.203) * [-965.744] (-961.912) (-959.216) (-965.235) -- 0:00:37
451000 -- (-961.969) [-960.122] (-960.924) (-963.796) * [-960.384] (-961.534) (-962.512) (-965.510) -- 0:00:37
451500 -- (-963.173) (-962.131) [-962.104] (-965.600) * (-961.658) [-963.760] (-964.780) (-964.425) -- 0:00:37
452000 -- (-963.693) [-960.116] (-962.858) (-960.859) * [-963.260] (-961.964) (-963.331) (-964.548) -- 0:00:37
452500 -- (-961.338) [-964.614] (-960.871) (-961.275) * (-962.951) (-959.888) (-962.750) [-967.397] -- 0:00:37
453000 -- (-960.369) (-962.224) (-961.607) [-960.660] * (-961.157) [-961.264] (-967.608) (-963.356) -- 0:00:37
453500 -- [-960.690] (-961.618) (-963.017) (-965.002) * (-960.158) [-962.170] (-966.006) (-962.865) -- 0:00:37
454000 -- (-964.336) [-960.620] (-961.409) (-965.681) * [-962.798] (-961.443) (-962.781) (-963.291) -- 0:00:37
454500 -- (-964.220) (-960.941) [-961.694] (-960.920) * (-961.478) (-961.178) [-961.674] (-968.368) -- 0:00:37
455000 -- [-963.941] (-962.744) (-962.809) (-963.016) * (-961.821) (-959.397) [-964.741] (-968.861) -- 0:00:37
Average standard deviation of split frequencies: 0.010015
455500 -- (-965.078) [-960.685] (-959.923) (-963.873) * [-962.192] (-957.818) (-961.432) (-962.886) -- 0:00:37
456000 -- (-968.297) (-961.484) [-959.946] (-962.954) * [-960.899] (-965.293) (-962.205) (-961.678) -- 0:00:36
456500 -- (-960.485) (-961.625) (-960.326) [-960.297] * [-958.976] (-964.503) (-963.890) (-962.734) -- 0:00:36
457000 -- (-961.162) (-959.589) [-960.080] (-963.925) * [-965.593] (-964.046) (-962.149) (-963.014) -- 0:00:36
457500 -- (-960.525) (-961.153) [-964.115] (-963.869) * (-964.803) (-961.510) (-963.343) [-966.535] -- 0:00:36
458000 -- (-966.302) [-960.565] (-963.787) (-962.636) * (-963.720) [-960.661] (-963.645) (-964.723) -- 0:00:36
458500 -- (-966.620) (-963.974) (-964.060) [-961.016] * (-968.241) [-961.434] (-965.963) (-967.516) -- 0:00:36
459000 -- (-964.434) (-962.446) (-962.126) [-962.330] * (-964.177) [-961.982] (-961.762) (-966.109) -- 0:00:36
459500 -- (-961.954) [-961.643] (-966.695) (-964.242) * (-961.567) [-963.383] (-962.365) (-962.960) -- 0:00:36
460000 -- (-962.512) (-964.925) [-961.782] (-963.470) * (-964.110) [-960.464] (-963.564) (-959.499) -- 0:00:36
Average standard deviation of split frequencies: 0.010173
460500 -- [-963.689] (-962.373) (-965.874) (-966.016) * [-962.843] (-967.880) (-965.951) (-965.642) -- 0:00:36
461000 -- (-963.494) [-962.767] (-964.405) (-961.884) * (-961.299) (-963.893) (-961.894) [-962.776] -- 0:00:36
461500 -- (-961.730) (-964.975) [-962.435] (-963.841) * (-960.765) (-962.539) (-963.322) [-960.922] -- 0:00:37
462000 -- [-963.788] (-961.307) (-965.098) (-963.974) * (-963.053) (-960.340) [-961.112] (-960.216) -- 0:00:37
462500 -- (-962.702) [-962.315] (-962.833) (-964.148) * [-961.316] (-964.770) (-962.895) (-962.475) -- 0:00:37
463000 -- (-960.916) [-961.188] (-962.252) (-960.624) * (-961.013) [-961.728] (-964.779) (-959.941) -- 0:00:37
463500 -- [-961.302] (-963.471) (-966.309) (-964.259) * (-961.487) (-960.670) [-966.738] (-965.484) -- 0:00:37
464000 -- (-960.285) (-960.913) [-963.724] (-965.319) * (-963.420) [-959.534] (-963.169) (-964.917) -- 0:00:36
464500 -- [-961.287] (-960.220) (-965.636) (-961.286) * (-965.356) [-962.403] (-966.933) (-963.208) -- 0:00:36
465000 -- [-961.120] (-959.678) (-966.809) (-965.309) * [-961.050] (-960.204) (-963.850) (-961.144) -- 0:00:36
Average standard deviation of split frequencies: 0.010354
465500 -- [-966.204] (-961.061) (-964.442) (-963.946) * (-967.863) (-961.531) (-960.504) [-962.283] -- 0:00:36
466000 -- (-961.855) (-961.399) [-962.143] (-963.063) * [-962.759] (-961.730) (-960.734) (-960.837) -- 0:00:36
466500 -- [-961.541] (-964.450) (-962.171) (-963.219) * (-963.203) (-958.219) [-959.345] (-960.912) -- 0:00:36
467000 -- (-961.992) [-968.257] (-964.692) (-962.132) * (-963.636) (-966.639) [-963.926] (-962.585) -- 0:00:36
467500 -- (-962.470) (-966.468) (-962.425) [-962.752] * (-961.594) [-963.109] (-961.376) (-961.738) -- 0:00:36
468000 -- (-961.753) (-959.116) (-960.259) [-958.831] * (-961.896) (-963.250) [-963.575] (-962.334) -- 0:00:36
468500 -- (-961.178) (-961.340) (-961.217) [-958.814] * (-962.492) (-964.620) [-960.688] (-961.601) -- 0:00:36
469000 -- (-969.099) (-963.345) (-972.407) [-961.889] * [-961.024] (-962.666) (-968.517) (-961.661) -- 0:00:36
469500 -- [-965.332] (-965.217) (-959.573) (-961.452) * (-959.154) [-963.273] (-972.710) (-960.466) -- 0:00:36
470000 -- (-961.424) (-967.670) [-961.444] (-961.419) * (-960.624) (-965.043) (-966.851) [-958.984] -- 0:00:36
Average standard deviation of split frequencies: 0.010391
470500 -- [-964.736] (-966.985) (-961.477) (-960.084) * (-964.532) (-964.249) [-962.329] (-963.131) -- 0:00:36
471000 -- (-965.040) (-965.733) (-959.929) [-960.770] * (-962.646) (-964.672) (-967.334) [-959.914] -- 0:00:35
471500 -- (-963.545) (-962.255) [-960.614] (-964.119) * [-963.946] (-965.939) (-960.371) (-961.484) -- 0:00:35
472000 -- (-960.781) (-961.005) (-961.739) [-961.965] * (-964.479) (-962.294) (-961.934) [-964.284] -- 0:00:35
472500 -- (-962.062) (-964.364) (-959.377) [-961.580] * (-965.460) (-961.060) (-964.489) [-961.856] -- 0:00:35
473000 -- [-963.110] (-964.704) (-960.538) (-964.392) * [-960.519] (-960.371) (-960.899) (-962.865) -- 0:00:35
473500 -- (-963.076) (-964.967) (-963.995) [-961.695] * (-967.157) [-960.855] (-964.509) (-962.076) -- 0:00:35
474000 -- (-963.455) (-964.418) (-961.597) [-961.594] * (-959.663) [-960.444] (-966.048) (-964.289) -- 0:00:35
474500 -- (-963.202) (-960.976) (-963.535) [-963.279] * [-963.334] (-964.273) (-964.464) (-960.994) -- 0:00:35
475000 -- [-963.132] (-960.231) (-963.679) (-964.384) * (-961.281) [-962.490] (-964.544) (-960.734) -- 0:00:35
Average standard deviation of split frequencies: 0.010646
475500 -- (-959.293) [-961.692] (-962.863) (-965.133) * (-964.249) (-965.442) (-965.946) [-960.467] -- 0:00:35
476000 -- (-961.428) (-962.262) [-963.296] (-966.034) * (-963.931) (-969.520) [-964.866] (-959.427) -- 0:00:35
476500 -- (-960.596) (-965.245) [-961.791] (-962.362) * [-962.434] (-965.775) (-963.280) (-963.422) -- 0:00:36
477000 -- (-962.551) (-962.449) (-964.107) [-962.207] * (-962.088) (-964.546) [-961.591] (-963.543) -- 0:00:36
477500 -- (-960.522) (-959.175) (-962.201) [-964.009] * (-962.879) (-962.996) [-960.064] (-963.463) -- 0:00:36
478000 -- (-960.991) (-958.932) (-964.192) [-962.092] * [-960.949] (-963.257) (-963.331) (-965.279) -- 0:00:36
478500 -- (-962.972) [-960.727] (-964.306) (-962.430) * (-963.610) (-961.562) (-964.101) [-962.509] -- 0:00:35
479000 -- (-961.868) [-962.035] (-962.989) (-961.875) * [-964.003] (-970.844) (-965.498) (-962.068) -- 0:00:35
479500 -- (-960.441) (-959.725) (-963.736) [-961.725] * (-962.793) (-966.262) (-962.276) [-961.918] -- 0:00:35
480000 -- (-961.923) [-958.925] (-966.486) (-960.961) * (-960.710) (-960.879) (-962.455) [-963.836] -- 0:00:35
Average standard deviation of split frequencies: 0.010788
480500 -- (-963.550) [-960.993] (-965.689) (-963.605) * (-964.414) (-961.432) (-965.757) [-960.526] -- 0:00:35
481000 -- (-963.194) (-960.997) (-968.257) [-961.079] * (-966.286) (-963.952) (-962.892) [-961.000] -- 0:00:35
481500 -- (-961.140) [-961.912] (-962.410) (-962.788) * (-963.093) (-961.515) (-961.604) [-960.222] -- 0:00:35
482000 -- (-964.088) (-967.894) [-962.708] (-963.531) * (-963.902) (-961.989) (-959.944) [-962.542] -- 0:00:35
482500 -- (-964.821) (-966.347) [-964.928] (-961.218) * (-959.968) [-961.025] (-969.119) (-963.669) -- 0:00:35
483000 -- (-961.914) [-963.292] (-963.294) (-961.015) * [-962.566] (-959.951) (-960.701) (-964.938) -- 0:00:35
483500 -- [-963.113] (-965.175) (-963.024) (-959.467) * (-964.511) [-961.142] (-963.123) (-962.787) -- 0:00:35
484000 -- (-960.765) (-964.294) [-963.749] (-963.070) * (-963.971) (-966.334) [-962.530] (-964.847) -- 0:00:35
484500 -- (-960.035) (-963.066) [-961.347] (-963.111) * (-961.309) (-962.301) (-960.203) [-962.068] -- 0:00:35
485000 -- [-961.589] (-967.578) (-962.795) (-967.237) * [-961.570] (-960.492) (-960.663) (-963.619) -- 0:00:35
Average standard deviation of split frequencies: 0.010185
485500 -- [-963.654] (-962.744) (-963.044) (-962.365) * (-961.362) [-959.861] (-960.746) (-959.762) -- 0:00:34
486000 -- [-960.312] (-964.233) (-964.199) (-962.776) * [-959.549] (-957.554) (-964.659) (-961.474) -- 0:00:34
486500 -- (-961.033) (-961.868) (-961.694) [-959.960] * [-962.161] (-961.710) (-961.471) (-964.158) -- 0:00:34
487000 -- (-961.876) [-964.177] (-960.534) (-962.929) * [-961.461] (-961.578) (-964.833) (-964.034) -- 0:00:34
487500 -- (-959.557) (-962.905) [-960.806] (-960.429) * (-963.359) (-961.169) [-963.969] (-967.037) -- 0:00:34
488000 -- (-963.224) (-969.395) (-963.574) [-964.511] * (-966.827) (-965.135) (-960.989) [-959.220] -- 0:00:34
488500 -- (-959.523) (-965.507) (-962.506) [-962.090] * [-962.670] (-962.719) (-962.451) (-963.081) -- 0:00:34
489000 -- [-960.759] (-966.088) (-964.979) (-964.047) * (-967.682) (-964.530) [-963.411] (-958.843) -- 0:00:34
489500 -- (-961.004) (-964.311) [-964.531] (-965.485) * (-965.653) (-963.407) (-961.951) [-959.224] -- 0:00:34
490000 -- [-960.356] (-963.206) (-962.824) (-960.228) * [-960.494] (-962.842) (-958.895) (-960.606) -- 0:00:34
Average standard deviation of split frequencies: 0.010088
490500 -- (-960.366) [-964.705] (-965.303) (-962.902) * (-961.441) (-962.939) (-961.848) [-961.079] -- 0:00:34
491000 -- (-960.622) [-963.003] (-962.216) (-962.624) * [-964.327] (-961.056) (-964.369) (-962.509) -- 0:00:34
491500 -- [-963.253] (-961.567) (-962.016) (-961.812) * (-962.064) [-963.095] (-960.402) (-963.606) -- 0:00:34
492000 -- (-962.453) (-964.738) [-962.089] (-964.480) * [-962.274] (-959.984) (-958.744) (-962.724) -- 0:00:35
492500 -- [-959.726] (-960.582) (-965.937) (-963.396) * [-961.439] (-960.695) (-958.920) (-964.211) -- 0:00:35
493000 -- (-960.541) (-961.364) (-965.280) [-962.783] * (-960.943) [-960.168] (-962.024) (-961.479) -- 0:00:34
493500 -- (-965.642) (-966.297) [-960.765] (-961.554) * (-960.097) (-959.706) [-960.855] (-960.080) -- 0:00:34
494000 -- (-964.812) (-961.963) [-964.386] (-961.627) * (-962.518) (-960.784) (-962.472) [-958.455] -- 0:00:34
494500 -- (-966.361) [-961.473] (-962.057) (-960.575) * (-960.533) (-963.036) (-962.561) [-959.461] -- 0:00:34
495000 -- (-963.452) (-960.646) (-963.807) [-960.757] * (-961.624) (-960.982) (-966.739) [-960.073] -- 0:00:34
Average standard deviation of split frequencies: 0.010276
495500 -- [-960.849] (-961.573) (-963.734) (-962.833) * [-966.150] (-961.735) (-965.624) (-960.563) -- 0:00:34
496000 -- (-962.427) (-964.164) (-970.415) [-960.318] * [-960.884] (-966.155) (-964.690) (-965.771) -- 0:00:34
496500 -- (-960.283) [-964.742] (-963.799) (-965.675) * (-961.222) [-961.383] (-963.380) (-964.134) -- 0:00:34
497000 -- (-962.935) [-960.836] (-963.817) (-961.919) * (-963.171) (-961.436) (-961.605) [-959.156] -- 0:00:34
497500 -- (-962.037) [-961.247] (-964.290) (-962.919) * [-961.108] (-960.320) (-962.946) (-959.373) -- 0:00:34
498000 -- [-962.053] (-965.063) (-960.805) (-964.549) * [-967.135] (-963.843) (-962.908) (-962.187) -- 0:00:34
498500 -- (-960.434) [-960.253] (-966.346) (-963.701) * (-964.750) (-961.997) (-961.077) [-961.930] -- 0:00:34
499000 -- (-959.292) [-961.523] (-965.303) (-963.084) * [-963.410] (-961.466) (-965.699) (-963.777) -- 0:00:34
499500 -- (-961.081) [-964.977] (-960.982) (-967.399) * (-962.114) [-962.797] (-964.598) (-966.400) -- 0:00:34
500000 -- (-964.173) [-964.832] (-965.668) (-965.199) * (-962.529) (-964.197) (-962.047) [-964.255] -- 0:00:34
Average standard deviation of split frequencies: 0.011181
500500 -- [-963.017] (-965.041) (-960.586) (-961.176) * (-960.678) (-964.672) (-960.123) [-963.297] -- 0:00:33
501000 -- (-962.392) (-960.863) [-963.281] (-959.863) * [-961.531] (-962.851) (-961.085) (-967.747) -- 0:00:33
501500 -- (-962.072) (-958.879) (-959.986) [-962.664] * (-960.407) (-963.014) [-962.833] (-959.530) -- 0:00:33
502000 -- [-962.989] (-967.459) (-965.055) (-965.848) * (-960.712) [-963.541] (-962.112) (-959.417) -- 0:00:33
502500 -- [-959.880] (-963.106) (-965.268) (-967.276) * (-963.219) [-966.706] (-965.037) (-961.695) -- 0:00:33
503000 -- (-960.896) (-961.224) [-967.211] (-966.603) * (-965.652) (-966.130) [-964.712] (-958.884) -- 0:00:33
503500 -- (-962.895) (-964.138) (-963.889) [-962.174] * (-964.329) (-969.965) [-961.167] (-965.270) -- 0:00:33
504000 -- [-960.065] (-960.998) (-962.579) (-966.900) * [-966.834] (-964.129) (-961.949) (-963.734) -- 0:00:33
504500 -- (-961.816) (-960.661) (-962.268) [-963.105] * (-960.708) (-965.179) [-960.638] (-959.284) -- 0:00:33
505000 -- (-961.653) (-959.321) (-965.256) [-962.338] * (-963.224) (-960.102) [-960.175] (-961.737) -- 0:00:33
Average standard deviation of split frequencies: 0.010481
505500 -- (-961.829) (-961.463) [-963.731] (-960.108) * (-967.002) (-962.918) [-962.181] (-960.411) -- 0:00:33
506000 -- (-959.960) [-962.311] (-963.864) (-961.140) * (-960.667) (-964.266) (-962.566) [-961.034] -- 0:00:33
506500 -- [-964.303] (-964.527) (-963.804) (-962.922) * (-961.335) (-961.507) (-963.345) [-958.850] -- 0:00:33
507000 -- [-964.716] (-963.573) (-962.093) (-964.199) * [-959.545] (-965.566) (-961.468) (-960.578) -- 0:00:34
507500 -- [-962.814] (-959.067) (-964.013) (-962.143) * (-960.149) [-962.969] (-959.847) (-962.347) -- 0:00:33
508000 -- (-963.174) [-959.401] (-961.554) (-964.593) * [-961.174] (-961.807) (-959.983) (-962.887) -- 0:00:33
508500 -- (-964.622) (-963.421) (-961.259) [-966.887] * [-960.184] (-965.039) (-963.444) (-968.242) -- 0:00:33
509000 -- (-962.095) (-963.166) [-961.704] (-964.243) * [-960.149] (-964.719) (-960.686) (-965.788) -- 0:00:33
509500 -- (-962.673) (-964.236) [-961.292] (-963.784) * (-965.280) (-969.310) [-961.693] (-964.118) -- 0:00:33
510000 -- (-963.704) (-960.115) [-961.359] (-963.921) * (-962.775) [-960.458] (-962.998) (-965.589) -- 0:00:33
Average standard deviation of split frequencies: 0.009462
510500 -- (-962.585) (-961.708) [-962.702] (-962.833) * (-960.706) [-963.652] (-961.592) (-960.862) -- 0:00:33
511000 -- [-961.738] (-959.831) (-960.320) (-963.962) * (-960.272) [-959.860] (-961.551) (-965.187) -- 0:00:33
511500 -- (-959.571) (-960.755) [-960.941] (-961.043) * (-961.792) [-960.571] (-964.619) (-964.490) -- 0:00:33
512000 -- (-964.822) (-963.794) [-960.258] (-964.035) * (-961.011) (-960.141) [-961.916] (-963.700) -- 0:00:33
512500 -- (-963.773) (-961.355) [-960.668] (-962.118) * [-960.020] (-962.944) (-960.419) (-966.175) -- 0:00:33
513000 -- (-962.593) [-961.014] (-961.264) (-962.548) * [-963.094] (-960.031) (-962.432) (-964.931) -- 0:00:33
513500 -- [-959.800] (-961.819) (-961.660) (-961.640) * [-959.964] (-963.099) (-962.338) (-962.301) -- 0:00:33
514000 -- (-961.703) (-961.629) (-963.021) [-960.078] * (-963.907) [-965.339] (-965.311) (-963.188) -- 0:00:33
514500 -- (-965.997) [-962.768] (-962.225) (-960.077) * [-960.447] (-960.872) (-961.474) (-964.927) -- 0:00:33
515000 -- [-963.249] (-965.214) (-964.336) (-963.584) * (-961.868) (-964.680) [-961.536] (-960.614) -- 0:00:32
Average standard deviation of split frequencies: 0.008907
515500 -- (-963.385) (-964.104) (-966.623) [-966.794] * (-961.322) (-961.135) (-967.032) [-964.353] -- 0:00:32
516000 -- [-963.886] (-963.229) (-967.378) (-960.361) * (-960.847) (-961.871) [-962.080] (-964.933) -- 0:00:32
516500 -- (-960.242) [-962.880] (-965.366) (-963.138) * (-965.494) (-959.939) (-963.095) [-963.718] -- 0:00:32
517000 -- [-959.918] (-966.898) (-961.050) (-963.642) * (-963.876) (-960.866) (-962.500) [-969.415] -- 0:00:32
517500 -- (-961.317) [-967.277] (-962.631) (-963.732) * (-961.675) (-965.056) (-963.507) [-961.890] -- 0:00:32
518000 -- (-960.480) (-965.804) [-961.287] (-962.137) * [-963.628] (-965.753) (-961.148) (-962.207) -- 0:00:32
518500 -- (-961.409) (-961.994) (-963.361) [-962.272] * (-962.123) (-965.078) [-961.841] (-961.631) -- 0:00:32
519000 -- [-962.323] (-961.066) (-959.490) (-961.726) * [-964.527] (-963.315) (-961.616) (-962.028) -- 0:00:32
519500 -- (-962.452) (-961.842) (-961.062) [-961.816] * [-960.465] (-961.178) (-962.693) (-960.918) -- 0:00:32
520000 -- (-968.710) (-961.434) (-959.999) [-961.289] * [-960.420] (-961.902) (-960.712) (-962.050) -- 0:00:32
Average standard deviation of split frequencies: 0.008828
520500 -- (-963.371) (-963.275) (-962.738) [-964.073] * (-962.901) (-961.486) (-959.057) [-959.664] -- 0:00:32
521000 -- [-962.842] (-960.511) (-961.166) (-960.634) * (-959.666) (-962.315) (-960.059) [-961.967] -- 0:00:32
521500 -- (-962.498) (-964.391) (-961.043) [-960.246] * (-960.060) (-966.861) (-961.047) [-961.420] -- 0:00:32
522000 -- (-961.592) (-961.434) (-961.955) [-961.071] * (-961.611) (-961.814) [-961.958] (-970.042) -- 0:00:32
522500 -- (-961.419) (-961.655) (-961.086) [-963.607] * (-961.407) (-963.573) (-962.505) [-964.035] -- 0:00:32
523000 -- [-961.357] (-963.884) (-960.960) (-962.398) * (-961.527) (-963.457) (-960.175) [-961.706] -- 0:00:32
523500 -- [-960.520] (-961.428) (-962.244) (-961.958) * (-961.979) [-960.332] (-963.764) (-965.436) -- 0:00:32
524000 -- (-960.527) [-961.601] (-961.071) (-960.700) * (-960.207) (-962.372) [-966.256] (-964.972) -- 0:00:32
524500 -- (-964.291) (-961.919) (-963.461) [-961.301] * (-959.724) (-961.123) (-964.854) [-963.000] -- 0:00:32
525000 -- (-962.891) (-965.134) (-964.848) [-961.558] * (-960.533) (-961.577) (-964.606) [-963.046] -- 0:00:32
Average standard deviation of split frequencies: 0.008514
525500 -- (-960.339) (-963.612) (-961.033) [-964.412] * (-968.368) (-962.703) [-964.757] (-961.684) -- 0:00:32
526000 -- [-964.052] (-963.454) (-966.128) (-965.855) * (-963.220) [-961.729] (-963.874) (-961.761) -- 0:00:32
526500 -- [-964.305] (-964.272) (-969.503) (-962.688) * (-964.657) [-962.261] (-962.738) (-963.894) -- 0:00:32
527000 -- (-961.878) (-962.436) (-966.188) [-960.134] * [-965.341] (-964.993) (-959.689) (-962.598) -- 0:00:32
527500 -- [-960.635] (-963.593) (-965.781) (-959.892) * (-963.930) [-961.782] (-959.786) (-960.803) -- 0:00:32
528000 -- (-960.895) (-960.542) [-959.447] (-963.392) * (-963.639) (-961.246) [-959.745] (-967.634) -- 0:00:32
528500 -- (-963.809) (-962.106) (-963.465) [-960.517] * [-964.054] (-961.542) (-959.296) (-964.550) -- 0:00:32
529000 -- (-967.303) [-963.717] (-964.692) (-960.342) * [-958.645] (-962.049) (-964.288) (-963.310) -- 0:00:32
529500 -- [-960.503] (-963.195) (-964.692) (-962.690) * [-962.932] (-967.078) (-962.511) (-962.014) -- 0:00:31
530000 -- [-964.108] (-963.940) (-964.180) (-962.818) * (-964.028) (-960.291) [-961.674] (-961.269) -- 0:00:31
Average standard deviation of split frequencies: 0.008106
530500 -- (-959.659) [-960.566] (-966.375) (-961.075) * (-964.402) [-961.143] (-963.874) (-963.627) -- 0:00:31
531000 -- [-960.096] (-962.588) (-964.278) (-959.405) * [-960.205] (-963.808) (-961.419) (-962.645) -- 0:00:31
531500 -- (-963.083) (-961.054) [-960.911] (-963.063) * (-961.649) (-964.007) (-961.324) [-960.416] -- 0:00:31
532000 -- (-963.239) [-961.655] (-965.224) (-963.148) * (-965.294) [-965.539] (-959.234) (-961.789) -- 0:00:31
532500 -- [-965.381] (-966.417) (-966.437) (-961.264) * [-962.123] (-963.188) (-960.168) (-961.463) -- 0:00:31
533000 -- [-957.327] (-963.621) (-963.340) (-962.095) * (-962.288) (-960.080) (-960.127) [-961.656] -- 0:00:31
533500 -- (-960.621) [-963.114] (-961.572) (-965.153) * [-963.862] (-959.734) (-959.172) (-960.489) -- 0:00:31
534000 -- (-962.036) (-963.969) (-960.050) [-961.788] * (-965.358) (-961.695) [-963.921] (-960.948) -- 0:00:31
534500 -- (-963.080) (-969.414) (-963.356) [-961.554] * [-961.722] (-961.859) (-969.183) (-963.353) -- 0:00:31
535000 -- (-963.087) [-964.051] (-961.858) (-964.195) * (-959.464) [-960.400] (-963.665) (-963.666) -- 0:00:31
Average standard deviation of split frequencies: 0.008190
535500 -- (-964.289) (-963.522) [-962.162] (-962.173) * (-960.901) (-963.961) [-959.449] (-968.594) -- 0:00:31
536000 -- (-963.892) (-961.362) [-961.223] (-961.457) * (-962.193) (-961.191) [-961.545] (-963.112) -- 0:00:31
536500 -- [-959.966] (-962.014) (-962.914) (-966.715) * (-966.073) (-963.570) [-960.012] (-963.756) -- 0:00:31
537000 -- (-960.701) [-962.657] (-961.671) (-967.172) * (-962.367) (-964.281) (-961.464) [-962.909] -- 0:00:31
537500 -- (-966.618) (-960.642) (-960.103) [-961.755] * (-961.305) (-963.097) [-962.569] (-960.754) -- 0:00:31
538000 -- (-961.094) (-960.854) (-961.098) [-963.978] * (-962.088) (-963.069) [-960.065] (-963.716) -- 0:00:31
538500 -- (-960.419) (-961.905) [-960.883] (-960.350) * (-966.729) [-961.426] (-966.202) (-961.024) -- 0:00:31
539000 -- (-962.939) [-963.564] (-961.795) (-960.441) * (-964.738) [-962.857] (-961.389) (-962.067) -- 0:00:31
539500 -- (-966.086) (-960.033) (-966.062) [-961.034] * (-966.099) (-963.709) [-960.495] (-961.859) -- 0:00:31
540000 -- [-965.164] (-963.591) (-961.924) (-961.266) * (-964.768) [-962.579] (-961.108) (-964.633) -- 0:00:31
Average standard deviation of split frequencies: 0.007898
540500 -- (-961.695) (-962.458) (-963.237) [-961.753] * (-964.821) (-959.846) [-963.408] (-963.253) -- 0:00:31
541000 -- (-961.332) [-962.876] (-966.604) (-964.565) * [-961.907] (-960.862) (-961.628) (-962.592) -- 0:00:31
541500 -- (-959.983) (-961.995) (-962.478) [-961.727] * [-964.177] (-960.729) (-961.915) (-962.685) -- 0:00:31
542000 -- [-963.201] (-961.815) (-968.746) (-967.737) * [-971.856] (-963.180) (-961.421) (-959.751) -- 0:00:31
542500 -- (-963.110) (-964.842) (-962.480) [-960.528] * (-964.025) [-960.328] (-960.326) (-962.230) -- 0:00:31
543000 -- (-959.264) (-964.858) [-965.396] (-959.320) * (-960.962) [-960.560] (-960.442) (-959.753) -- 0:00:31
543500 -- [-960.317] (-962.964) (-965.921) (-960.806) * (-966.544) (-961.298) [-962.378] (-961.946) -- 0:00:31
544000 -- [-961.080] (-962.642) (-960.954) (-964.127) * (-963.316) (-960.406) (-964.581) [-963.647] -- 0:00:31
544500 -- (-963.727) [-966.337] (-964.273) (-964.529) * (-962.511) [-962.597] (-962.958) (-965.677) -- 0:00:30
545000 -- (-959.231) (-961.987) (-961.828) [-963.318] * [-965.549] (-962.845) (-960.438) (-965.660) -- 0:00:30
Average standard deviation of split frequencies: 0.008227
545500 -- (-962.273) [-962.147] (-962.396) (-961.414) * (-963.473) [-962.480] (-960.552) (-968.294) -- 0:00:30
546000 -- (-964.517) [-959.321] (-961.421) (-962.356) * (-963.448) (-964.368) (-965.746) [-961.664] -- 0:00:30
546500 -- (-961.994) [-963.499] (-964.294) (-963.387) * (-963.381) (-966.236) (-963.068) [-963.359] -- 0:00:30
547000 -- (-960.685) (-965.352) [-963.896] (-963.339) * (-963.984) (-963.542) [-961.180] (-962.190) -- 0:00:30
547500 -- (-960.871) [-962.603] (-963.973) (-960.520) * (-963.037) (-960.416) [-960.494] (-968.548) -- 0:00:30
548000 -- (-959.721) (-960.921) (-961.980) [-964.815] * (-964.515) (-962.271) (-959.717) [-962.494] -- 0:00:30
548500 -- (-961.433) [-962.966] (-963.143) (-963.711) * [-962.376] (-962.269) (-961.835) (-962.380) -- 0:00:30
549000 -- [-962.520] (-963.515) (-963.899) (-966.268) * (-962.889) (-964.657) (-962.512) [-962.714] -- 0:00:30
549500 -- [-962.090] (-962.591) (-969.272) (-963.633) * [-961.239] (-963.360) (-961.931) (-962.127) -- 0:00:30
550000 -- (-964.049) [-962.733] (-967.319) (-964.207) * (-963.948) (-959.357) [-963.403] (-959.296) -- 0:00:30
Average standard deviation of split frequencies: 0.007544
550500 -- (-959.431) [-965.747] (-963.934) (-964.305) * (-963.696) (-962.163) [-963.717] (-966.055) -- 0:00:30
551000 -- [-962.960] (-964.416) (-962.218) (-964.387) * (-964.221) (-964.123) [-964.872] (-963.439) -- 0:00:30
551500 -- (-965.894) [-965.082] (-962.416) (-959.909) * (-965.536) (-970.084) [-960.646] (-967.789) -- 0:00:30
552000 -- (-959.875) (-963.243) (-966.504) [-959.453] * (-962.054) (-961.138) (-965.785) [-962.244] -- 0:00:30
552500 -- (-965.450) [-963.586] (-965.158) (-959.662) * (-961.607) (-961.715) (-962.227) [-963.127] -- 0:00:30
553000 -- (-963.926) (-966.214) [-967.869] (-959.856) * [-965.368] (-966.158) (-963.421) (-965.530) -- 0:00:30
553500 -- (-963.634) (-965.545) (-961.554) [-961.663] * (-963.131) [-960.103] (-960.955) (-962.115) -- 0:00:30
554000 -- (-963.915) (-963.443) (-965.124) [-960.772] * (-966.807) (-959.837) (-965.361) [-961.338] -- 0:00:30
554500 -- (-960.801) [-961.668] (-965.645) (-961.333) * (-961.113) (-960.401) (-964.899) [-963.950] -- 0:00:30
555000 -- (-959.903) (-962.887) [-961.262] (-963.705) * [-961.137] (-961.024) (-962.931) (-960.157) -- 0:00:30
Average standard deviation of split frequencies: 0.007481
555500 -- [-966.333] (-964.758) (-959.772) (-961.068) * (-963.998) [-962.187] (-962.644) (-959.974) -- 0:00:30
556000 -- (-963.939) (-964.320) (-959.412) [-962.649] * (-964.067) (-960.417) (-962.136) [-960.564] -- 0:00:30
556500 -- (-964.544) (-961.355) [-960.244] (-964.987) * (-962.490) (-963.266) [-962.342] (-962.888) -- 0:00:30
557000 -- (-962.614) [-961.324] (-963.382) (-966.868) * (-963.566) (-960.510) [-961.276] (-963.547) -- 0:00:30
557500 -- (-964.048) [-959.673] (-965.237) (-964.333) * [-965.843] (-962.209) (-959.675) (-958.532) -- 0:00:30
558000 -- (-965.687) [-959.668] (-960.428) (-964.825) * [-961.529] (-962.371) (-962.315) (-959.833) -- 0:00:30
558500 -- [-960.743] (-960.505) (-960.571) (-962.939) * (-961.436) (-962.777) (-959.175) [-967.300] -- 0:00:30
559000 -- (-966.472) (-959.428) (-963.380) [-964.635] * [-962.454] (-964.229) (-961.511) (-962.897) -- 0:00:29
559500 -- (-961.907) (-962.514) [-962.757] (-962.097) * [-962.984] (-961.304) (-966.681) (-964.545) -- 0:00:29
560000 -- [-961.449] (-962.157) (-962.404) (-965.477) * (-967.653) [-959.891] (-962.944) (-965.367) -- 0:00:29
Average standard deviation of split frequencies: 0.007468
560500 -- (-965.160) (-963.320) (-962.966) [-963.904] * (-961.803) (-963.619) (-960.693) [-961.568] -- 0:00:29
561000 -- [-963.609] (-963.833) (-963.427) (-960.249) * (-961.011) [-963.433] (-962.877) (-965.971) -- 0:00:29
561500 -- (-962.199) (-963.259) [-960.506] (-960.965) * (-961.097) (-964.160) [-962.829] (-963.329) -- 0:00:29
562000 -- (-963.649) [-962.893] (-960.409) (-964.779) * [-959.780] (-962.781) (-960.604) (-961.004) -- 0:00:29
562500 -- [-962.382] (-964.250) (-960.993) (-965.781) * (-961.954) (-962.128) (-962.851) [-961.855] -- 0:00:29
563000 -- (-961.955) (-963.278) [-963.540] (-959.658) * (-962.658) (-961.273) (-962.085) [-961.521] -- 0:00:29
563500 -- (-964.633) (-960.839) (-960.970) [-963.627] * (-963.187) (-963.638) (-961.304) [-961.865] -- 0:00:29
564000 -- (-968.381) [-961.293] (-960.814) (-961.418) * [-964.412] (-961.911) (-960.665) (-960.882) -- 0:00:29
564500 -- (-961.997) [-961.777] (-960.930) (-965.943) * (-961.889) (-963.613) [-966.093] (-966.669) -- 0:00:29
565000 -- (-965.473) (-962.993) [-961.212] (-962.126) * (-958.609) (-962.111) (-964.872) [-963.203] -- 0:00:29
Average standard deviation of split frequencies: 0.007184
565500 -- (-968.985) (-967.160) [-964.691] (-960.425) * (-960.769) [-963.632] (-963.695) (-965.661) -- 0:00:29
566000 -- (-965.603) (-963.021) (-962.222) [-961.958] * (-964.940) (-965.626) [-963.588] (-966.472) -- 0:00:29
566500 -- (-967.945) (-961.445) [-961.667] (-961.747) * (-961.859) (-962.129) (-959.875) [-963.520] -- 0:00:29
567000 -- (-964.954) [-962.548] (-963.661) (-962.909) * [-961.514] (-964.833) (-961.933) (-964.388) -- 0:00:29
567500 -- [-962.878] (-960.159) (-964.769) (-960.397) * (-960.045) [-961.730] (-962.476) (-962.000) -- 0:00:29
568000 -- [-964.078] (-961.855) (-965.215) (-963.413) * [-963.072] (-958.824) (-964.744) (-965.787) -- 0:00:29
568500 -- (-964.496) (-959.801) [-964.477] (-962.745) * (-961.914) (-964.660) [-959.485] (-962.538) -- 0:00:29
569000 -- (-967.854) (-960.708) [-965.536] (-960.210) * (-962.009) [-964.809] (-964.848) (-965.807) -- 0:00:29
569500 -- (-968.319) (-961.451) (-964.558) [-959.602] * [-962.947] (-961.834) (-962.252) (-960.877) -- 0:00:29
570000 -- (-965.731) (-962.205) [-960.853] (-962.052) * (-961.746) (-961.207) (-961.147) [-960.186] -- 0:00:29
Average standard deviation of split frequencies: 0.007228
570500 -- [-961.675] (-965.570) (-963.991) (-959.497) * [-960.065] (-964.106) (-964.695) (-961.762) -- 0:00:29
571000 -- (-961.402) [-961.401] (-962.332) (-962.899) * [-959.940] (-961.665) (-962.129) (-963.718) -- 0:00:29
571500 -- (-966.244) (-962.433) (-963.598) [-961.082] * [-957.959] (-962.510) (-962.385) (-960.271) -- 0:00:29
572000 -- (-959.738) (-962.546) [-961.181] (-960.190) * (-960.794) (-962.220) (-960.063) [-962.684] -- 0:00:29
572500 -- (-962.145) (-966.555) (-961.596) [-960.903] * (-962.614) (-961.013) (-961.019) [-960.401] -- 0:00:29
573000 -- (-965.265) (-965.732) (-967.545) [-960.071] * [-963.355] (-962.254) (-961.087) (-965.690) -- 0:00:29
573500 -- [-961.416] (-960.295) (-965.014) (-965.281) * (-961.031) (-961.548) (-962.508) [-960.089] -- 0:00:29
574000 -- [-965.253] (-964.100) (-964.344) (-969.881) * [-958.935] (-969.024) (-966.806) (-962.875) -- 0:00:28
574500 -- (-966.210) [-960.070] (-960.308) (-965.243) * (-958.901) [-963.293] (-964.661) (-964.011) -- 0:00:28
575000 -- (-962.811) (-961.235) (-965.013) [-960.281] * [-960.690] (-958.928) (-963.965) (-965.979) -- 0:00:28
Average standard deviation of split frequencies: 0.006905
575500 -- (-962.811) [-962.305] (-964.879) (-963.799) * [-960.754] (-963.334) (-959.650) (-968.050) -- 0:00:28
576000 -- [-961.902] (-959.513) (-961.342) (-962.716) * (-960.342) [-962.375] (-963.615) (-965.294) -- 0:00:28
576500 -- (-968.950) (-962.801) (-961.551) [-961.303] * (-962.382) (-969.042) (-961.796) [-966.617] -- 0:00:28
577000 -- [-965.918] (-961.690) (-965.451) (-963.674) * (-963.673) (-963.583) (-961.328) [-969.013] -- 0:00:28
577500 -- (-964.164) (-960.353) [-959.657] (-961.843) * (-960.403) (-963.404) [-958.403] (-963.573) -- 0:00:28
578000 -- (-964.108) [-963.162] (-961.743) (-960.117) * (-959.164) [-963.696] (-963.185) (-964.587) -- 0:00:28
578500 -- [-959.390] (-964.746) (-962.052) (-960.424) * [-959.862] (-964.477) (-965.015) (-962.925) -- 0:00:28
579000 -- (-960.413) (-962.803) [-960.827] (-960.119) * (-959.838) (-963.122) (-966.805) [-963.689] -- 0:00:28
579500 -- (-961.463) (-962.952) (-961.971) [-959.690] * (-959.619) (-964.628) (-965.941) [-964.100] -- 0:00:29
580000 -- (-960.065) (-962.351) (-960.697) [-960.933] * (-960.168) [-964.427] (-963.090) (-960.609) -- 0:00:28
Average standard deviation of split frequencies: 0.007256
580500 -- (-961.185) (-961.780) (-962.539) [-963.637] * [-964.216] (-966.092) (-960.585) (-960.751) -- 0:00:28
581000 -- [-963.126] (-959.592) (-962.781) (-960.240) * (-970.491) (-962.020) [-961.189] (-962.620) -- 0:00:28
581500 -- (-960.608) (-962.505) (-960.328) [-959.959] * (-964.172) (-961.996) (-961.481) [-964.998] -- 0:00:28
582000 -- (-965.848) (-963.543) (-961.126) [-963.685] * (-961.607) (-964.968) [-962.808] (-966.134) -- 0:00:28
582500 -- (-963.171) [-962.714] (-965.264) (-966.881) * (-959.270) (-963.732) [-961.106] (-964.612) -- 0:00:28
583000 -- (-962.209) (-960.103) (-965.824) [-961.805] * (-961.076) (-960.484) (-961.538) [-965.336] -- 0:00:28
583500 -- [-960.453] (-962.670) (-961.211) (-963.813) * (-964.605) (-961.405) (-963.772) [-961.273] -- 0:00:28
584000 -- [-962.908] (-961.273) (-961.281) (-966.894) * [-966.480] (-964.303) (-965.200) (-961.896) -- 0:00:28
584500 -- (-962.323) [-961.590] (-960.114) (-964.403) * (-964.049) (-964.786) (-961.701) [-964.153] -- 0:00:28
585000 -- (-960.837) (-959.885) (-961.649) [-958.831] * (-962.963) (-966.733) (-962.457) [-961.935] -- 0:00:28
Average standard deviation of split frequencies: 0.007793
585500 -- [-962.764] (-965.108) (-964.686) (-961.523) * (-962.544) [-964.926] (-960.909) (-964.455) -- 0:00:28
586000 -- (-964.201) [-960.143] (-963.736) (-964.456) * (-962.696) (-965.620) (-961.402) [-962.290] -- 0:00:28
586500 -- (-962.897) (-963.391) [-968.895] (-964.016) * [-962.777] (-962.660) (-962.590) (-965.465) -- 0:00:28
587000 -- (-962.695) (-963.687) [-962.476] (-964.241) * [-959.813] (-965.055) (-962.899) (-960.761) -- 0:00:28
587500 -- (-962.206) (-963.095) (-963.813) [-963.427] * (-961.956) (-965.395) [-959.921] (-961.232) -- 0:00:28
588000 -- (-963.280) (-967.305) [-960.784] (-961.406) * (-966.957) (-963.296) [-959.676] (-962.843) -- 0:00:28
588500 -- (-964.025) (-963.894) (-960.115) [-962.236] * (-970.402) [-963.117] (-964.776) (-961.856) -- 0:00:27
589000 -- (-961.551) [-960.621] (-960.124) (-963.570) * (-966.646) (-964.310) [-959.643] (-965.697) -- 0:00:27
589500 -- (-964.053) (-960.897) [-964.314] (-959.557) * (-961.863) (-960.805) (-963.457) [-962.351] -- 0:00:27
590000 -- [-962.872] (-961.599) (-965.466) (-963.401) * (-962.117) (-965.126) [-960.974] (-962.434) -- 0:00:27
Average standard deviation of split frequencies: 0.007881
590500 -- (-960.713) (-968.369) [-960.803] (-960.269) * (-960.357) [-961.247] (-961.174) (-960.646) -- 0:00:27
591000 -- (-961.753) (-963.644) [-960.125] (-962.472) * (-968.818) [-970.354] (-961.920) (-965.539) -- 0:00:27
591500 -- (-960.473) (-959.717) (-960.143) [-961.132] * [-963.097] (-966.082) (-960.082) (-962.174) -- 0:00:27
592000 -- (-961.191) (-961.521) [-960.601] (-963.667) * (-960.493) (-967.827) [-963.625] (-964.652) -- 0:00:28
592500 -- (-960.346) [-958.693] (-959.138) (-963.969) * (-961.159) (-964.237) (-965.019) [-960.497] -- 0:00:28
593000 -- [-960.413] (-964.174) (-963.414) (-961.768) * (-964.041) [-961.597] (-961.941) (-965.218) -- 0:00:28
593500 -- (-959.958) (-964.321) (-962.695) [-962.247] * [-962.102] (-964.117) (-962.238) (-961.229) -- 0:00:28
594000 -- (-959.311) [-962.670] (-962.529) (-960.883) * (-964.722) [-962.337] (-961.145) (-964.702) -- 0:00:28
594500 -- [-965.105] (-961.567) (-965.667) (-961.574) * (-963.687) (-963.865) (-964.926) [-961.072] -- 0:00:27
595000 -- (-965.848) [-963.830] (-962.382) (-960.661) * (-964.314) (-962.756) [-961.064] (-961.201) -- 0:00:27
Average standard deviation of split frequencies: 0.007712
595500 -- (-964.905) [-960.571] (-961.502) (-960.453) * (-962.865) (-966.078) (-967.414) [-961.564] -- 0:00:27
596000 -- [-962.452] (-960.025) (-961.480) (-962.405) * (-961.533) (-962.720) (-962.684) [-965.398] -- 0:00:27
596500 -- (-964.774) (-960.330) (-962.847) [-961.962] * (-963.952) (-962.889) (-963.947) [-962.772] -- 0:00:27
597000 -- (-963.074) (-967.605) [-960.866] (-964.832) * (-964.986) (-961.180) [-960.879] (-965.928) -- 0:00:27
597500 -- (-963.782) (-960.861) [-959.369] (-963.612) * (-962.859) (-967.578) (-963.031) [-963.687] -- 0:00:27
598000 -- (-960.049) [-959.438] (-963.670) (-962.417) * (-960.711) (-965.680) [-963.725] (-962.112) -- 0:00:27
598500 -- (-966.173) (-963.751) [-960.600] (-961.093) * (-966.435) (-963.340) (-962.253) [-960.915] -- 0:00:27
599000 -- [-966.388] (-962.888) (-962.192) (-961.815) * (-961.815) (-960.458) [-963.176] (-961.820) -- 0:00:27
599500 -- (-962.451) (-958.803) (-961.299) [-963.500] * [-959.720] (-962.424) (-960.117) (-960.086) -- 0:00:27
600000 -- (-960.416) [-960.213] (-961.815) (-967.053) * (-960.335) [-963.153] (-961.482) (-963.642) -- 0:00:27
Average standard deviation of split frequencies: 0.007358
600500 -- (-963.407) [-958.727] (-964.907) (-959.641) * [-964.135] (-962.539) (-965.273) (-963.857) -- 0:00:27
601000 -- [-963.423] (-962.126) (-969.819) (-962.165) * (-965.029) (-965.786) [-962.366] (-962.737) -- 0:00:27
601500 -- [-961.945] (-961.808) (-961.962) (-958.402) * [-960.182] (-964.201) (-966.204) (-961.752) -- 0:00:27
602000 -- (-964.897) (-963.421) [-961.038] (-962.862) * [-959.935] (-961.603) (-962.625) (-963.943) -- 0:00:27
602500 -- (-968.929) (-964.448) (-961.669) [-964.839] * (-962.664) (-960.209) [-963.758] (-960.804) -- 0:00:27
603000 -- [-965.836] (-961.443) (-963.150) (-964.037) * (-960.826) (-963.858) (-963.615) [-960.250] -- 0:00:26
603500 -- [-966.799] (-962.226) (-965.048) (-967.595) * (-965.874) (-964.691) [-961.002] (-962.011) -- 0:00:26
604000 -- (-962.085) (-960.072) [-961.978] (-967.602) * [-961.599] (-963.936) (-961.987) (-966.895) -- 0:00:26
604500 -- (-962.235) [-960.690] (-960.341) (-960.565) * (-961.093) (-961.988) [-962.422] (-960.918) -- 0:00:27
605000 -- (-963.830) (-960.386) [-959.975] (-965.048) * [-963.715] (-960.598) (-964.367) (-962.364) -- 0:00:27
Average standard deviation of split frequencies: 0.007779
605500 -- [-962.057] (-959.842) (-961.678) (-960.978) * (-961.510) (-962.270) (-963.902) [-960.747] -- 0:00:27
606000 -- [-963.505] (-963.765) (-962.737) (-965.638) * [-961.287] (-961.037) (-961.314) (-966.340) -- 0:00:27
606500 -- (-963.648) [-961.013] (-962.757) (-964.234) * (-965.258) (-965.361) (-968.086) [-962.970] -- 0:00:27
607000 -- (-961.500) (-960.455) (-963.190) [-962.582] * (-965.016) (-965.259) [-962.593] (-963.430) -- 0:00:27
607500 -- (-964.106) (-960.503) [-961.981] (-965.527) * (-961.535) (-960.908) (-964.071) [-960.286] -- 0:00:27
608000 -- (-961.419) (-965.527) [-962.616] (-960.365) * (-962.877) (-965.462) [-962.894] (-960.638) -- 0:00:27
608500 -- [-961.888] (-963.421) (-963.981) (-960.891) * (-960.808) (-964.554) (-965.350) [-962.930] -- 0:00:27
609000 -- [-961.571] (-961.314) (-967.719) (-962.991) * [-962.335] (-961.294) (-960.952) (-964.910) -- 0:00:26
609500 -- (-961.962) [-963.005] (-963.686) (-961.813) * [-961.344] (-958.902) (-964.521) (-961.251) -- 0:00:26
610000 -- (-961.955) (-963.151) [-965.454] (-965.036) * (-960.634) [-963.912] (-961.967) (-962.598) -- 0:00:26
Average standard deviation of split frequencies: 0.007430
610500 -- (-963.291) (-962.850) [-962.736] (-960.817) * (-960.531) (-962.152) [-961.402] (-962.686) -- 0:00:26
611000 -- (-964.531) (-962.666) (-963.202) [-961.778] * (-962.051) [-965.931] (-964.006) (-962.320) -- 0:00:26
611500 -- [-968.321] (-965.525) (-961.090) (-959.618) * (-960.405) (-966.710) [-966.776] (-962.816) -- 0:00:26
612000 -- (-964.471) (-960.697) (-967.180) [-961.077] * [-962.466] (-963.714) (-962.614) (-962.567) -- 0:00:26
612500 -- [-962.693] (-962.061) (-964.461) (-961.250) * (-968.003) (-962.852) [-964.002] (-962.977) -- 0:00:26
613000 -- (-965.305) (-961.176) (-962.045) [-962.893] * (-962.953) (-962.984) (-963.654) [-962.204] -- 0:00:26
613500 -- (-964.855) [-961.433] (-965.583) (-963.740) * (-968.050) (-962.554) [-961.299] (-962.949) -- 0:00:26
614000 -- (-964.527) [-960.709] (-962.181) (-964.601) * (-964.169) [-960.770] (-965.392) (-960.443) -- 0:00:26
614500 -- (-960.434) (-960.373) [-964.195] (-964.371) * (-962.036) (-965.016) (-963.763) [-965.596] -- 0:00:26
615000 -- (-968.016) (-962.180) (-963.576) [-959.172] * (-961.900) [-962.779] (-966.782) (-961.159) -- 0:00:26
Average standard deviation of split frequencies: 0.007383
615500 -- (-962.555) (-967.780) (-962.280) [-960.755] * (-960.792) (-959.680) (-963.607) [-963.699] -- 0:00:26
616000 -- (-962.271) (-965.596) [-961.395] (-962.246) * (-961.144) [-959.351] (-962.112) (-962.337) -- 0:00:26
616500 -- (-964.055) [-966.698] (-962.753) (-961.088) * (-963.214) [-961.406] (-964.930) (-959.858) -- 0:00:26
617000 -- [-964.665] (-963.906) (-963.256) (-961.551) * [-962.905] (-963.184) (-965.337) (-961.180) -- 0:00:26
617500 -- (-971.900) [-961.267] (-965.796) (-963.782) * (-962.607) [-963.073] (-965.216) (-962.623) -- 0:00:26
618000 -- (-964.989) (-962.353) (-963.049) [-963.110] * (-964.098) (-960.594) [-962.606] (-962.637) -- 0:00:26
618500 -- (-966.737) (-963.708) (-963.592) [-961.829] * (-962.101) [-961.268] (-964.984) (-962.824) -- 0:00:26
619000 -- (-966.649) [-965.733] (-961.537) (-958.554) * [-961.971] (-963.879) (-963.321) (-963.289) -- 0:00:26
619500 -- (-963.587) (-961.397) (-964.007) [-963.057] * (-961.960) (-966.771) [-964.627] (-961.269) -- 0:00:26
620000 -- (-963.707) (-962.940) (-964.430) [-960.175] * (-963.232) (-962.801) (-962.473) [-964.996] -- 0:00:26
Average standard deviation of split frequencies: 0.007059
620500 -- (-960.253) (-965.333) [-962.065] (-959.648) * (-959.990) (-963.377) [-960.718] (-961.025) -- 0:00:26
621000 -- (-964.815) (-966.181) (-963.316) [-961.603] * (-960.823) (-962.820) (-961.288) [-960.155] -- 0:00:26
621500 -- (-963.581) (-964.798) [-967.837] (-962.897) * (-959.910) (-962.320) (-969.185) [-960.687] -- 0:00:26
622000 -- (-963.271) (-965.218) [-962.370] (-963.214) * [-964.773] (-960.803) (-961.737) (-963.091) -- 0:00:26
622500 -- (-963.145) (-963.342) (-961.804) [-964.786] * [-962.899] (-964.042) (-963.041) (-961.327) -- 0:00:26
623000 -- (-963.534) [-963.574] (-960.193) (-960.512) * (-965.266) (-962.704) (-959.585) [-963.870] -- 0:00:26
623500 -- (-962.625) (-963.821) [-961.333] (-963.358) * (-962.283) (-959.913) [-960.521] (-962.619) -- 0:00:25
624000 -- (-964.785) (-964.835) [-959.758] (-963.292) * [-961.631] (-961.401) (-960.864) (-961.292) -- 0:00:25
624500 -- [-962.965] (-963.588) (-961.185) (-961.984) * (-959.869) (-959.906) (-961.773) [-960.755] -- 0:00:25
625000 -- [-963.110] (-962.834) (-962.477) (-962.501) * (-961.768) (-963.525) [-963.370] (-961.579) -- 0:00:25
Average standard deviation of split frequencies: 0.007132
625500 -- [-959.813] (-961.850) (-963.103) (-961.660) * [-963.180] (-959.600) (-963.370) (-959.596) -- 0:00:25
626000 -- (-960.842) (-960.716) [-962.860] (-962.806) * [-959.938] (-962.244) (-961.834) (-958.857) -- 0:00:25
626500 -- (-964.507) [-962.559] (-960.532) (-968.016) * (-961.232) [-962.630] (-959.376) (-961.535) -- 0:00:25
627000 -- (-965.320) (-961.984) [-962.282] (-961.755) * (-961.813) (-963.461) (-964.230) [-960.300] -- 0:00:25
627500 -- (-967.391) (-963.575) (-960.522) [-963.173] * (-962.493) (-961.728) [-960.455] (-962.602) -- 0:00:25
628000 -- (-964.028) (-960.971) [-960.872] (-959.967) * (-964.651) [-961.336] (-966.080) (-963.954) -- 0:00:25
628500 -- (-964.346) (-964.491) [-962.535] (-959.601) * [-962.086] (-965.903) (-960.834) (-968.992) -- 0:00:25
629000 -- (-963.824) [-960.820] (-961.868) (-960.030) * [-963.372] (-965.415) (-961.135) (-961.757) -- 0:00:25
629500 -- (-967.311) (-964.176) (-959.761) [-960.098] * (-962.071) (-962.006) (-972.453) [-961.428] -- 0:00:25
630000 -- (-963.296) [-959.599] (-963.747) (-960.936) * [-960.102] (-961.535) (-963.120) (-965.268) -- 0:00:25
Average standard deviation of split frequencies: 0.006903
630500 -- (-965.160) (-963.814) [-963.431] (-959.733) * (-962.215) (-962.383) [-960.699] (-964.460) -- 0:00:25
631000 -- (-965.929) [-961.066] (-964.872) (-963.960) * (-960.169) (-961.821) [-962.757] (-961.153) -- 0:00:25
631500 -- (-959.512) (-961.624) (-968.832) [-961.283] * (-963.177) (-963.579) [-962.941] (-961.255) -- 0:00:25
632000 -- [-961.446] (-961.955) (-963.346) (-959.333) * (-961.245) (-965.924) [-959.146] (-961.115) -- 0:00:25
632500 -- [-963.217] (-961.878) (-963.569) (-958.308) * (-960.581) (-962.657) [-962.282] (-962.101) -- 0:00:25
633000 -- (-963.317) (-967.941) [-967.525] (-960.235) * (-959.849) (-966.662) [-966.237] (-963.234) -- 0:00:25
633500 -- (-971.179) [-964.774] (-963.867) (-959.747) * [-961.617] (-959.968) (-963.464) (-960.174) -- 0:00:25
634000 -- (-971.472) [-963.143] (-963.811) (-965.827) * (-961.070) (-962.698) (-961.363) [-959.484] -- 0:00:25
634500 -- (-961.660) (-964.782) [-963.403] (-961.944) * (-963.800) (-967.428) [-961.803] (-957.744) -- 0:00:25
635000 -- (-963.013) (-964.160) (-964.409) [-963.595] * [-959.740] (-966.216) (-962.439) (-958.444) -- 0:00:25
Average standard deviation of split frequencies: 0.007107
635500 -- (-962.512) (-962.390) (-964.315) [-962.393] * [-963.841] (-961.135) (-960.601) (-961.398) -- 0:00:25
636000 -- (-963.725) (-962.954) [-964.879] (-960.642) * [-963.381] (-961.583) (-964.943) (-963.396) -- 0:00:25
636500 -- (-961.275) [-961.608] (-966.097) (-963.415) * (-959.486) (-961.701) (-961.774) [-961.524] -- 0:00:25
637000 -- (-962.137) (-967.240) [-960.992] (-966.000) * (-960.045) (-964.302) (-962.254) [-961.426] -- 0:00:25
637500 -- (-961.256) (-961.618) [-963.689] (-964.193) * (-959.262) [-961.297] (-965.614) (-962.506) -- 0:00:25
638000 -- [-962.239] (-961.517) (-965.378) (-959.960) * [-962.548] (-967.247) (-964.552) (-961.220) -- 0:00:24
638500 -- (-963.701) (-962.275) (-963.010) [-960.114] * [-963.913] (-965.691) (-964.156) (-962.820) -- 0:00:24
639000 -- [-965.505] (-963.371) (-961.961) (-963.195) * (-960.831) (-963.006) [-961.626] (-963.587) -- 0:00:24
639500 -- (-965.966) (-961.724) (-966.797) [-960.181] * (-960.079) [-959.607] (-963.801) (-962.709) -- 0:00:24
640000 -- (-964.543) (-961.331) (-964.566) [-958.476] * (-959.203) (-961.652) [-961.050] (-962.582) -- 0:00:24
Average standard deviation of split frequencies: 0.007142
640500 -- (-964.637) (-963.568) [-961.686] (-959.936) * (-961.771) (-960.468) (-962.025) [-962.526] -- 0:00:24
641000 -- [-961.825] (-963.422) (-962.674) (-966.583) * (-960.283) (-962.434) [-961.443] (-961.155) -- 0:00:24
641500 -- (-966.295) (-967.404) [-965.914] (-966.161) * (-963.915) (-960.069) (-964.742) [-960.075] -- 0:00:24
642000 -- (-966.239) (-964.113) [-962.868] (-965.226) * [-960.607] (-964.562) (-963.412) (-961.867) -- 0:00:24
642500 -- (-967.587) (-964.053) [-963.057] (-966.257) * [-960.157] (-967.553) (-960.226) (-965.218) -- 0:00:24
643000 -- (-961.757) (-959.664) [-962.470] (-963.302) * (-962.662) (-963.792) [-959.939] (-961.500) -- 0:00:24
643500 -- (-961.575) [-958.727] (-961.389) (-962.360) * (-961.974) [-964.229] (-965.677) (-960.848) -- 0:00:24
644000 -- [-963.130] (-959.982) (-966.913) (-962.859) * [-962.352] (-959.920) (-960.733) (-961.269) -- 0:00:24
644500 -- (-962.314) (-963.801) [-962.093] (-968.082) * (-962.214) (-965.561) [-959.976] (-963.086) -- 0:00:24
645000 -- [-960.136] (-960.208) (-961.019) (-966.909) * (-964.929) (-962.668) (-961.643) [-960.137] -- 0:00:24
Average standard deviation of split frequencies: 0.007254
645500 -- [-965.751] (-960.166) (-963.220) (-968.956) * [-961.712] (-961.302) (-962.843) (-961.295) -- 0:00:24
646000 -- (-961.506) (-959.210) [-960.893] (-961.661) * (-963.700) (-964.251) (-961.922) [-959.914] -- 0:00:24
646500 -- (-968.476) (-958.999) [-963.064] (-964.181) * [-960.537] (-961.329) (-962.268) (-960.543) -- 0:00:24
647000 -- [-962.347] (-959.072) (-962.278) (-965.530) * (-961.874) (-959.240) (-962.729) [-959.618] -- 0:00:24
647500 -- [-960.713] (-961.250) (-960.879) (-959.947) * (-962.537) (-961.280) (-970.193) [-960.117] -- 0:00:24
648000 -- (-961.068) [-960.253] (-960.282) (-963.460) * (-966.478) (-961.812) (-963.431) [-959.520] -- 0:00:24
648500 -- (-969.578) [-960.117] (-964.930) (-964.216) * (-963.423) (-964.506) [-961.187] (-960.825) -- 0:00:24
649000 -- (-963.064) (-965.151) [-963.461] (-962.432) * (-960.417) (-964.508) (-961.809) [-960.559] -- 0:00:24
649500 -- (-969.039) (-961.567) [-961.907] (-961.993) * (-963.180) (-959.168) [-961.291] (-966.743) -- 0:00:24
650000 -- (-961.403) (-963.614) (-962.979) [-964.426] * [-962.235] (-964.436) (-971.272) (-960.695) -- 0:00:24
Average standard deviation of split frequencies: 0.007373
650500 -- [-962.151] (-961.123) (-967.002) (-965.024) * (-965.128) (-963.448) [-963.015] (-965.167) -- 0:00:24
651000 -- (-960.695) [-959.270] (-961.754) (-964.720) * (-962.838) (-961.914) [-970.171] (-962.366) -- 0:00:24
651500 -- [-962.577] (-966.054) (-964.900) (-959.863) * (-967.912) (-964.459) [-968.702] (-959.954) -- 0:00:24
652000 -- (-961.706) (-961.521) [-961.006] (-960.965) * (-965.287) (-962.328) [-964.585] (-962.029) -- 0:00:24
652500 -- (-961.730) (-962.221) [-959.826] (-963.817) * (-963.555) (-962.236) (-966.804) [-965.804] -- 0:00:23
653000 -- [-962.012] (-961.521) (-963.182) (-963.851) * (-962.312) (-959.563) (-963.970) [-960.368] -- 0:00:23
653500 -- (-959.555) (-966.744) [-962.257] (-961.653) * [-961.056] (-962.264) (-966.016) (-969.104) -- 0:00:23
654000 -- (-963.515) (-962.295) [-962.142] (-962.020) * (-960.999) [-959.405] (-963.732) (-962.131) -- 0:00:23
654500 -- (-958.466) (-965.976) [-959.867] (-966.754) * (-962.022) (-961.000) [-960.714] (-962.354) -- 0:00:23
655000 -- [-962.253] (-960.738) (-962.396) (-963.109) * (-962.413) (-959.719) [-964.714] (-963.271) -- 0:00:23
Average standard deviation of split frequencies: 0.006890
655500 -- (-965.435) (-959.669) (-964.501) [-960.997] * (-965.366) [-961.257] (-963.773) (-965.539) -- 0:00:23
656000 -- (-963.522) (-962.867) [-964.500] (-961.322) * (-964.694) (-962.286) [-962.273] (-963.846) -- 0:00:23
656500 -- (-963.800) [-962.566] (-962.148) (-964.056) * (-961.010) (-963.071) [-961.609] (-962.911) -- 0:00:23
657000 -- (-962.834) (-963.012) [-963.307] (-966.246) * (-961.783) (-963.725) (-959.577) [-962.519] -- 0:00:23
657500 -- (-964.169) (-960.183) (-965.256) [-965.362] * (-961.615) (-961.187) (-964.184) [-964.634] -- 0:00:23
658000 -- [-964.292] (-960.472) (-963.630) (-962.025) * [-961.295] (-958.907) (-965.616) (-961.626) -- 0:00:23
658500 -- (-966.996) (-960.063) [-964.666] (-963.485) * [-958.430] (-965.905) (-966.000) (-963.309) -- 0:00:23
659000 -- (-964.155) [-962.522] (-960.951) (-966.295) * (-962.102) [-966.590] (-962.484) (-963.654) -- 0:00:23
659500 -- [-961.674] (-964.156) (-961.293) (-964.623) * [-959.940] (-961.905) (-960.630) (-960.742) -- 0:00:23
660000 -- (-964.949) (-963.304) (-967.487) [-963.876] * [-962.301] (-965.397) (-965.147) (-960.476) -- 0:00:23
Average standard deviation of split frequencies: 0.006841
660500 -- (-962.479) [-963.314] (-963.164) (-962.043) * (-960.374) (-961.435) (-959.890) [-962.010] -- 0:00:23
661000 -- (-964.589) [-961.839] (-962.132) (-963.932) * [-962.118] (-961.477) (-963.133) (-960.953) -- 0:00:23
661500 -- (-963.722) (-960.381) (-962.485) [-963.885] * [-962.295] (-960.887) (-961.269) (-965.920) -- 0:00:23
662000 -- (-962.351) [-963.795] (-962.223) (-967.215) * (-964.461) (-964.342) [-961.040] (-964.044) -- 0:00:23
662500 -- [-963.761] (-962.100) (-963.224) (-961.315) * (-961.814) (-964.323) [-961.304] (-960.665) -- 0:00:23
663000 -- (-964.525) [-962.257] (-961.791) (-962.177) * (-961.735) (-959.753) (-961.140) [-960.692] -- 0:00:23
663500 -- (-966.231) [-965.957] (-959.461) (-959.797) * (-960.239) (-961.641) (-960.749) [-963.839] -- 0:00:23
664000 -- (-963.683) (-964.479) [-959.154] (-960.508) * [-960.680] (-962.685) (-962.928) (-960.482) -- 0:00:23
664500 -- (-960.616) (-965.123) (-966.610) [-960.822] * (-962.312) (-963.530) [-962.145] (-967.134) -- 0:00:23
665000 -- [-960.519] (-963.307) (-967.116) (-961.581) * (-961.837) (-962.454) [-962.844] (-962.814) -- 0:00:23
Average standard deviation of split frequencies: 0.006745
665500 -- (-964.179) (-965.424) (-961.242) [-960.323] * (-962.424) (-964.972) [-960.226] (-964.309) -- 0:00:23
666000 -- (-966.023) (-961.567) [-961.768] (-962.314) * (-965.177) [-961.611] (-963.193) (-963.765) -- 0:00:23
666500 -- (-961.406) [-963.185] (-961.195) (-962.623) * (-963.051) (-965.724) [-962.173] (-968.012) -- 0:00:23
667000 -- [-961.817] (-962.605) (-962.149) (-967.112) * (-959.557) (-961.908) [-964.073] (-962.547) -- 0:00:22
667500 -- (-962.685) (-960.648) (-963.391) [-964.567] * (-961.711) [-965.237] (-960.586) (-960.666) -- 0:00:22
668000 -- (-964.911) [-958.765] (-962.968) (-959.329) * (-962.851) [-962.681] (-966.627) (-961.550) -- 0:00:22
668500 -- (-960.838) [-963.581] (-959.426) (-960.973) * [-962.943] (-959.551) (-963.973) (-961.023) -- 0:00:22
669000 -- [-959.729] (-959.164) (-959.876) (-961.823) * (-962.389) [-959.451] (-963.412) (-969.876) -- 0:00:22
669500 -- [-966.226] (-960.229) (-960.813) (-965.819) * (-965.224) [-960.841] (-963.855) (-961.967) -- 0:00:22
670000 -- [-962.818] (-960.789) (-964.984) (-961.732) * (-961.073) [-961.004] (-964.826) (-962.683) -- 0:00:22
Average standard deviation of split frequencies: 0.006574
670500 -- (-961.277) [-958.406] (-961.185) (-967.572) * [-963.973] (-966.516) (-965.749) (-962.569) -- 0:00:22
671000 -- (-966.036) (-966.369) (-964.485) [-965.387] * (-964.509) (-960.808) (-967.541) [-964.774] -- 0:00:22
671500 -- (-962.605) [-960.998] (-963.585) (-962.578) * [-963.360] (-963.594) (-964.752) (-961.400) -- 0:00:22
672000 -- (-962.821) [-960.359] (-966.090) (-962.753) * (-964.274) (-960.316) (-964.524) [-963.380] -- 0:00:22
672500 -- (-959.973) (-961.924) [-962.835] (-968.618) * (-966.331) [-960.279] (-965.045) (-963.998) -- 0:00:22
673000 -- (-966.925) (-960.387) (-964.020) [-965.654] * (-963.874) (-960.818) (-960.084) [-962.167] -- 0:00:22
673500 -- [-960.192] (-962.817) (-960.497) (-962.154) * (-962.123) (-961.755) (-963.906) [-963.904] -- 0:00:22
674000 -- (-958.522) (-959.688) (-961.008) [-960.932] * [-962.807] (-965.609) (-962.535) (-959.274) -- 0:00:22
674500 -- [-963.162] (-961.592) (-963.134) (-962.273) * (-967.001) (-964.491) (-959.695) [-960.070] -- 0:00:22
675000 -- (-967.103) (-962.983) (-964.689) [-960.741] * (-968.467) (-960.311) [-960.744] (-963.324) -- 0:00:22
Average standard deviation of split frequencies: 0.006727
675500 -- (-962.725) (-961.435) (-962.815) [-957.616] * (-964.035) [-959.465] (-964.048) (-962.939) -- 0:00:22
676000 -- [-963.430] (-960.494) (-961.915) (-964.656) * (-961.241) (-961.352) [-961.991] (-959.651) -- 0:00:22
676500 -- (-963.433) (-959.532) (-963.579) [-962.983] * (-962.438) (-962.878) (-963.064) [-963.356] -- 0:00:22
677000 -- (-965.833) (-959.846) [-963.406] (-963.520) * [-962.068] (-962.045) (-960.973) (-963.777) -- 0:00:22
677500 -- (-964.584) [-958.105] (-964.365) (-962.746) * (-962.503) [-960.354] (-967.889) (-965.853) -- 0:00:22
678000 -- (-964.307) (-967.584) (-961.631) [-962.051] * (-963.071) [-964.067] (-960.876) (-968.285) -- 0:00:22
678500 -- (-960.957) (-967.195) [-960.640] (-961.603) * (-961.558) (-961.578) [-961.987] (-959.620) -- 0:00:22
679000 -- (-962.419) (-961.191) (-963.562) [-963.429] * (-962.317) [-959.661] (-962.746) (-963.818) -- 0:00:22
679500 -- (-961.124) [-959.847] (-963.519) (-961.551) * [-961.403] (-962.544) (-964.191) (-963.655) -- 0:00:22
680000 -- (-965.151) (-960.312) [-963.239] (-960.138) * (-965.209) [-963.313] (-961.085) (-959.236) -- 0:00:22
Average standard deviation of split frequencies: 0.006966
680500 -- [-963.970] (-964.944) (-961.840) (-962.869) * (-964.614) (-963.696) [-960.463] (-964.601) -- 0:00:22
681000 -- (-961.556) [-959.954] (-960.420) (-964.227) * [-959.861] (-965.267) (-961.867) (-962.046) -- 0:00:22
681500 -- (-963.499) [-959.869] (-967.205) (-963.911) * (-959.913) (-961.094) [-959.518] (-962.857) -- 0:00:21
682000 -- (-961.464) (-962.428) [-969.443] (-961.591) * (-962.628) [-961.567] (-962.651) (-965.170) -- 0:00:21
682500 -- (-963.346) [-958.907] (-968.538) (-961.775) * (-962.030) [-961.908] (-961.756) (-962.690) -- 0:00:21
683000 -- (-967.156) (-960.382) [-959.702] (-963.530) * (-963.211) (-962.183) (-959.574) [-963.229] -- 0:00:21
683500 -- (-966.094) (-963.146) [-963.880] (-960.151) * (-960.356) (-963.553) (-961.674) [-960.391] -- 0:00:21
684000 -- (-963.936) [-961.029] (-960.769) (-961.439) * (-963.542) (-960.144) (-961.826) [-960.201] -- 0:00:21
684500 -- (-966.505) (-963.300) [-963.401] (-965.590) * (-965.825) (-962.345) [-961.288] (-959.689) -- 0:00:21
685000 -- (-967.481) (-964.659) [-960.255] (-960.388) * (-959.455) (-962.113) (-959.854) [-961.350] -- 0:00:21
Average standard deviation of split frequencies: 0.006751
685500 -- [-962.204] (-959.813) (-961.979) (-960.860) * [-964.391] (-961.274) (-962.988) (-960.303) -- 0:00:21
686000 -- [-960.736] (-959.855) (-963.019) (-963.279) * (-962.642) [-961.348] (-962.302) (-961.767) -- 0:00:21
686500 -- (-963.692) (-962.363) [-960.279] (-962.138) * (-963.343) [-960.806] (-961.157) (-962.622) -- 0:00:21
687000 -- [-962.505] (-964.382) (-962.368) (-965.981) * (-963.548) (-963.094) (-960.459) [-960.824] -- 0:00:21
687500 -- (-960.355) (-959.203) [-964.019] (-966.184) * (-962.562) (-963.653) (-963.017) [-963.859] -- 0:00:21
688000 -- (-959.767) [-965.888] (-961.375) (-963.327) * (-961.845) [-961.410] (-964.962) (-962.462) -- 0:00:21
688500 -- [-960.564] (-968.005) (-961.406) (-962.483) * (-960.685) (-963.261) [-962.065] (-961.657) -- 0:00:21
689000 -- (-960.977) [-959.904] (-964.469) (-966.419) * [-962.522] (-965.620) (-960.562) (-964.912) -- 0:00:21
689500 -- (-961.428) [-964.622] (-962.429) (-965.711) * (-966.019) (-963.766) [-961.841] (-963.911) -- 0:00:21
690000 -- (-962.640) [-959.782] (-963.009) (-966.332) * (-963.047) [-963.389] (-960.471) (-964.197) -- 0:00:21
Average standard deviation of split frequencies: 0.006625
690500 -- (-960.895) [-959.415] (-964.690) (-961.430) * [-961.561] (-961.104) (-959.937) (-960.613) -- 0:00:21
691000 -- (-961.228) [-960.584] (-963.212) (-963.939) * [-962.653] (-962.851) (-963.890) (-962.350) -- 0:00:21
691500 -- (-960.563) (-961.920) [-959.622] (-967.348) * (-959.152) (-962.912) (-961.967) [-965.100] -- 0:00:21
692000 -- (-961.454) [-962.748] (-965.450) (-963.601) * [-962.869] (-960.328) (-963.762) (-962.010) -- 0:00:21
692500 -- (-961.904) (-965.787) [-960.421] (-968.166) * (-961.958) [-958.926] (-969.772) (-962.027) -- 0:00:21
693000 -- (-961.016) (-967.226) [-959.833] (-964.385) * [-961.542] (-960.268) (-967.862) (-963.013) -- 0:00:21
693500 -- (-962.473) (-966.693) [-960.690] (-962.839) * [-960.937] (-958.798) (-961.108) (-964.258) -- 0:00:21
694000 -- (-966.382) (-960.557) (-959.777) [-961.153] * [-963.531] (-962.247) (-959.410) (-964.640) -- 0:00:21
694500 -- (-966.418) (-963.376) [-960.094] (-962.772) * (-961.292) (-959.927) (-960.151) [-961.803] -- 0:00:21
695000 -- (-964.334) (-961.065) [-963.089] (-967.505) * (-960.945) (-962.580) [-964.251] (-963.557) -- 0:00:21
Average standard deviation of split frequencies: 0.006454
695500 -- [-959.127] (-964.480) (-964.229) (-962.758) * (-963.927) (-959.743) (-966.729) [-960.010] -- 0:00:21
696000 -- (-961.663) (-960.389) (-961.062) [-961.914] * (-965.103) (-963.338) (-961.136) [-965.123] -- 0:00:20
696500 -- (-961.181) (-964.706) [-963.215] (-961.776) * (-967.613) (-960.845) [-962.898] (-961.446) -- 0:00:20
697000 -- (-962.896) [-962.285] (-966.113) (-959.869) * (-962.423) [-962.666] (-960.573) (-964.760) -- 0:00:20
697500 -- (-965.335) (-961.733) (-965.055) [-962.935] * (-963.206) (-962.134) (-964.926) [-967.235] -- 0:00:20
698000 -- (-960.183) (-965.119) [-961.688] (-965.252) * (-961.787) (-964.104) (-962.450) [-963.761] -- 0:00:20
698500 -- (-969.104) (-961.468) [-959.494] (-966.561) * (-962.829) (-964.232) [-960.935] (-964.890) -- 0:00:20
699000 -- [-963.197] (-963.449) (-961.729) (-965.186) * (-961.724) [-959.659] (-965.473) (-967.401) -- 0:00:20
699500 -- (-968.329) (-965.983) [-962.847] (-964.500) * (-967.030) [-959.049] (-962.425) (-965.231) -- 0:00:20
700000 -- (-962.642) [-962.579] (-961.227) (-961.772) * (-965.293) (-964.229) (-962.704) [-964.219] -- 0:00:20
Average standard deviation of split frequencies: 0.006372
700500 -- (-961.652) [-964.692] (-965.068) (-962.151) * (-961.296) (-963.459) (-962.425) [-961.671] -- 0:00:20
701000 -- (-966.423) (-962.161) (-963.210) [-961.717] * (-964.270) (-963.818) (-960.310) [-966.995] -- 0:00:20
701500 -- (-960.686) (-961.162) (-961.406) [-963.491] * [-961.475] (-968.372) (-963.284) (-964.971) -- 0:00:20
702000 -- [-960.361] (-962.875) (-963.699) (-961.586) * (-963.818) [-963.205] (-964.339) (-967.651) -- 0:00:20
702500 -- (-960.793) [-964.528] (-966.165) (-961.347) * (-964.741) (-961.792) [-963.071] (-963.512) -- 0:00:20
703000 -- (-963.979) (-965.562) (-962.714) [-962.507] * [-964.186] (-963.026) (-965.000) (-962.992) -- 0:00:20
703500 -- [-959.842] (-964.057) (-962.052) (-961.921) * (-966.269) (-962.539) (-960.804) [-960.163] -- 0:00:20
704000 -- (-959.649) [-964.041] (-962.369) (-964.959) * (-964.813) (-961.515) (-963.969) [-961.383] -- 0:00:20
704500 -- (-962.423) (-964.418) [-960.857] (-965.417) * (-968.499) (-960.982) (-964.596) [-962.533] -- 0:00:20
705000 -- (-962.425) (-966.420) [-960.492] (-962.221) * (-962.004) [-961.265] (-961.581) (-964.743) -- 0:00:20
Average standard deviation of split frequencies: 0.006324
705500 -- (-962.095) (-963.669) (-959.561) [-959.447] * [-964.738] (-963.923) (-962.025) (-964.929) -- 0:00:20
706000 -- (-961.105) (-962.870) (-961.151) [-961.853] * [-966.282] (-965.454) (-963.519) (-964.002) -- 0:00:20
706500 -- (-964.104) (-963.292) [-962.986] (-962.741) * (-965.650) (-969.922) [-959.632] (-965.449) -- 0:00:20
707000 -- (-960.804) [-963.292] (-958.829) (-962.438) * (-964.580) (-961.357) [-960.651] (-967.475) -- 0:00:20
707500 -- (-961.770) (-964.561) (-960.582) [-962.281] * (-964.290) [-962.402] (-959.345) (-964.114) -- 0:00:20
708000 -- [-961.995] (-965.729) (-961.771) (-963.894) * (-961.490) (-965.452) [-963.659] (-961.225) -- 0:00:20
708500 -- [-961.107] (-964.961) (-961.035) (-962.445) * (-968.968) [-961.701] (-966.569) (-963.189) -- 0:00:20
709000 -- (-963.629) (-962.814) (-961.003) [-960.982] * (-964.194) (-968.301) [-962.998] (-969.248) -- 0:00:20
709500 -- (-963.901) [-965.413] (-961.064) (-964.279) * [-962.132] (-965.740) (-962.489) (-962.062) -- 0:00:20
710000 -- [-960.013] (-964.691) (-962.440) (-968.459) * [-962.784] (-963.464) (-961.278) (-960.330) -- 0:00:20
Average standard deviation of split frequencies: 0.006399
710500 -- [-963.290] (-964.503) (-962.632) (-960.582) * (-963.648) (-963.099) (-962.589) [-964.410] -- 0:00:19
711000 -- (-966.114) (-960.020) (-962.188) [-968.182] * (-960.558) [-960.466] (-961.727) (-963.434) -- 0:00:19
711500 -- (-964.921) [-958.704] (-961.131) (-964.499) * (-960.405) (-960.922) [-964.204] (-959.790) -- 0:00:19
712000 -- (-963.245) (-965.478) [-959.851] (-964.991) * (-964.657) (-963.506) (-962.680) [-963.736] -- 0:00:19
712500 -- (-963.136) [-961.069] (-965.367) (-965.515) * (-963.349) (-961.390) (-958.634) [-960.264] -- 0:00:19
713000 -- (-964.516) [-964.289] (-967.779) (-963.973) * (-965.197) (-960.947) (-961.613) [-959.888] -- 0:00:19
713500 -- [-958.044] (-961.044) (-963.685) (-964.804) * [-964.070] (-964.797) (-966.974) (-963.012) -- 0:00:19
714000 -- (-962.528) (-963.847) [-964.469] (-960.865) * [-966.410] (-962.515) (-963.464) (-960.708) -- 0:00:19
714500 -- (-963.513) (-961.335) [-965.349] (-961.144) * (-965.016) (-960.337) (-970.324) [-959.679] -- 0:00:19
715000 -- (-963.838) (-960.492) [-963.301] (-961.739) * (-966.355) (-962.378) (-967.113) [-962.218] -- 0:00:19
Average standard deviation of split frequencies: 0.006235
715500 -- (-959.254) (-963.831) (-963.816) [-965.883] * (-964.456) (-960.739) (-962.219) [-959.456] -- 0:00:19
716000 -- (-965.493) [-963.356] (-964.846) (-963.252) * (-963.940) (-962.735) (-961.336) [-960.826] -- 0:00:19
716500 -- [-959.125] (-959.610) (-963.742) (-961.625) * (-966.999) (-961.053) (-961.401) [-960.414] -- 0:00:19
717000 -- (-964.231) [-965.747] (-969.528) (-961.202) * (-963.223) [-958.622] (-964.979) (-964.488) -- 0:00:19
717500 -- [-962.279] (-963.493) (-963.804) (-964.420) * (-962.920) (-961.552) [-960.521] (-965.310) -- 0:00:19
718000 -- [-961.797] (-965.182) (-962.067) (-964.590) * (-970.258) [-961.073] (-962.887) (-961.932) -- 0:00:19
718500 -- [-962.750] (-959.829) (-962.532) (-960.840) * (-965.028) [-961.928] (-970.320) (-961.456) -- 0:00:19
719000 -- (-964.943) (-961.266) (-964.614) [-966.193] * [-966.506] (-961.018) (-965.509) (-962.587) -- 0:00:19
719500 -- (-962.687) (-968.893) (-964.896) [-962.945] * [-967.741] (-960.349) (-965.888) (-963.593) -- 0:00:19
720000 -- [-961.458] (-969.638) (-963.743) (-962.268) * (-964.156) [-963.812] (-965.061) (-965.228) -- 0:00:19
Average standard deviation of split frequencies: 0.006734
720500 -- (-962.704) [-964.315] (-962.660) (-965.018) * (-964.470) [-963.553] (-961.446) (-963.668) -- 0:00:19
721000 -- (-971.831) (-961.300) (-964.257) [-966.827] * (-961.139) (-965.513) [-965.003] (-962.175) -- 0:00:19
721500 -- (-964.398) [-960.899] (-964.743) (-964.903) * (-961.279) (-961.003) [-960.083] (-961.987) -- 0:00:19
722000 -- (-959.906) (-963.446) [-963.852] (-963.327) * (-960.353) (-964.511) [-966.588] (-961.718) -- 0:00:19
722500 -- (-960.931) (-960.053) (-964.462) [-960.357] * (-960.505) (-966.067) [-963.042] (-961.969) -- 0:00:19
723000 -- (-963.062) (-962.391) (-965.209) [-961.960] * (-959.322) [-961.784] (-960.002) (-959.551) -- 0:00:19
723500 -- (-961.534) (-969.151) (-963.406) [-962.105] * (-962.203) (-961.928) (-961.529) [-961.641] -- 0:00:19
724000 -- (-963.883) (-965.376) (-967.092) [-960.282] * (-968.483) [-960.094] (-959.756) (-959.624) -- 0:00:19
724500 -- (-966.162) (-960.035) [-965.293] (-961.527) * (-962.564) [-961.202] (-963.082) (-963.267) -- 0:00:19
725000 -- (-964.876) [-959.489] (-964.763) (-962.057) * (-962.473) [-964.258] (-962.512) (-961.603) -- 0:00:18
Average standard deviation of split frequencies: 0.007066
725500 -- (-961.313) [-961.834] (-963.115) (-966.521) * (-961.628) (-961.388) (-959.657) [-960.381] -- 0:00:18
726000 -- (-965.284) (-964.990) [-963.849] (-962.309) * (-961.716) (-964.084) (-965.822) [-962.902] -- 0:00:18
726500 -- (-958.926) (-963.510) (-961.964) [-964.327] * [-961.794] (-961.440) (-963.929) (-964.108) -- 0:00:18
727000 -- (-962.313) (-960.248) (-962.014) [-964.084] * (-967.416) (-960.918) (-961.323) [-962.131] -- 0:00:18
727500 -- (-960.990) [-961.241] (-962.207) (-963.489) * (-961.163) [-959.160] (-961.326) (-961.274) -- 0:00:18
728000 -- (-963.526) [-960.669] (-966.935) (-961.261) * (-960.421) [-959.310] (-960.806) (-960.343) -- 0:00:18
728500 -- (-962.095) [-958.860] (-961.656) (-962.518) * (-962.150) [-971.627] (-965.109) (-961.756) -- 0:00:18
729000 -- (-963.222) (-959.359) [-961.339] (-966.552) * (-959.007) (-964.863) [-963.024] (-962.319) -- 0:00:18
729500 -- (-961.636) (-961.185) [-959.975] (-963.374) * (-959.753) (-964.872) [-961.541] (-960.545) -- 0:00:18
730000 -- (-961.649) (-960.644) (-962.032) [-967.263] * (-967.522) [-960.687] (-960.651) (-960.752) -- 0:00:18
Average standard deviation of split frequencies: 0.006869
730500 -- (-962.128) [-961.520] (-962.154) (-966.050) * [-963.646] (-966.985) (-962.977) (-960.911) -- 0:00:18
731000 -- [-960.405] (-960.695) (-963.351) (-965.479) * (-962.528) (-962.016) [-960.021] (-962.661) -- 0:00:18
731500 -- (-961.959) [-961.234] (-960.467) (-966.580) * [-960.225] (-962.247) (-959.742) (-961.305) -- 0:00:18
732000 -- (-961.282) (-959.922) [-959.219] (-961.212) * (-961.293) (-961.373) [-959.445] (-960.037) -- 0:00:18
732500 -- [-962.731] (-960.640) (-960.656) (-963.939) * [-965.032] (-964.424) (-959.686) (-964.209) -- 0:00:18
733000 -- [-961.264] (-963.284) (-961.404) (-967.442) * (-961.336) [-960.946] (-959.962) (-962.194) -- 0:00:18
733500 -- (-960.984) [-961.077] (-964.070) (-967.608) * (-960.397) (-958.176) [-961.927] (-960.342) -- 0:00:18
734000 -- (-961.712) (-962.104) (-961.467) [-960.133] * (-962.549) (-958.070) (-963.870) [-961.882] -- 0:00:18
734500 -- (-960.252) (-963.299) (-960.999) [-960.793] * (-960.841) (-963.869) [-959.756] (-964.180) -- 0:00:18
735000 -- [-959.800] (-964.604) (-960.550) (-964.980) * (-968.391) [-961.842] (-962.774) (-966.279) -- 0:00:18
Average standard deviation of split frequencies: 0.006565
735500 -- (-966.348) (-961.591) [-960.410] (-964.116) * [-960.755] (-961.421) (-962.377) (-962.271) -- 0:00:18
736000 -- (-965.768) (-960.962) [-963.326] (-959.546) * (-960.660) [-963.948] (-964.839) (-961.630) -- 0:00:18
736500 -- [-963.696] (-962.956) (-963.506) (-960.124) * (-961.088) [-959.728] (-963.617) (-959.723) -- 0:00:18
737000 -- (-962.129) [-961.430] (-962.976) (-959.927) * (-966.635) [-960.729] (-962.718) (-961.085) -- 0:00:18
737500 -- [-962.405] (-965.922) (-961.239) (-960.682) * (-969.010) [-961.651] (-961.733) (-964.138) -- 0:00:18
738000 -- (-961.571) (-960.533) [-959.795] (-961.545) * [-963.441] (-964.341) (-964.174) (-962.132) -- 0:00:18
738500 -- (-967.274) (-959.930) [-962.042] (-963.635) * (-960.319) [-960.311] (-962.408) (-964.830) -- 0:00:18
739000 -- (-961.411) [-961.776] (-960.251) (-961.011) * (-960.696) (-968.147) [-962.441] (-963.038) -- 0:00:18
739500 -- (-961.810) [-965.064] (-961.380) (-963.237) * (-961.037) [-960.945] (-962.046) (-961.125) -- 0:00:17
740000 -- (-961.957) [-961.525] (-959.336) (-963.426) * (-961.960) [-959.167] (-962.117) (-963.388) -- 0:00:17
Average standard deviation of split frequencies: 0.006404
740500 -- [-961.605] (-962.128) (-960.393) (-961.772) * [-963.876] (-963.507) (-964.053) (-959.962) -- 0:00:17
741000 -- (-962.573) [-962.401] (-960.269) (-962.675) * (-961.154) (-963.256) (-965.103) [-960.320] -- 0:00:17
741500 -- (-967.171) (-960.327) (-963.184) [-959.485] * (-960.892) (-961.967) [-960.199] (-960.875) -- 0:00:17
742000 -- [-961.517] (-964.201) (-962.667) (-961.849) * (-962.019) (-960.315) [-961.988] (-962.817) -- 0:00:17
742500 -- (-962.473) (-961.768) (-966.602) [-964.308] * (-964.307) (-960.171) (-967.475) [-962.499] -- 0:00:17
743000 -- (-959.951) [-962.558] (-962.425) (-960.286) * (-962.932) (-962.326) (-961.911) [-960.117] -- 0:00:17
743500 -- [-962.869] (-962.044) (-960.678) (-960.389) * [-963.569] (-960.820) (-964.086) (-960.709) -- 0:00:17
744000 -- (-960.643) (-961.291) [-963.624] (-968.018) * (-965.655) (-962.771) [-958.854] (-959.411) -- 0:00:17
744500 -- (-967.788) (-964.858) [-963.332] (-962.024) * (-965.458) (-960.895) (-960.530) [-963.701] -- 0:00:17
745000 -- (-964.280) [-964.052] (-961.951) (-960.131) * [-965.125] (-959.476) (-961.729) (-966.686) -- 0:00:17
Average standard deviation of split frequencies: 0.006398
745500 -- (-962.707) [-961.851] (-964.352) (-961.637) * [-961.564] (-965.488) (-967.506) (-963.730) -- 0:00:17
746000 -- [-962.668] (-966.442) (-963.699) (-961.806) * [-960.262] (-963.502) (-960.310) (-965.470) -- 0:00:17
746500 -- [-960.915] (-961.555) (-965.807) (-963.079) * [-959.597] (-962.053) (-961.014) (-961.710) -- 0:00:17
747000 -- [-962.437] (-961.118) (-965.799) (-965.248) * (-958.118) (-960.443) [-960.830] (-963.828) -- 0:00:17
747500 -- (-961.057) (-961.056) (-962.704) [-961.562] * [-959.174] (-959.682) (-964.423) (-960.788) -- 0:00:17
748000 -- (-961.467) (-968.882) (-964.390) [-959.319] * (-962.527) (-964.398) [-963.748] (-961.170) -- 0:00:17
748500 -- (-966.799) (-964.557) (-960.931) [-962.628] * (-961.672) (-963.496) (-961.433) [-960.905] -- 0:00:17
749000 -- (-962.031) (-962.717) [-958.946] (-964.046) * (-965.639) (-964.982) [-963.209] (-961.385) -- 0:00:17
749500 -- (-962.799) (-962.750) (-960.360) [-960.170] * (-962.922) [-963.879] (-961.363) (-961.982) -- 0:00:17
750000 -- (-966.566) [-959.876] (-958.627) (-963.893) * (-963.787) (-965.686) (-959.937) [-964.770] -- 0:00:17
Average standard deviation of split frequencies: 0.006555
750500 -- (-962.115) [-960.518] (-961.028) (-977.089) * (-961.395) [-959.600] (-962.909) (-963.218) -- 0:00:17
751000 -- (-960.720) [-961.656] (-965.796) (-970.904) * [-961.763] (-960.813) (-962.831) (-960.233) -- 0:00:17
751500 -- (-961.565) [-964.365] (-962.418) (-964.701) * [-963.674] (-962.805) (-960.845) (-963.904) -- 0:00:17
752000 -- [-963.264] (-965.584) (-961.316) (-963.194) * (-963.398) [-960.737] (-963.950) (-964.425) -- 0:00:17
752500 -- (-966.853) (-967.369) [-959.369] (-960.466) * [-961.875] (-962.045) (-965.986) (-961.594) -- 0:00:17
753000 -- (-967.893) (-968.713) (-961.543) [-963.519] * [-961.145] (-962.661) (-966.935) (-962.131) -- 0:00:17
753500 -- (-963.539) [-964.451] (-959.343) (-969.111) * [-961.810] (-963.154) (-965.768) (-962.350) -- 0:00:17
754000 -- (-959.281) [-963.812] (-961.754) (-961.555) * (-961.757) (-963.863) (-963.453) [-965.133] -- 0:00:16
754500 -- (-963.826) [-961.207] (-963.379) (-962.720) * (-961.169) (-965.148) [-960.878] (-964.529) -- 0:00:16
755000 -- (-961.351) (-960.635) [-963.172] (-961.200) * (-962.389) (-965.765) [-960.314] (-964.069) -- 0:00:16
Average standard deviation of split frequencies: 0.006664
755500 -- (-962.031) [-959.967] (-962.644) (-961.027) * (-961.795) (-960.118) (-964.623) [-962.739] -- 0:00:16
756000 -- [-960.517] (-960.839) (-961.872) (-968.390) * (-962.623) (-965.719) [-960.005] (-964.554) -- 0:00:16
756500 -- (-963.138) (-961.461) (-960.919) [-963.567] * (-967.637) (-961.240) (-961.742) [-963.733] -- 0:00:16
757000 -- (-962.212) (-966.721) (-959.905) [-964.873] * [-960.068] (-962.693) (-961.788) (-960.948) -- 0:00:16
757500 -- (-960.181) (-962.541) [-959.400] (-958.977) * (-960.991) (-960.189) [-961.649] (-963.208) -- 0:00:16
758000 -- (-964.339) [-961.677] (-964.046) (-958.912) * (-961.142) [-961.304] (-963.656) (-967.554) -- 0:00:16
758500 -- (-962.078) [-960.067] (-965.942) (-964.285) * (-961.255) (-961.450) [-960.622] (-966.947) -- 0:00:16
759000 -- (-964.287) (-961.524) [-962.218] (-964.292) * [-961.784] (-961.039) (-960.912) (-966.417) -- 0:00:16
759500 -- (-962.432) (-959.511) [-961.035] (-967.082) * (-961.564) (-964.430) [-960.010] (-965.201) -- 0:00:16
760000 -- (-963.242) (-960.969) (-963.801) [-963.613] * (-963.945) (-965.953) (-963.884) [-963.137] -- 0:00:16
Average standard deviation of split frequencies: 0.006856
760500 -- [-965.149] (-958.965) (-960.973) (-962.199) * (-962.288) (-966.844) (-961.424) [-962.091] -- 0:00:16
761000 -- [-960.608] (-961.039) (-965.413) (-962.438) * (-960.305) (-965.390) (-960.928) [-963.608] -- 0:00:16
761500 -- [-961.795] (-965.059) (-959.895) (-962.874) * (-961.448) [-961.979] (-962.547) (-962.902) -- 0:00:16
762000 -- (-962.465) (-966.124) [-961.912] (-966.206) * (-960.215) (-962.414) (-961.059) [-964.489] -- 0:00:16
762500 -- (-963.634) (-961.329) [-963.194] (-963.764) * (-962.180) [-962.389] (-962.101) (-963.287) -- 0:00:16
763000 -- (-964.710) (-962.179) [-961.734] (-960.735) * [-960.747] (-964.000) (-960.031) (-962.865) -- 0:00:16
763500 -- [-964.682] (-966.919) (-965.112) (-962.369) * (-961.234) [-960.960] (-961.748) (-960.266) -- 0:00:16
764000 -- [-961.198] (-968.324) (-964.126) (-960.801) * (-964.956) (-963.438) (-963.999) [-962.124] -- 0:00:16
764500 -- (-967.238) (-967.100) [-964.347] (-963.460) * [-965.492] (-959.430) (-961.446) (-962.258) -- 0:00:16
765000 -- (-962.252) [-965.804] (-964.002) (-960.679) * [-962.334] (-961.186) (-962.193) (-961.467) -- 0:00:16
Average standard deviation of split frequencies: 0.007116
765500 -- [-962.441] (-960.712) (-960.958) (-961.333) * (-964.639) [-960.858] (-964.040) (-961.686) -- 0:00:16
766000 -- [-964.061] (-960.554) (-964.931) (-964.881) * (-963.826) (-964.946) (-963.024) [-963.041] -- 0:00:16
766500 -- (-961.570) (-966.547) (-959.246) [-968.674] * (-959.484) (-967.904) [-959.713] (-961.591) -- 0:00:16
767000 -- (-960.423) (-963.677) [-961.988] (-967.197) * (-962.365) [-960.764] (-959.538) (-962.471) -- 0:00:16
767500 -- [-960.631] (-969.690) (-964.581) (-963.200) * [-958.133] (-964.078) (-960.775) (-965.271) -- 0:00:16
768000 -- (-961.745) (-960.740) [-962.182] (-960.930) * (-965.782) (-959.863) [-959.282] (-963.801) -- 0:00:16
768500 -- (-963.198) (-961.370) [-963.155] (-961.168) * (-959.196) (-960.536) (-961.650) [-960.951] -- 0:00:15
769000 -- (-964.102) [-962.545] (-963.422) (-965.596) * (-964.836) (-961.950) [-960.913] (-961.750) -- 0:00:15
769500 -- [-959.276] (-958.994) (-966.046) (-965.789) * [-960.444] (-960.638) (-965.164) (-961.404) -- 0:00:15
770000 -- (-962.598) (-960.116) (-961.469) [-962.684] * (-960.600) [-959.246] (-964.381) (-967.699) -- 0:00:15
Average standard deviation of split frequencies: 0.007302
770500 -- (-963.953) [-959.358] (-965.181) (-961.296) * (-960.541) [-961.482] (-962.534) (-961.727) -- 0:00:15
771000 -- (-965.179) [-963.294] (-961.470) (-964.335) * (-959.616) (-960.123) [-959.660] (-962.776) -- 0:00:15
771500 -- (-961.932) [-962.139] (-961.666) (-964.092) * [-963.960] (-960.867) (-961.932) (-962.279) -- 0:00:15
772000 -- (-960.618) (-961.621) [-960.314] (-962.868) * [-963.673] (-960.544) (-962.427) (-963.661) -- 0:00:15
772500 -- [-960.332] (-961.470) (-961.718) (-967.300) * (-961.151) [-960.247] (-963.057) (-962.091) -- 0:00:15
773000 -- [-959.344] (-965.413) (-960.968) (-968.205) * [-958.200] (-959.356) (-962.787) (-960.039) -- 0:00:15
773500 -- (-960.382) (-962.045) [-960.007] (-964.572) * (-959.354) [-961.170] (-964.840) (-962.733) -- 0:00:15
774000 -- (-961.746) [-961.347] (-963.430) (-960.016) * [-960.271] (-964.448) (-963.192) (-964.468) -- 0:00:15
774500 -- [-961.033] (-963.196) (-963.933) (-960.805) * (-959.988) (-959.677) (-962.356) [-965.021] -- 0:00:15
775000 -- (-961.002) (-964.984) (-964.672) [-960.492] * (-962.886) (-959.947) [-960.446] (-964.212) -- 0:00:15
Average standard deviation of split frequencies: 0.007669
775500 -- (-961.887) (-960.638) [-961.266] (-961.709) * (-964.919) (-964.691) [-961.541] (-963.679) -- 0:00:15
776000 -- (-961.005) (-960.593) [-960.778] (-960.963) * (-962.771) (-963.030) (-960.486) [-958.683] -- 0:00:15
776500 -- (-963.253) (-959.817) (-965.207) [-964.122] * (-962.630) (-964.683) [-962.006] (-965.731) -- 0:00:15
777000 -- (-965.119) [-960.571] (-970.028) (-963.112) * (-964.580) (-964.018) [-967.269] (-962.954) -- 0:00:15
777500 -- (-961.799) [-961.383] (-966.085) (-966.130) * (-965.402) [-963.139] (-967.281) (-963.791) -- 0:00:15
778000 -- (-961.781) [-961.960] (-964.406) (-963.909) * (-962.321) (-961.186) [-962.143] (-965.542) -- 0:00:15
778500 -- [-959.510] (-963.357) (-964.402) (-963.263) * (-963.567) (-959.348) (-965.005) [-959.722] -- 0:00:15
779000 -- (-961.924) [-963.909] (-964.106) (-963.195) * (-960.737) [-958.660] (-963.830) (-959.914) -- 0:00:15
779500 -- [-962.770] (-962.776) (-967.138) (-961.949) * (-958.869) [-960.805] (-965.356) (-959.430) -- 0:00:15
780000 -- [-963.290] (-959.271) (-962.333) (-962.705) * (-959.872) (-962.307) [-963.011] (-960.923) -- 0:00:15
Average standard deviation of split frequencies: 0.007850
780500 -- [-961.437] (-962.215) (-968.646) (-963.578) * (-960.407) (-960.445) (-964.350) [-963.450] -- 0:00:15
781000 -- [-961.103] (-960.097) (-964.382) (-962.561) * (-961.856) [-964.119] (-966.734) (-963.691) -- 0:00:15
781500 -- (-961.804) (-965.015) (-965.341) [-959.837] * [-961.909] (-961.967) (-965.908) (-963.189) -- 0:00:15
782000 -- [-959.377] (-961.673) (-962.158) (-961.640) * (-962.870) [-961.325] (-962.776) (-960.447) -- 0:00:15
782500 -- [-962.979] (-960.952) (-961.416) (-962.366) * (-959.987) [-961.847] (-960.858) (-959.479) -- 0:00:15
783000 -- [-960.156] (-962.629) (-963.062) (-961.938) * (-959.144) [-961.373] (-963.853) (-960.908) -- 0:00:14
783500 -- [-959.841] (-960.697) (-963.937) (-963.158) * (-961.346) [-960.147] (-966.180) (-967.157) -- 0:00:14
784000 -- (-969.765) (-959.024) (-965.030) [-960.661] * (-961.870) (-962.812) (-964.654) [-961.761] -- 0:00:14
784500 -- [-960.532] (-960.267) (-967.010) (-965.509) * (-962.932) (-960.986) (-962.007) [-963.739] -- 0:00:14
785000 -- (-962.384) [-963.923] (-965.668) (-959.833) * (-963.775) [-964.239] (-967.834) (-961.375) -- 0:00:14
Average standard deviation of split frequencies: 0.008059
785500 -- (-963.551) (-960.471) (-963.978) [-959.293] * (-964.885) [-962.476] (-966.975) (-963.787) -- 0:00:14
786000 -- (-962.323) (-959.760) (-963.251) [-961.316] * (-958.167) [-964.456] (-963.413) (-962.306) -- 0:00:14
786500 -- (-960.643) (-961.693) [-961.928] (-964.248) * [-960.416] (-965.543) (-963.499) (-963.807) -- 0:00:14
787000 -- (-960.730) (-962.539) (-960.857) [-963.354] * [-961.768] (-963.688) (-961.068) (-962.376) -- 0:00:14
787500 -- (-960.057) (-961.418) (-966.283) [-965.783] * [-962.782] (-966.748) (-962.312) (-963.885) -- 0:00:14
788000 -- (-963.840) (-961.957) (-961.553) [-961.667] * [-960.044] (-964.649) (-961.591) (-960.531) -- 0:00:14
788500 -- (-965.648) (-968.296) (-961.571) [-962.499] * [-963.634] (-961.987) (-963.584) (-964.025) -- 0:00:14
789000 -- (-965.632) (-961.206) [-960.274] (-966.464) * [-961.696] (-960.222) (-965.630) (-963.907) -- 0:00:14
789500 -- (-965.637) [-963.949] (-963.421) (-964.918) * (-960.613) [-959.689] (-963.908) (-960.495) -- 0:00:14
790000 -- (-965.922) (-963.546) (-963.300) [-960.375] * (-960.934) [-961.417] (-966.315) (-961.847) -- 0:00:14
Average standard deviation of split frequencies: 0.008198
790500 -- [-960.846] (-962.418) (-964.941) (-964.624) * (-964.904) (-960.447) (-959.500) [-960.895] -- 0:00:14
791000 -- (-966.282) [-964.236] (-959.848) (-963.726) * (-964.524) (-963.082) (-962.287) [-966.823] -- 0:00:14
791500 -- (-968.292) (-964.986) [-963.039] (-966.127) * [-965.982] (-961.108) (-963.318) (-961.986) -- 0:00:14
792000 -- (-964.345) [-964.777] (-963.686) (-961.726) * (-961.154) (-959.512) [-961.965] (-959.993) -- 0:00:14
792500 -- [-960.964] (-964.750) (-961.292) (-964.589) * (-962.503) (-960.641) (-960.155) [-961.930] -- 0:00:14
793000 -- (-962.666) (-964.848) [-961.551] (-964.771) * (-961.974) (-962.609) [-966.335] (-962.752) -- 0:00:14
793500 -- (-962.309) [-961.022] (-969.676) (-961.354) * (-960.488) [-963.140] (-960.058) (-961.746) -- 0:00:14
794000 -- (-965.758) (-960.892) (-962.516) [-963.072] * (-962.309) (-959.754) (-962.972) [-963.736] -- 0:00:14
794500 -- [-960.899] (-958.726) (-962.023) (-964.103) * (-960.476) (-963.959) [-962.780] (-964.213) -- 0:00:14
795000 -- (-964.863) [-958.558] (-964.735) (-962.150) * (-964.862) [-962.179] (-960.960) (-964.820) -- 0:00:14
Average standard deviation of split frequencies: 0.008143
795500 -- (-964.587) (-960.059) (-962.199) [-958.481] * (-963.135) (-961.553) (-964.370) [-968.988] -- 0:00:14
796000 -- (-963.138) (-961.895) [-961.185] (-965.942) * [-960.990] (-960.569) (-960.309) (-963.429) -- 0:00:14
796500 -- (-963.876) (-961.204) [-960.606] (-963.032) * (-963.651) [-963.505] (-963.047) (-966.118) -- 0:00:14
797000 -- (-960.145) (-962.857) [-961.614] (-963.671) * [-963.649] (-960.948) (-963.816) (-968.336) -- 0:00:14
797500 -- (-963.449) (-960.348) (-960.037) [-962.594] * (-964.934) (-963.431) (-964.181) [-966.051] -- 0:00:13
798000 -- (-965.192) [-963.393] (-964.548) (-961.083) * (-960.442) (-960.070) [-962.773] (-964.843) -- 0:00:13
798500 -- (-968.670) (-960.224) [-959.931] (-959.593) * [-958.719] (-963.171) (-962.155) (-963.384) -- 0:00:13
799000 -- (-965.779) (-961.397) [-960.606] (-962.400) * (-961.906) (-964.597) (-962.508) [-964.009] -- 0:00:13
799500 -- (-963.668) (-961.055) (-959.133) [-962.481] * (-964.303) [-962.925] (-962.811) (-963.711) -- 0:00:13
800000 -- (-963.279) (-959.640) (-960.311) [-961.316] * (-964.439) [-959.786] (-960.349) (-970.846) -- 0:00:13
Average standard deviation of split frequencies: 0.008280
800500 -- (-966.544) (-959.384) [-961.086] (-963.903) * (-962.090) [-959.282] (-962.547) (-962.103) -- 0:00:13
801000 -- (-960.650) [-959.864] (-966.800) (-962.219) * (-961.477) [-959.796] (-960.356) (-964.838) -- 0:00:13
801500 -- (-962.913) [-960.356] (-964.137) (-962.461) * (-962.441) (-962.794) (-961.074) [-960.871] -- 0:00:13
802000 -- (-961.165) (-962.397) (-960.323) [-960.478] * (-965.080) (-961.193) [-962.465] (-964.130) -- 0:00:13
802500 -- [-960.728] (-960.725) (-962.942) (-965.227) * [-959.633] (-962.535) (-966.733) (-964.006) -- 0:00:13
803000 -- [-961.735] (-961.069) (-961.045) (-963.041) * (-963.971) (-961.760) [-961.719] (-963.319) -- 0:00:13
803500 -- (-965.223) [-959.728] (-962.725) (-959.701) * (-960.691) (-966.341) [-963.244] (-961.580) -- 0:00:13
804000 -- [-962.443] (-959.467) (-959.684) (-961.101) * [-960.106] (-965.693) (-964.345) (-963.677) -- 0:00:13
804500 -- (-962.897) [-960.322] (-962.160) (-963.060) * (-967.722) [-961.993] (-963.197) (-968.314) -- 0:00:13
805000 -- (-961.785) (-965.294) [-961.533] (-961.605) * (-963.217) (-964.494) (-962.231) [-964.417] -- 0:00:13
Average standard deviation of split frequencies: 0.007859
805500 -- (-962.434) (-962.635) [-959.910] (-959.946) * [-959.214] (-961.311) (-962.116) (-962.835) -- 0:00:13
806000 -- (-963.156) (-965.235) [-959.844] (-964.735) * (-961.934) [-963.903] (-960.079) (-960.227) -- 0:00:13
806500 -- (-965.295) (-958.723) [-961.367] (-965.992) * (-964.232) (-962.742) [-961.142] (-963.805) -- 0:00:13
807000 -- (-965.616) (-960.670) [-963.007] (-960.416) * (-962.508) (-961.654) (-960.286) [-965.601] -- 0:00:13
807500 -- (-964.904) (-966.233) [-959.718] (-959.837) * (-960.840) (-963.554) [-961.687] (-966.588) -- 0:00:13
808000 -- [-962.759] (-967.263) (-959.784) (-960.995) * (-959.415) (-964.074) [-960.139] (-966.500) -- 0:00:13
808500 -- (-963.717) (-962.187) (-960.467) [-960.939] * [-965.329] (-963.233) (-963.755) (-961.648) -- 0:00:13
809000 -- (-963.710) (-962.556) [-961.466] (-960.074) * (-964.568) (-963.285) [-961.932] (-962.531) -- 0:00:13
809500 -- (-963.872) (-961.236) [-959.160] (-961.902) * (-960.418) [-959.923] (-960.826) (-963.149) -- 0:00:13
810000 -- [-963.943] (-960.563) (-959.897) (-961.811) * (-964.257) (-960.307) (-961.523) [-964.304] -- 0:00:13
Average standard deviation of split frequencies: 0.007792
810500 -- (-962.889) (-963.462) [-961.414] (-961.903) * [-963.512] (-960.317) (-967.396) (-964.673) -- 0:00:13
811000 -- (-970.438) (-963.670) (-961.882) [-960.783] * (-960.190) [-960.956] (-961.258) (-964.975) -- 0:00:13
811500 -- (-967.953) (-959.271) (-963.599) [-960.007] * [-958.735] (-960.842) (-959.337) (-963.512) -- 0:00:13
812000 -- (-968.402) [-960.213] (-962.233) (-961.093) * (-961.316) (-962.770) [-959.817] (-962.457) -- 0:00:12
812500 -- (-962.940) (-962.410) (-962.407) [-963.055] * (-964.709) (-959.550) (-963.803) [-961.905] -- 0:00:12
813000 -- [-960.198] (-963.590) (-964.227) (-962.471) * (-966.321) (-963.291) (-966.947) [-962.280] -- 0:00:12
813500 -- (-963.690) (-965.445) [-966.082] (-962.210) * (-961.193) (-958.581) (-967.158) [-960.752] -- 0:00:12
814000 -- (-961.573) [-959.854] (-962.864) (-963.015) * (-962.046) [-962.191] (-961.840) (-961.613) -- 0:00:12
814500 -- (-961.853) (-960.921) (-965.971) [-961.292] * (-960.720) [-961.521] (-966.237) (-961.622) -- 0:00:12
815000 -- (-962.346) (-961.597) [-963.873] (-963.343) * [-959.892] (-962.772) (-961.273) (-961.667) -- 0:00:12
Average standard deviation of split frequencies: 0.007279
815500 -- (-960.191) (-961.886) (-962.700) [-959.804] * [-960.984] (-962.164) (-961.830) (-960.703) -- 0:00:12
816000 -- (-961.738) (-962.014) (-961.770) [-962.135] * (-963.208) (-961.765) (-968.568) [-958.571] -- 0:00:12
816500 -- (-964.374) [-965.453] (-964.852) (-967.482) * [-962.846] (-962.165) (-965.369) (-960.899) -- 0:00:12
817000 -- [-964.773] (-961.895) (-961.616) (-963.476) * (-965.886) (-966.658) (-960.483) [-963.973] -- 0:00:12
817500 -- [-963.329] (-961.597) (-963.165) (-963.818) * (-963.617) [-960.746] (-964.671) (-962.217) -- 0:00:12
818000 -- [-961.670] (-959.841) (-961.189) (-962.093) * [-963.030] (-961.281) (-963.465) (-962.209) -- 0:00:12
818500 -- (-959.147) (-961.836) (-962.116) [-960.512] * (-962.226) [-961.081] (-961.295) (-962.036) -- 0:00:12
819000 -- [-961.869] (-961.323) (-964.101) (-961.469) * (-962.106) [-961.034] (-961.534) (-962.252) -- 0:00:12
819500 -- (-962.214) (-962.472) (-959.079) [-964.436] * (-961.773) [-960.691] (-961.890) (-959.739) -- 0:00:12
820000 -- [-958.620] (-959.088) (-961.957) (-960.860) * [-964.242] (-961.586) (-961.059) (-958.620) -- 0:00:12
Average standard deviation of split frequencies: 0.007391
820500 -- [-962.272] (-960.057) (-963.773) (-961.987) * [-961.144] (-965.237) (-965.797) (-961.137) -- 0:00:12
821000 -- [-960.614] (-963.110) (-961.740) (-968.717) * [-961.210] (-962.955) (-964.247) (-962.581) -- 0:00:12
821500 -- (-961.167) [-960.829] (-962.500) (-960.590) * [-962.640] (-963.713) (-962.407) (-961.818) -- 0:00:12
822000 -- [-963.895] (-961.229) (-962.127) (-959.874) * (-961.398) [-958.593] (-964.277) (-964.349) -- 0:00:12
822500 -- (-961.278) [-959.379] (-962.609) (-963.380) * (-962.961) (-959.185) (-961.070) [-960.983] -- 0:00:12
823000 -- (-961.516) (-960.894) (-960.337) [-962.932] * (-969.037) (-962.056) (-965.070) [-963.043] -- 0:00:12
823500 -- (-965.331) (-959.150) [-962.154] (-961.325) * (-970.171) (-962.500) (-961.728) [-962.566] -- 0:00:12
824000 -- (-962.317) (-963.721) [-961.250] (-966.871) * (-975.579) (-959.650) (-960.244) [-961.873] -- 0:00:12
824500 -- (-962.058) (-960.273) (-960.994) [-965.641] * (-962.046) (-959.603) [-959.925] (-962.214) -- 0:00:12
825000 -- (-967.469) (-967.235) (-967.097) [-966.391] * (-964.355) [-959.938] (-959.790) (-966.097) -- 0:00:12
Average standard deviation of split frequencies: 0.007381
825500 -- (-963.829) (-959.231) (-960.148) [-962.075] * (-964.579) [-959.378] (-962.563) (-961.659) -- 0:00:12
826000 -- (-962.683) (-961.872) [-960.225] (-963.773) * [-960.991] (-967.564) (-964.384) (-963.840) -- 0:00:12
826500 -- (-960.587) (-959.963) (-959.814) [-963.555] * (-959.873) (-963.752) (-964.794) [-965.144] -- 0:00:11
827000 -- (-962.748) (-960.995) (-962.849) [-960.639] * (-960.480) (-962.000) [-962.820] (-962.478) -- 0:00:11
827500 -- (-961.249) (-963.147) [-961.664] (-963.888) * (-960.628) (-965.559) (-962.444) [-960.698] -- 0:00:11
828000 -- [-961.749] (-962.296) (-963.338) (-962.392) * (-959.604) (-966.032) (-959.931) [-961.492] -- 0:00:11
828500 -- (-960.643) (-962.359) [-960.750] (-959.227) * (-964.897) (-961.841) (-962.184) [-960.947] -- 0:00:11
829000 -- [-965.839] (-961.046) (-959.409) (-964.632) * (-960.602) (-961.350) (-963.313) [-960.815] -- 0:00:11
829500 -- [-963.543] (-961.793) (-960.915) (-963.422) * (-962.784) (-964.534) [-960.700] (-960.424) -- 0:00:11
830000 -- [-963.618] (-965.441) (-960.319) (-960.885) * (-964.003) (-965.746) (-961.602) [-965.659] -- 0:00:11
Average standard deviation of split frequencies: 0.007756
830500 -- [-963.898] (-965.557) (-959.900) (-961.283) * (-966.043) (-970.895) (-961.675) [-959.926] -- 0:00:11
831000 -- (-965.300) (-964.427) [-962.912] (-962.220) * [-963.732] (-963.513) (-961.452) (-961.771) -- 0:00:11
831500 -- (-965.842) (-966.710) (-964.382) [-961.781] * (-962.334) (-960.730) (-961.829) [-960.530] -- 0:00:11
832000 -- (-963.541) (-961.731) [-959.500] (-962.944) * [-961.739] (-962.236) (-963.758) (-962.022) -- 0:00:11
832500 -- (-965.415) (-959.484) [-961.304] (-966.358) * (-966.348) [-962.649] (-963.543) (-962.993) -- 0:00:11
833000 -- [-960.419] (-960.451) (-962.100) (-967.679) * (-961.242) (-964.561) [-964.427] (-965.592) -- 0:00:11
833500 -- (-961.151) (-963.225) [-964.758] (-960.612) * (-963.283) (-964.279) [-962.874] (-962.418) -- 0:00:11
834000 -- [-961.561] (-965.564) (-959.902) (-962.813) * [-962.193] (-964.315) (-964.753) (-964.741) -- 0:00:11
834500 -- (-960.660) [-959.603] (-963.511) (-962.752) * [-959.654] (-963.719) (-964.476) (-961.721) -- 0:00:11
835000 -- [-960.802] (-962.545) (-964.566) (-961.602) * (-961.620) (-962.570) [-960.916] (-960.490) -- 0:00:11
Average standard deviation of split frequencies: 0.007142
835500 -- (-965.232) [-960.610] (-963.888) (-959.993) * (-962.854) [-962.903] (-961.749) (-964.163) -- 0:00:11
836000 -- (-961.412) (-963.161) [-961.159] (-964.681) * [-963.334] (-961.108) (-960.785) (-965.645) -- 0:00:11
836500 -- (-964.451) (-964.335) [-963.278] (-960.377) * (-961.858) [-963.215] (-965.672) (-962.646) -- 0:00:11
837000 -- [-964.668] (-959.620) (-962.418) (-962.698) * (-962.263) [-964.613] (-962.794) (-964.792) -- 0:00:11
837500 -- (-963.586) (-960.604) [-961.251] (-960.735) * [-962.544] (-962.005) (-965.192) (-963.424) -- 0:00:11
838000 -- (-963.582) (-959.177) (-963.981) [-960.554] * (-962.466) [-960.428] (-972.604) (-961.164) -- 0:00:11
838500 -- (-959.614) (-963.310) (-961.064) [-960.803] * [-959.326] (-961.785) (-962.820) (-961.974) -- 0:00:10
839000 -- (-961.711) [-965.864] (-965.681) (-963.548) * (-961.680) [-965.392] (-965.760) (-964.298) -- 0:00:11
839500 -- [-964.157] (-964.961) (-964.156) (-963.926) * (-964.408) [-964.181] (-962.649) (-960.245) -- 0:00:11
840000 -- (-963.418) [-959.365] (-961.950) (-961.750) * (-963.907) [-960.157] (-963.861) (-962.188) -- 0:00:11
Average standard deviation of split frequencies: 0.007402
840500 -- (-960.698) [-962.999] (-962.527) (-961.946) * (-959.371) [-961.719] (-961.026) (-961.264) -- 0:00:11
841000 -- (-960.210) [-963.430] (-960.924) (-962.048) * [-963.212] (-967.845) (-962.491) (-961.717) -- 0:00:10
841500 -- (-962.504) (-960.804) (-962.388) [-960.980] * (-960.695) (-961.393) (-965.481) [-964.274] -- 0:00:10
842000 -- [-964.238] (-961.546) (-964.569) (-961.865) * [-959.243] (-966.695) (-961.748) (-965.246) -- 0:00:10
842500 -- [-961.772] (-961.903) (-968.311) (-963.565) * [-965.365] (-972.932) (-960.515) (-965.620) -- 0:00:10
843000 -- (-970.507) [-961.712] (-963.344) (-964.500) * (-962.347) (-963.739) (-964.175) [-963.362] -- 0:00:10
843500 -- (-962.640) [-966.262] (-962.473) (-961.637) * (-961.810) (-963.804) [-960.695] (-963.827) -- 0:00:10
844000 -- (-965.790) (-965.892) [-961.194] (-960.372) * (-962.955) (-970.666) [-960.225] (-962.805) -- 0:00:10
844500 -- (-963.867) (-962.568) [-963.234] (-960.380) * (-961.464) (-965.365) (-960.469) [-959.668] -- 0:00:10
845000 -- (-961.569) (-961.566) (-963.840) [-960.045] * (-964.186) (-968.008) [-959.296] (-960.959) -- 0:00:10
Average standard deviation of split frequencies: 0.007764
845500 -- (-959.299) (-958.740) (-962.945) [-964.459] * (-962.539) (-964.090) (-964.039) [-965.428] -- 0:00:10
846000 -- [-961.124] (-959.320) (-961.569) (-964.121) * (-963.365) (-963.759) (-960.865) [-960.273] -- 0:00:10
846500 -- [-961.758] (-965.750) (-963.247) (-961.194) * (-963.311) (-964.130) (-964.341) [-963.543] -- 0:00:10
847000 -- [-966.137] (-964.378) (-962.230) (-962.320) * (-961.613) (-961.824) (-961.122) [-960.662] -- 0:00:10
847500 -- (-961.594) (-961.226) [-961.366] (-962.457) * (-962.492) (-963.740) [-962.135] (-963.181) -- 0:00:10
848000 -- [-962.294] (-962.709) (-961.751) (-964.386) * (-960.847) [-964.771] (-968.932) (-962.310) -- 0:00:10
848500 -- (-966.734) (-966.250) (-963.560) [-960.924] * [-963.312] (-966.397) (-968.163) (-967.685) -- 0:00:10
849000 -- [-962.379] (-963.219) (-960.647) (-961.623) * (-960.720) (-965.459) [-961.739] (-964.081) -- 0:00:10
849500 -- (-963.374) (-963.341) [-961.945] (-958.615) * [-964.331] (-965.935) (-967.822) (-963.605) -- 0:00:10
850000 -- (-965.546) (-960.217) (-961.762) [-959.984] * [-963.619] (-960.796) (-965.013) (-960.403) -- 0:00:10
Average standard deviation of split frequencies: 0.007832
850500 -- (-967.411) [-961.302] (-960.098) (-962.873) * (-962.652) (-964.431) [-960.745] (-964.592) -- 0:00:10
851000 -- (-969.034) (-962.104) [-965.134] (-963.591) * [-961.879] (-965.646) (-964.577) (-967.547) -- 0:00:10
851500 -- (-968.091) (-962.476) (-961.191) [-959.507] * (-964.446) (-963.495) [-963.286] (-963.872) -- 0:00:10
852000 -- (-963.536) (-963.243) (-964.311) [-962.564] * (-964.431) [-967.730] (-965.660) (-959.922) -- 0:00:10
852500 -- (-964.382) [-962.005] (-970.192) (-961.251) * (-962.181) [-963.867] (-961.899) (-962.760) -- 0:00:10
853000 -- [-964.492] (-962.066) (-968.560) (-963.091) * (-965.430) [-960.511] (-962.083) (-962.994) -- 0:00:09
853500 -- (-963.149) [-961.365] (-965.799) (-964.937) * (-963.843) (-964.735) (-965.742) [-960.571] -- 0:00:09
854000 -- (-962.190) (-960.272) (-962.559) [-962.890] * (-965.513) (-963.426) [-961.445] (-962.394) -- 0:00:10
854500 -- (-961.707) [-964.229] (-964.241) (-961.841) * (-963.075) (-961.954) [-959.113] (-961.533) -- 0:00:10
855000 -- [-962.125] (-960.510) (-963.050) (-962.225) * (-965.087) (-962.832) (-962.802) [-963.966] -- 0:00:10
Average standard deviation of split frequencies: 0.007453
855500 -- (-964.135) [-960.671] (-962.936) (-960.344) * (-963.173) [-959.463] (-959.555) (-966.914) -- 0:00:09
856000 -- (-960.019) [-960.140] (-964.478) (-966.468) * (-962.466) [-960.236] (-962.649) (-963.481) -- 0:00:09
856500 -- (-960.242) (-964.104) [-961.892] (-963.042) * (-961.104) (-964.702) [-965.472] (-965.098) -- 0:00:09
857000 -- [-960.435] (-959.537) (-966.983) (-963.353) * (-960.594) [-960.433] (-967.476) (-963.286) -- 0:00:09
857500 -- (-962.960) (-964.174) (-969.835) [-962.881] * [-961.825] (-960.882) (-963.700) (-963.140) -- 0:00:09
858000 -- (-961.995) (-963.265) (-971.566) [-963.443] * (-960.122) [-961.010] (-961.469) (-961.148) -- 0:00:09
858500 -- (-963.747) [-964.579] (-966.424) (-964.036) * (-965.276) [-960.539] (-961.005) (-965.302) -- 0:00:09
859000 -- [-962.766] (-961.419) (-969.317) (-963.270) * (-960.534) (-960.435) [-961.443] (-960.937) -- 0:00:09
859500 -- [-962.756] (-964.111) (-958.688) (-966.993) * (-962.191) (-963.214) (-960.956) [-963.359] -- 0:00:09
860000 -- (-960.647) (-963.415) (-961.700) [-962.682] * (-959.838) (-965.080) [-961.386] (-962.189) -- 0:00:09
Average standard deviation of split frequencies: 0.006847
860500 -- (-966.381) (-961.541) [-962.426] (-964.433) * (-960.873) [-961.192] (-960.674) (-960.501) -- 0:00:09
861000 -- (-965.772) (-967.345) (-965.128) [-959.899] * (-963.983) (-967.768) [-962.363] (-962.046) -- 0:00:09
861500 -- (-966.058) [-961.138] (-963.154) (-959.470) * (-961.174) [-962.278] (-965.531) (-963.398) -- 0:00:09
862000 -- (-963.693) (-963.553) (-961.887) [-960.221] * (-963.534) [-963.871] (-960.750) (-964.065) -- 0:00:09
862500 -- (-961.486) (-960.204) [-959.050] (-959.366) * (-962.278) (-959.717) [-963.288] (-964.742) -- 0:00:09
863000 -- (-961.537) [-960.822] (-960.347) (-961.560) * (-962.650) [-959.987] (-964.879) (-963.132) -- 0:00:09
863500 -- (-960.004) (-960.741) (-961.054) [-960.237] * (-960.224) (-966.558) [-964.222] (-961.756) -- 0:00:09
864000 -- (-962.775) (-959.507) (-963.133) [-962.390] * (-961.091) (-961.712) (-962.234) [-963.698] -- 0:00:09
864500 -- (-964.274) [-963.102] (-962.772) (-963.498) * (-962.919) (-961.800) [-965.274] (-965.372) -- 0:00:09
865000 -- (-964.704) (-960.483) [-961.422] (-963.367) * (-961.557) (-959.575) [-962.536] (-962.498) -- 0:00:09
Average standard deviation of split frequencies: 0.007451
865500 -- (-960.670) [-963.107] (-963.764) (-961.634) * (-961.157) [-965.043] (-966.166) (-963.654) -- 0:00:09
866000 -- [-962.376] (-962.261) (-962.860) (-960.127) * (-960.191) (-966.081) [-965.799] (-960.122) -- 0:00:09
866500 -- (-959.999) (-962.676) (-963.833) [-961.822] * [-959.859] (-963.905) (-961.031) (-963.505) -- 0:00:09
867000 -- (-961.062) [-960.281] (-962.682) (-960.312) * (-961.529) (-959.596) (-964.326) [-958.545] -- 0:00:09
867500 -- (-960.041) (-964.188) [-960.590] (-961.933) * [-961.164] (-961.535) (-962.788) (-959.154) -- 0:00:09
868000 -- (-964.167) [-962.344] (-965.930) (-961.151) * [-960.170] (-961.650) (-961.961) (-963.152) -- 0:00:08
868500 -- [-963.921] (-962.097) (-975.432) (-965.382) * (-960.313) [-960.012] (-963.070) (-963.883) -- 0:00:08
869000 -- (-961.968) [-963.959] (-960.930) (-963.587) * (-960.815) (-963.160) [-966.303] (-961.400) -- 0:00:08
869500 -- (-961.676) (-964.580) [-964.845] (-962.672) * (-964.227) (-961.136) [-960.555] (-968.954) -- 0:00:09
870000 -- (-959.931) [-962.860] (-962.149) (-966.149) * (-961.737) [-961.816] (-959.614) (-967.110) -- 0:00:08
Average standard deviation of split frequencies: 0.007905
870500 -- (-961.532) [-961.950] (-964.709) (-962.136) * (-961.621) (-961.734) (-964.147) [-963.457] -- 0:00:08
871000 -- (-963.115) (-962.255) [-967.444] (-962.280) * [-961.403] (-967.643) (-962.742) (-962.604) -- 0:00:08
871500 -- (-962.493) [-959.923] (-970.967) (-959.900) * (-964.421) (-962.841) [-960.493] (-962.077) -- 0:00:08
872000 -- (-962.805) (-962.687) [-967.534] (-966.111) * [-961.238] (-965.907) (-962.413) (-962.358) -- 0:00:08
872500 -- (-964.794) (-964.627) (-965.404) [-961.924] * [-961.288] (-964.507) (-961.269) (-963.660) -- 0:00:08
873000 -- [-961.322] (-962.501) (-962.014) (-961.216) * [-962.133] (-960.185) (-961.412) (-960.267) -- 0:00:08
873500 -- (-962.061) [-964.338] (-961.233) (-963.428) * (-962.772) (-964.661) [-963.303] (-961.158) -- 0:00:08
874000 -- (-960.799) (-961.366) [-959.612] (-967.259) * (-963.639) (-959.432) (-964.013) [-961.216] -- 0:00:08
874500 -- [-959.763] (-964.021) (-962.168) (-964.105) * [-959.809] (-962.786) (-961.313) (-964.021) -- 0:00:08
875000 -- (-964.848) [-964.420] (-963.142) (-962.429) * [-959.929] (-961.709) (-961.697) (-965.541) -- 0:00:08
Average standard deviation of split frequencies: 0.007749
875500 -- (-961.995) (-961.140) [-959.549] (-962.531) * (-965.504) (-963.312) [-962.149] (-960.774) -- 0:00:08
876000 -- (-965.682) (-964.508) (-961.396) [-963.151] * (-963.012) [-962.328] (-961.022) (-960.103) -- 0:00:08
876500 -- [-967.677] (-960.324) (-962.051) (-963.328) * [-958.665] (-963.904) (-960.269) (-961.407) -- 0:00:08
877000 -- (-962.172) (-962.713) (-959.856) [-963.236] * (-959.972) (-963.088) (-963.296) [-961.408] -- 0:00:08
877500 -- (-960.995) (-960.153) (-963.884) [-961.449] * (-960.815) (-958.381) (-959.873) [-959.877] -- 0:00:08
878000 -- (-963.120) (-960.801) [-962.180] (-962.110) * (-961.105) (-961.625) [-961.250] (-959.387) -- 0:00:08
878500 -- (-960.595) (-962.416) [-962.326] (-959.625) * (-961.769) (-964.556) [-961.210] (-965.176) -- 0:00:08
879000 -- (-964.464) (-962.620) (-960.370) [-965.092] * (-964.563) (-961.042) [-964.682] (-959.682) -- 0:00:08
879500 -- [-964.110] (-962.547) (-962.830) (-961.519) * (-959.535) (-960.947) (-961.358) [-964.878] -- 0:00:08
880000 -- (-965.618) (-961.879) (-964.461) [-963.977] * (-962.164) (-961.437) (-963.603) [-959.410] -- 0:00:08
Average standard deviation of split frequencies: 0.007744
880500 -- (-961.404) (-966.938) [-965.903] (-963.997) * (-966.595) [-959.082] (-962.658) (-963.310) -- 0:00:08
881000 -- (-961.730) (-966.903) (-961.696) [-959.376] * (-963.243) (-962.893) [-964.349] (-960.517) -- 0:00:08
881500 -- (-964.461) (-963.912) [-961.932] (-962.387) * (-963.224) (-960.085) [-964.498] (-962.966) -- 0:00:08
882000 -- [-959.775] (-965.282) (-962.923) (-961.396) * (-964.608) [-961.396] (-964.537) (-962.953) -- 0:00:08
882500 -- (-963.069) (-960.535) [-962.982] (-965.681) * (-962.821) (-963.338) [-965.087] (-962.481) -- 0:00:07
883000 -- [-961.724] (-963.058) (-960.974) (-960.712) * (-963.248) (-968.931) [-961.520] (-963.366) -- 0:00:07
883500 -- (-963.449) [-960.942] (-961.374) (-962.092) * (-963.741) (-964.848) (-963.909) [-960.329] -- 0:00:07
884000 -- [-963.916] (-963.551) (-961.288) (-960.902) * (-964.479) (-963.132) [-966.043] (-963.482) -- 0:00:07
884500 -- (-964.562) (-968.191) (-962.896) [-960.085] * (-962.122) (-964.265) [-964.620] (-969.542) -- 0:00:07
885000 -- (-961.220) [-963.180] (-962.778) (-961.051) * (-962.562) [-961.038] (-963.638) (-969.553) -- 0:00:07
Average standard deviation of split frequencies: 0.007520
885500 -- [-961.332] (-964.428) (-961.634) (-962.404) * (-962.085) [-961.952] (-960.778) (-966.193) -- 0:00:07
886000 -- [-960.722] (-963.466) (-960.560) (-960.859) * (-963.141) [-964.101] (-963.193) (-962.335) -- 0:00:07
886500 -- (-962.224) (-963.382) (-960.043) [-960.296] * (-962.274) (-959.225) (-961.128) [-960.159] -- 0:00:07
887000 -- (-964.482) (-962.767) [-962.625] (-960.452) * (-962.045) (-960.604) (-959.937) [-959.492] -- 0:00:07
887500 -- (-962.883) (-961.780) [-959.393] (-961.630) * (-962.379) [-960.297] (-962.327) (-960.423) -- 0:00:07
888000 -- (-960.770) (-961.258) [-960.740] (-960.899) * (-965.185) (-964.243) (-965.621) [-960.088] -- 0:00:07
888500 -- (-963.298) [-964.137] (-959.529) (-961.686) * (-961.820) (-964.619) [-965.604] (-963.287) -- 0:00:07
889000 -- (-964.953) (-963.319) (-960.609) [-960.473] * (-960.260) (-960.839) (-960.657) [-960.113] -- 0:00:07
889500 -- (-962.515) [-962.527] (-958.107) (-962.048) * [-960.693] (-959.824) (-960.449) (-961.077) -- 0:00:07
890000 -- (-964.415) (-964.731) (-962.351) [-959.605] * (-960.719) (-961.205) (-959.309) [-959.470] -- 0:00:07
Average standard deviation of split frequencies: 0.007233
890500 -- (-961.525) (-965.238) (-961.820) [-964.403] * (-961.287) (-963.918) (-961.688) [-960.707] -- 0:00:07
891000 -- (-964.703) (-961.171) [-961.964] (-964.605) * (-963.726) [-958.864] (-961.070) (-962.061) -- 0:00:07
891500 -- [-961.011] (-965.200) (-961.517) (-959.987) * (-959.938) (-962.959) (-960.806) [-961.081] -- 0:00:07
892000 -- [-962.563] (-961.968) (-961.497) (-964.060) * (-964.483) [-963.486] (-961.628) (-963.877) -- 0:00:07
892500 -- [-961.024] (-961.208) (-960.223) (-960.588) * [-962.325] (-964.779) (-961.403) (-969.386) -- 0:00:07
893000 -- (-960.732) (-963.570) (-963.372) [-961.886] * [-963.055] (-962.482) (-960.502) (-962.812) -- 0:00:07
893500 -- (-963.282) [-966.159] (-960.148) (-968.303) * [-964.220] (-967.352) (-961.278) (-964.072) -- 0:00:07
894000 -- (-962.008) (-962.516) (-962.237) [-959.351] * (-961.453) (-961.388) [-961.783] (-965.021) -- 0:00:07
894500 -- [-960.969] (-961.062) (-963.597) (-960.288) * (-963.019) (-961.178) [-959.651] (-962.688) -- 0:00:07
895000 -- (-960.912) [-964.475] (-960.567) (-960.538) * (-963.673) [-961.471] (-963.392) (-965.290) -- 0:00:07
Average standard deviation of split frequencies: 0.007225
895500 -- (-963.999) (-963.443) (-961.000) [-961.004] * (-961.726) (-961.048) (-969.030) [-962.818] -- 0:00:07
896000 -- [-961.952] (-960.398) (-972.341) (-959.194) * (-958.825) (-964.125) (-963.004) [-964.428] -- 0:00:07
896500 -- (-963.647) (-963.208) (-962.742) [-958.839] * (-964.630) (-963.080) [-960.726] (-964.610) -- 0:00:07
897000 -- (-965.211) [-959.200] (-965.842) (-963.147) * (-962.256) (-959.378) (-959.872) [-962.827] -- 0:00:07
897500 -- [-961.310] (-960.457) (-961.587) (-960.857) * (-965.855) [-960.011] (-971.180) (-964.052) -- 0:00:06
898000 -- (-961.833) (-960.750) [-960.897] (-964.932) * (-959.631) (-964.073) (-966.533) [-961.114] -- 0:00:06
898500 -- [-963.712] (-962.233) (-960.302) (-964.454) * (-960.736) [-963.410] (-960.140) (-962.322) -- 0:00:06
899000 -- (-965.440) [-960.726] (-960.438) (-964.038) * (-964.306) [-960.668] (-960.612) (-966.218) -- 0:00:06
899500 -- (-960.024) (-969.513) (-962.338) [-961.836] * (-962.522) [-959.689] (-963.792) (-965.833) -- 0:00:06
900000 -- (-961.351) (-963.126) [-963.731] (-960.278) * (-963.939) (-961.689) (-961.361) [-961.844] -- 0:00:06
Average standard deviation of split frequencies: 0.007188
900500 -- (-962.310) (-963.195) (-964.514) [-960.961] * (-964.483) (-964.775) (-963.096) [-962.364] -- 0:00:06
901000 -- (-963.869) (-966.431) (-963.105) [-961.252] * (-962.543) (-965.370) [-959.973] (-962.216) -- 0:00:06
901500 -- (-963.009) [-959.600] (-962.368) (-962.077) * (-964.257) (-964.120) (-967.333) [-962.037] -- 0:00:06
902000 -- [-963.450] (-965.596) (-974.152) (-962.007) * [-960.726] (-964.256) (-966.151) (-965.610) -- 0:00:06
902500 -- (-962.943) [-961.875] (-959.786) (-963.658) * [-962.645] (-961.285) (-968.156) (-963.115) -- 0:00:06
903000 -- (-961.274) (-963.193) [-963.853] (-963.627) * (-960.625) [-963.353] (-961.694) (-962.264) -- 0:00:06
903500 -- (-959.598) (-966.124) [-960.599] (-964.894) * (-964.294) [-961.682] (-962.364) (-962.055) -- 0:00:06
904000 -- (-962.725) (-966.052) (-963.533) [-960.426] * (-965.575) (-960.200) [-963.441] (-964.197) -- 0:00:06
904500 -- (-961.239) (-959.635) [-961.750] (-963.698) * (-965.509) [-960.655] (-965.896) (-961.236) -- 0:00:06
905000 -- (-960.544) (-964.203) [-958.049] (-966.334) * [-965.255] (-962.249) (-968.308) (-967.244) -- 0:00:06
Average standard deviation of split frequencies: 0.007458
905500 -- (-962.052) [-962.281] (-964.836) (-965.844) * (-959.563) (-961.736) (-961.563) [-963.952] -- 0:00:06
906000 -- [-962.163] (-960.830) (-960.061) (-963.839) * [-963.145] (-965.053) (-966.962) (-965.825) -- 0:00:06
906500 -- [-961.789] (-964.861) (-958.836) (-964.116) * (-965.161) [-961.208] (-962.268) (-960.729) -- 0:00:06
907000 -- (-961.526) (-965.211) [-960.498] (-964.030) * (-964.137) (-962.225) [-961.099] (-964.898) -- 0:00:06
907500 -- [-961.017] (-962.275) (-963.711) (-965.314) * (-965.233) [-961.752] (-964.723) (-971.556) -- 0:00:06
908000 -- (-961.780) [-960.216] (-961.192) (-963.104) * (-963.970) [-961.329] (-968.115) (-960.397) -- 0:00:06
908500 -- (-960.815) (-968.493) [-960.633] (-964.190) * (-965.493) (-963.565) (-965.287) [-963.159] -- 0:00:06
909000 -- [-959.495] (-960.944) (-960.097) (-961.508) * [-966.716] (-964.548) (-962.253) (-964.525) -- 0:00:06
909500 -- (-962.616) (-963.523) (-961.453) [-962.504] * (-962.641) (-963.412) [-961.735] (-963.617) -- 0:00:06
910000 -- (-964.914) (-959.651) (-961.089) [-961.713] * (-965.746) (-960.389) (-959.888) [-963.975] -- 0:00:06
Average standard deviation of split frequencies: 0.006936
910500 -- (-965.109) [-960.996] (-960.538) (-963.025) * (-962.207) (-961.057) [-961.568] (-959.691) -- 0:00:06
911000 -- (-963.847) [-963.336] (-959.468) (-964.610) * [-964.254] (-965.132) (-961.690) (-960.012) -- 0:00:06
911500 -- (-960.872) [-965.039] (-959.075) (-962.746) * (-962.130) (-960.264) (-962.091) [-962.537] -- 0:00:06
912000 -- (-961.761) (-963.611) (-963.278) [-963.651] * (-962.737) (-960.703) (-964.486) [-962.159] -- 0:00:05
912500 -- [-960.736] (-963.262) (-965.569) (-959.996) * (-964.882) [-957.625] (-963.315) (-960.115) -- 0:00:05
913000 -- [-959.956] (-963.169) (-959.974) (-967.205) * (-964.116) (-963.417) [-962.048] (-963.276) -- 0:00:05
913500 -- [-959.913] (-963.975) (-963.822) (-964.905) * (-963.702) [-960.110] (-959.061) (-961.528) -- 0:00:05
914000 -- (-961.701) [-962.995] (-965.179) (-962.117) * (-963.845) [-959.867] (-959.201) (-961.580) -- 0:00:05
914500 -- (-961.232) (-964.565) [-959.870] (-962.324) * (-961.678) (-961.477) [-960.304] (-966.560) -- 0:00:05
915000 -- (-961.533) (-966.248) (-966.230) [-960.754] * (-961.420) (-963.265) [-967.982] (-962.739) -- 0:00:05
Average standard deviation of split frequencies: 0.006656
915500 -- (-963.987) (-963.033) [-962.220] (-960.837) * (-961.739) (-961.241) [-959.994] (-962.960) -- 0:00:05
916000 -- (-959.178) (-965.427) (-962.560) [-960.874] * (-962.145) [-961.169] (-959.880) (-960.456) -- 0:00:05
916500 -- (-958.930) (-962.639) (-961.638) [-961.253] * (-961.748) (-959.264) [-960.928] (-960.757) -- 0:00:05
917000 -- (-959.319) [-962.141] (-961.168) (-960.115) * (-959.560) [-966.750] (-965.747) (-963.471) -- 0:00:05
917500 -- (-960.024) (-962.424) (-962.254) [-961.091] * (-963.252) (-962.097) (-965.116) [-963.233] -- 0:00:05
918000 -- [-961.572] (-968.176) (-959.384) (-963.560) * (-964.784) (-960.027) [-964.705] (-964.347) -- 0:00:05
918500 -- (-962.296) [-965.242] (-964.485) (-966.265) * [-962.815] (-959.198) (-965.041) (-961.208) -- 0:00:05
919000 -- [-958.642] (-966.290) (-962.557) (-966.806) * (-969.869) (-962.803) (-965.539) [-960.860] -- 0:00:05
919500 -- (-964.868) (-963.035) (-959.927) [-962.842] * (-971.853) (-960.869) (-961.425) [-963.596] -- 0:00:05
920000 -- (-959.940) (-966.926) (-963.433) [-960.590] * (-965.415) (-972.510) [-958.251] (-962.600) -- 0:00:05
Average standard deviation of split frequencies: 0.006452
920500 -- (-960.549) (-961.977) [-960.464] (-964.793) * [-961.786] (-964.152) (-963.279) (-963.259) -- 0:00:05
921000 -- (-960.506) [-963.108] (-965.175) (-963.913) * (-961.951) (-961.301) (-962.096) [-960.792] -- 0:00:05
921500 -- [-962.369] (-961.568) (-964.202) (-960.864) * [-962.946] (-959.298) (-965.296) (-963.068) -- 0:00:05
922000 -- (-959.840) (-959.857) (-964.402) [-959.379] * (-961.251) (-964.508) (-959.893) [-962.938] -- 0:00:05
922500 -- (-960.592) (-962.919) (-967.045) [-961.765] * (-964.214) (-961.428) (-965.017) [-961.463] -- 0:00:05
923000 -- [-961.683] (-962.532) (-964.054) (-961.229) * [-960.780] (-964.813) (-962.703) (-962.935) -- 0:00:05
923500 -- (-962.336) [-964.682] (-966.327) (-959.942) * (-961.116) (-961.784) (-968.559) [-961.850] -- 0:00:05
924000 -- [-958.722] (-964.584) (-963.448) (-963.045) * [-963.918] (-963.614) (-960.095) (-960.354) -- 0:00:05
924500 -- (-962.850) (-962.022) (-964.204) [-962.915] * (-961.245) (-963.046) (-961.500) [-961.723] -- 0:00:05
925000 -- (-965.818) (-961.076) (-967.148) [-960.878] * (-960.093) (-961.664) (-961.489) [-959.567] -- 0:00:05
Average standard deviation of split frequencies: 0.006245
925500 -- [-961.945] (-961.338) (-962.517) (-962.387) * (-961.073) (-961.877) (-969.153) [-966.580] -- 0:00:05
926000 -- (-962.464) (-965.421) (-965.532) [-962.998] * (-960.763) [-965.757] (-961.363) (-966.119) -- 0:00:05
926500 -- (-960.637) (-962.742) [-960.096] (-966.101) * (-965.879) [-963.329] (-961.421) (-961.575) -- 0:00:04
927000 -- (-962.610) (-962.569) [-964.335] (-962.096) * (-961.841) (-963.736) [-961.497] (-968.282) -- 0:00:04
927500 -- [-959.697] (-960.230) (-965.128) (-959.024) * (-961.076) [-960.721] (-964.589) (-967.534) -- 0:00:04
928000 -- (-960.811) [-963.030] (-960.444) (-963.681) * [-961.520] (-962.644) (-960.624) (-965.377) -- 0:00:04
928500 -- (-962.729) [-960.632] (-963.578) (-959.690) * (-961.439) [-963.079] (-962.068) (-966.110) -- 0:00:04
929000 -- (-963.672) (-960.681) [-963.783] (-962.780) * (-960.074) (-963.652) (-964.291) [-962.460] -- 0:00:04
929500 -- [-961.259] (-961.638) (-962.372) (-959.084) * (-960.884) (-962.959) (-965.258) [-960.986] -- 0:00:04
930000 -- (-961.364) (-960.846) (-961.082) [-960.688] * [-962.934] (-961.592) (-963.853) (-961.691) -- 0:00:04
Average standard deviation of split frequencies: 0.006247
930500 -- (-959.890) (-960.282) (-963.717) [-962.175] * [-960.314] (-962.415) (-965.234) (-959.677) -- 0:00:04
931000 -- (-963.678) [-962.140] (-961.876) (-966.668) * [-960.355] (-961.039) (-972.104) (-958.957) -- 0:00:04
931500 -- (-964.537) (-966.091) [-960.683] (-970.426) * (-961.512) (-961.844) (-973.284) [-961.272] -- 0:00:04
932000 -- (-961.205) (-963.313) (-963.653) [-966.880] * (-962.420) (-961.744) [-966.505] (-960.779) -- 0:00:04
932500 -- (-960.204) (-964.840) (-962.142) [-962.506] * [-961.243] (-963.349) (-966.136) (-963.724) -- 0:00:04
933000 -- [-960.237] (-963.629) (-963.754) (-963.978) * [-963.714] (-964.322) (-960.978) (-961.543) -- 0:00:04
933500 -- (-965.879) (-959.468) (-960.077) [-959.919] * (-967.243) [-959.941] (-962.767) (-963.695) -- 0:00:04
934000 -- (-962.675) (-965.264) [-961.045] (-965.613) * (-961.431) [-959.708] (-965.507) (-961.574) -- 0:00:04
934500 -- (-964.463) [-960.440] (-961.228) (-961.857) * [-960.611] (-961.739) (-961.347) (-960.797) -- 0:00:04
935000 -- (-963.318) (-959.242) (-961.698) [-960.432] * [-958.677] (-960.653) (-963.024) (-959.260) -- 0:00:04
Average standard deviation of split frequencies: 0.006484
935500 -- [-963.341] (-960.524) (-960.521) (-965.609) * (-960.927) [-959.109] (-964.965) (-959.801) -- 0:00:04
936000 -- (-963.890) [-960.692] (-963.810) (-964.806) * [-963.581] (-961.199) (-962.053) (-960.464) -- 0:00:04
936500 -- [-962.214] (-961.507) (-963.041) (-959.930) * (-963.585) [-959.883] (-962.395) (-960.492) -- 0:00:04
937000 -- (-966.389) (-961.063) [-961.021] (-964.937) * (-963.362) [-962.548] (-962.640) (-962.584) -- 0:00:04
937500 -- (-963.770) [-962.302] (-960.919) (-961.195) * (-961.808) (-961.879) [-959.489] (-966.625) -- 0:00:04
938000 -- (-960.260) (-962.065) [-959.616] (-961.373) * [-960.738] (-961.625) (-961.062) (-960.673) -- 0:00:04
938500 -- [-961.596] (-964.378) (-960.767) (-962.057) * (-958.492) [-962.350] (-961.800) (-963.282) -- 0:00:04
939000 -- (-960.538) (-963.102) (-964.998) [-963.254] * (-964.831) (-961.962) [-962.718] (-959.567) -- 0:00:04
939500 -- [-960.352] (-963.077) (-963.629) (-960.823) * (-963.954) (-965.193) (-961.237) [-959.381] -- 0:00:04
940000 -- [-965.430] (-960.638) (-958.451) (-963.959) * (-963.395) [-961.334] (-962.878) (-960.711) -- 0:00:04
Average standard deviation of split frequencies: 0.006381
940500 -- (-960.544) (-961.638) (-963.232) [-960.422] * [-961.245] (-961.602) (-961.914) (-961.001) -- 0:00:04
941000 -- (-961.207) (-962.542) (-964.228) [-963.265] * (-962.178) [-961.719] (-964.805) (-959.955) -- 0:00:04
941500 -- (-963.053) (-960.797) (-959.380) [-960.146] * (-959.645) [-961.712] (-963.434) (-962.269) -- 0:00:03
942000 -- [-961.004] (-962.230) (-959.498) (-961.246) * [-959.753] (-962.026) (-963.138) (-959.600) -- 0:00:03
942500 -- (-969.190) [-961.988] (-960.287) (-960.302) * (-964.619) [-961.207] (-963.570) (-962.853) -- 0:00:03
943000 -- (-960.428) (-962.272) [-961.063] (-960.255) * (-963.994) [-961.291] (-963.819) (-961.805) -- 0:00:03
943500 -- (-960.234) (-962.771) [-962.505] (-961.141) * (-962.539) [-965.086] (-964.880) (-960.723) -- 0:00:03
944000 -- [-959.371] (-964.035) (-958.519) (-963.372) * (-961.892) (-966.658) (-961.264) [-960.752] -- 0:00:03
944500 -- [-962.106] (-958.477) (-961.310) (-960.014) * (-960.281) [-960.974] (-963.253) (-962.888) -- 0:00:03
945000 -- (-963.946) [-962.352] (-962.759) (-964.511) * (-963.353) (-964.265) (-963.770) [-965.074] -- 0:00:03
Average standard deviation of split frequencies: 0.006572
945500 -- (-961.942) [-960.549] (-960.294) (-962.056) * (-963.089) (-963.767) (-961.448) [-962.710] -- 0:00:03
946000 -- (-959.138) (-961.952) (-965.104) [-959.986] * (-959.674) (-960.595) (-962.638) [-961.057] -- 0:00:03
946500 -- (-963.130) (-961.067) [-961.422] (-960.685) * [-959.929] (-960.349) (-963.794) (-968.011) -- 0:00:03
947000 -- (-961.748) [-961.661] (-960.743) (-959.550) * [-964.437] (-962.783) (-960.944) (-963.231) -- 0:00:03
947500 -- (-961.320) (-968.534) [-959.605] (-961.721) * [-960.899] (-962.615) (-962.030) (-958.281) -- 0:00:03
948000 -- (-961.829) (-964.629) [-960.925] (-961.689) * (-959.601) (-961.667) [-963.865] (-959.114) -- 0:00:03
948500 -- [-959.987] (-964.049) (-962.288) (-962.973) * (-964.169) (-960.446) [-963.938] (-961.403) -- 0:00:03
949000 -- (-963.923) [-960.745] (-964.379) (-961.033) * (-963.354) [-960.662] (-965.412) (-961.652) -- 0:00:03
949500 -- [-964.251] (-961.806) (-962.258) (-965.203) * (-960.778) (-959.183) [-961.581] (-964.227) -- 0:00:03
950000 -- [-961.349] (-962.350) (-962.439) (-964.075) * (-960.601) [-960.956] (-961.318) (-962.241) -- 0:00:03
Average standard deviation of split frequencies: 0.006632
950500 -- [-963.126] (-964.630) (-965.617) (-962.027) * (-965.390) (-966.081) (-960.207) [-960.735] -- 0:00:03
951000 -- (-965.400) (-963.740) (-962.643) [-959.953] * (-968.504) [-961.931] (-959.707) (-963.371) -- 0:00:03
951500 -- (-964.829) (-962.365) [-963.391] (-961.456) * (-961.833) (-962.446) (-961.357) [-960.954] -- 0:00:03
952000 -- [-962.448] (-962.579) (-964.300) (-957.882) * (-963.789) [-961.055] (-963.253) (-962.743) -- 0:00:03
952500 -- (-964.420) (-959.892) [-961.222] (-963.843) * [-960.597] (-961.593) (-964.101) (-965.519) -- 0:00:03
953000 -- (-963.409) [-961.350] (-964.449) (-962.597) * (-961.715) (-962.417) (-960.184) [-961.983] -- 0:00:03
953500 -- (-963.470) [-960.743] (-961.708) (-963.909) * [-962.258] (-962.321) (-962.564) (-958.936) -- 0:00:03
954000 -- [-962.964] (-963.803) (-962.294) (-962.086) * (-965.410) [-961.486] (-962.631) (-963.855) -- 0:00:03
954500 -- [-963.498] (-961.098) (-961.713) (-960.845) * [-969.255] (-966.117) (-959.140) (-962.221) -- 0:00:03
955000 -- (-963.901) [-963.292] (-963.737) (-961.557) * (-962.617) [-961.012] (-962.983) (-962.407) -- 0:00:03
Average standard deviation of split frequencies: 0.006379
955500 -- (-965.000) (-964.800) (-963.227) [-961.724] * [-963.426] (-959.509) (-960.811) (-961.727) -- 0:00:03
956000 -- [-965.014] (-965.140) (-959.035) (-963.094) * (-964.383) (-962.048) [-960.513] (-961.360) -- 0:00:02
956500 -- (-962.027) (-965.454) [-962.952] (-960.069) * (-964.709) [-961.635] (-963.087) (-963.877) -- 0:00:02
957000 -- (-964.509) (-963.455) [-963.528] (-960.424) * (-963.474) (-961.321) [-960.339] (-965.887) -- 0:00:02
957500 -- (-961.489) (-965.178) (-962.271) [-959.987] * (-965.088) [-963.560] (-962.499) (-962.502) -- 0:00:02
958000 -- (-966.582) (-963.288) [-962.067] (-961.030) * (-965.090) (-965.052) (-961.201) [-959.605] -- 0:00:02
958500 -- [-960.657] (-962.640) (-962.232) (-963.893) * (-961.124) (-964.008) [-961.621] (-962.664) -- 0:00:02
959000 -- (-963.761) [-963.806] (-960.266) (-962.845) * [-964.050] (-960.482) (-961.578) (-960.765) -- 0:00:02
959500 -- (-961.617) (-964.022) [-960.828] (-960.229) * (-963.694) [-961.017] (-965.709) (-961.788) -- 0:00:02
960000 -- [-965.582] (-962.732) (-960.095) (-960.655) * (-962.787) (-966.646) [-960.759] (-960.740) -- 0:00:02
Average standard deviation of split frequencies: 0.005888
960500 -- [-958.916] (-962.049) (-959.489) (-960.929) * [-960.704] (-963.073) (-965.480) (-963.099) -- 0:00:02
961000 -- (-962.061) (-964.978) [-960.606] (-964.521) * (-958.287) [-960.658] (-962.389) (-962.666) -- 0:00:02
961500 -- [-962.649] (-963.597) (-961.756) (-961.084) * [-962.734] (-967.250) (-964.507) (-962.661) -- 0:00:02
962000 -- (-964.974) (-963.222) (-961.862) [-961.585] * [-965.039] (-961.445) (-969.356) (-962.858) -- 0:00:02
962500 -- [-962.198] (-961.272) (-961.674) (-962.216) * (-960.949) (-963.253) [-963.030] (-963.057) -- 0:00:02
963000 -- [-962.585] (-961.851) (-963.350) (-959.807) * (-959.947) (-963.514) [-963.197] (-966.790) -- 0:00:02
963500 -- (-962.349) (-962.217) [-963.798] (-962.221) * (-963.767) (-961.225) [-960.701] (-964.868) -- 0:00:02
964000 -- [-963.080] (-965.608) (-964.170) (-958.842) * (-960.713) (-967.899) (-964.805) [-962.366] -- 0:00:02
964500 -- (-962.580) [-963.820] (-961.665) (-963.420) * (-960.373) (-964.163) [-962.685] (-965.367) -- 0:00:02
965000 -- (-962.262) (-961.706) (-964.269) [-963.898] * [-960.095] (-962.038) (-961.636) (-960.648) -- 0:00:02
Average standard deviation of split frequencies: 0.005823
965500 -- (-965.837) (-964.665) [-961.285] (-966.427) * (-961.968) (-960.977) (-966.769) [-962.854] -- 0:00:02
966000 -- (-962.889) (-960.223) (-965.664) [-964.159] * (-965.220) [-961.025] (-963.455) (-965.840) -- 0:00:02
966500 -- (-964.669) [-963.805] (-961.258) (-965.856) * (-965.680) (-961.114) [-962.413] (-961.305) -- 0:00:02
967000 -- [-963.497] (-960.517) (-965.236) (-959.477) * (-964.519) (-963.164) (-965.247) [-960.095] -- 0:00:02
967500 -- (-964.537) (-958.617) [-963.746] (-962.198) * (-963.360) (-962.940) [-959.367] (-964.282) -- 0:00:02
968000 -- [-960.552] (-961.915) (-963.997) (-970.422) * (-963.070) [-963.133] (-962.799) (-966.247) -- 0:00:02
968500 -- (-961.326) (-959.649) (-961.604) [-966.962] * (-963.354) (-966.224) [-961.182] (-962.819) -- 0:00:02
969000 -- (-962.429) (-963.998) [-962.587] (-962.947) * (-963.722) (-962.662) [-960.904] (-962.876) -- 0:00:02
969500 -- (-964.618) [-958.150] (-966.950) (-959.542) * [-967.209] (-960.557) (-963.986) (-960.111) -- 0:00:02
970000 -- (-962.142) [-961.425] (-965.886) (-959.506) * (-965.351) (-967.564) (-966.178) [-961.389] -- 0:00:02
Average standard deviation of split frequencies: 0.005634
970500 -- (-962.543) [-963.670] (-964.607) (-963.000) * (-963.467) (-965.761) (-963.900) [-961.408] -- 0:00:02
971000 -- [-962.492] (-960.803) (-967.460) (-960.624) * (-963.944) (-963.745) (-960.296) [-959.968] -- 0:00:01
971500 -- (-962.772) (-959.290) (-959.029) [-963.341] * (-963.591) (-963.088) (-963.890) [-959.934] -- 0:00:01
972000 -- (-967.131) (-958.846) [-963.708] (-965.097) * (-966.676) [-966.219] (-961.225) (-962.421) -- 0:00:01
972500 -- (-963.229) (-959.216) [-962.716] (-960.735) * (-963.948) [-959.889] (-963.704) (-959.005) -- 0:00:01
973000 -- [-960.515] (-961.499) (-959.532) (-965.232) * (-962.299) [-962.521] (-960.727) (-963.546) -- 0:00:01
973500 -- (-961.001) (-964.017) (-964.668) [-962.312] * (-961.120) (-960.542) (-961.121) [-961.466] -- 0:00:01
974000 -- [-960.499] (-963.568) (-964.709) (-959.087) * (-960.128) (-964.597) (-966.563) [-960.242] -- 0:00:01
974500 -- (-963.485) (-965.597) (-960.351) [-962.957] * [-962.541] (-964.292) (-960.055) (-960.740) -- 0:00:01
975000 -- (-961.973) (-963.423) (-961.154) [-961.823] * (-964.299) (-960.100) [-961.357] (-964.595) -- 0:00:01
Average standard deviation of split frequencies: 0.005404
975500 -- [-962.692] (-960.461) (-961.161) (-960.929) * (-965.868) (-963.740) [-963.343] (-964.852) -- 0:00:01
976000 -- (-961.248) (-963.110) [-961.344] (-958.353) * (-962.097) [-959.356] (-961.909) (-959.410) -- 0:00:01
976500 -- (-961.185) (-962.180) (-963.547) [-959.307] * (-963.442) (-962.820) [-960.502] (-959.985) -- 0:00:01
977000 -- (-960.737) [-963.029] (-962.548) (-960.142) * [-964.544] (-958.257) (-963.060) (-963.631) -- 0:00:01
977500 -- (-962.081) (-964.730) [-961.768] (-963.103) * (-965.595) (-958.466) (-963.055) [-961.186] -- 0:00:01
978000 -- (-961.611) (-962.470) (-959.649) [-959.361] * [-962.402] (-961.327) (-962.760) (-967.429) -- 0:00:01
978500 -- (-960.405) [-962.309] (-962.031) (-961.612) * [-963.196] (-963.372) (-963.061) (-968.126) -- 0:00:01
979000 -- [-961.214] (-962.811) (-963.714) (-960.594) * [-962.378] (-961.488) (-962.182) (-962.965) -- 0:00:01
979500 -- (-964.038) [-962.735] (-961.640) (-959.274) * (-964.776) [-960.759] (-962.607) (-961.879) -- 0:00:01
980000 -- (-961.292) [-959.307] (-961.616) (-961.781) * (-962.310) (-959.862) (-965.685) [-961.594] -- 0:00:01
Average standard deviation of split frequencies: 0.005017
980500 -- (-961.860) (-959.374) (-962.256) [-963.400] * [-963.192] (-962.300) (-964.905) (-961.963) -- 0:00:01
981000 -- [-961.234] (-961.796) (-968.661) (-962.014) * (-964.559) [-960.314] (-965.119) (-968.107) -- 0:00:01
981500 -- (-961.143) [-959.904] (-960.238) (-964.693) * (-961.037) [-961.918] (-959.954) (-962.999) -- 0:00:01
982000 -- (-968.088) (-961.500) [-963.729] (-966.378) * (-962.275) (-962.044) [-963.564] (-963.636) -- 0:00:01
982500 -- (-962.005) (-964.628) (-962.679) [-964.887] * (-962.524) (-961.894) (-960.715) [-959.200] -- 0:00:01
983000 -- (-962.970) (-960.770) [-961.215] (-961.861) * (-964.826) (-962.733) (-965.614) [-960.259] -- 0:00:01
983500 -- (-960.967) (-963.463) (-960.561) [-962.540] * [-964.897] (-962.153) (-964.355) (-960.583) -- 0:00:01
984000 -- (-960.245) [-967.647] (-962.197) (-962.847) * [-963.893] (-962.758) (-961.042) (-966.746) -- 0:00:01
984500 -- (-960.859) (-964.781) (-964.413) [-961.557] * (-965.863) [-958.123] (-964.127) (-962.318) -- 0:00:01
985000 -- [-960.348] (-961.247) (-966.913) (-960.005) * (-964.309) [-960.828] (-964.928) (-962.539) -- 0:00:01
Average standard deviation of split frequencies: 0.004717
985500 -- [-959.631] (-958.508) (-962.546) (-960.254) * (-964.399) [-960.053] (-959.580) (-967.010) -- 0:00:00
986000 -- (-961.750) [-962.335] (-962.445) (-960.512) * (-967.423) [-960.839] (-959.180) (-965.632) -- 0:00:00
986500 -- (-959.779) [-960.367] (-964.710) (-966.069) * (-967.249) (-961.623) [-959.019] (-963.985) -- 0:00:00
987000 -- (-960.158) (-960.027) (-960.203) [-960.827] * (-968.616) (-960.500) (-959.385) [-962.259] -- 0:00:00
987500 -- (-961.218) [-964.790] (-961.688) (-961.317) * (-964.977) (-959.771) [-959.328] (-964.177) -- 0:00:00
988000 -- (-963.771) [-960.315] (-961.725) (-962.107) * (-961.520) (-960.149) [-959.747] (-964.639) -- 0:00:00
988500 -- (-963.992) (-962.584) (-963.103) [-964.364] * (-974.202) [-963.465] (-962.930) (-960.053) -- 0:00:00
989000 -- (-961.499) (-961.303) (-966.682) [-961.873] * (-964.282) [-965.262] (-960.842) (-963.752) -- 0:00:00
989500 -- (-965.495) (-962.220) [-963.955] (-962.363) * [-960.052] (-960.825) (-959.639) (-965.170) -- 0:00:00
990000 -- (-963.004) (-962.652) [-963.117] (-959.772) * (-961.108) [-961.721] (-961.966) (-967.382) -- 0:00:00
Average standard deviation of split frequencies: 0.004917
990500 -- (-960.507) (-960.440) (-967.621) [-963.229] * (-961.376) (-962.235) (-963.330) [-960.637] -- 0:00:00
991000 -- (-963.015) [-960.267] (-962.520) (-965.486) * (-962.810) (-963.231) (-964.078) [-960.481] -- 0:00:00
991500 -- (-968.559) (-965.346) [-960.578] (-960.646) * (-961.127) (-962.724) [-962.549] (-961.289) -- 0:00:00
992000 -- (-966.541) (-961.881) [-963.394] (-960.094) * [-962.026] (-963.186) (-959.198) (-962.011) -- 0:00:00
992500 -- (-965.135) (-964.357) [-959.723] (-959.770) * [-959.865] (-962.216) (-966.604) (-964.606) -- 0:00:00
993000 -- (-966.681) [-963.687] (-962.320) (-963.473) * (-959.520) (-962.232) [-960.576] (-966.056) -- 0:00:00
993500 -- (-968.576) (-959.658) [-960.292] (-962.825) * (-958.878) [-960.567] (-962.022) (-962.794) -- 0:00:00
994000 -- (-966.070) (-959.287) (-961.717) [-966.733] * (-960.996) (-963.198) (-964.976) [-961.943] -- 0:00:00
994500 -- [-962.270] (-961.599) (-963.503) (-961.645) * [-961.311] (-960.228) (-960.556) (-961.674) -- 0:00:00
995000 -- (-960.844) [-961.547] (-963.658) (-965.403) * [-959.460] (-960.195) (-958.559) (-963.452) -- 0:00:00
Average standard deviation of split frequencies: 0.005080
995500 -- (-959.380) [-962.674] (-960.834) (-963.882) * (-961.929) (-961.037) [-960.384] (-960.695) -- 0:00:00
996000 -- (-962.294) (-964.609) (-962.384) [-962.681] * (-962.197) (-963.024) [-960.624] (-963.568) -- 0:00:00
996500 -- (-961.906) (-965.385) (-963.332) [-964.256] * (-961.001) (-965.377) (-963.759) [-960.065] -- 0:00:00
997000 -- (-962.364) (-964.982) [-958.680] (-962.183) * (-963.588) (-962.876) (-962.846) [-963.401] -- 0:00:00
997500 -- (-962.244) [-961.270] (-971.571) (-963.291) * [-964.119] (-968.036) (-962.759) (-965.454) -- 0:00:00
998000 -- [-961.610] (-965.219) (-959.480) (-965.938) * (-962.218) (-960.985) [-962.786] (-963.960) -- 0:00:00
998500 -- (-959.791) [-964.354] (-965.916) (-962.566) * (-960.678) [-962.324] (-961.160) (-961.523) -- 0:00:00
999000 -- (-962.006) (-962.829) (-961.804) [-963.534] * (-963.577) (-960.961) (-962.296) [-963.878] -- 0:00:00
999500 -- [-960.341] (-963.963) (-960.156) (-960.566) * (-959.882) (-969.919) [-963.405] (-960.708) -- 0:00:00
1000000 -- (-965.983) [-964.662] (-966.013) (-963.971) * (-960.549) (-965.719) [-967.608] (-965.630) -- 0:00:00
Average standard deviation of split frequencies: 0.005005
Analysis completed in 1 mins 8 seconds
Analysis used 66.48 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -957.13
Likelihood of best state for "cold" chain of run 2 was -957.20
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 72 %) Dirichlet(Revmat{all})
97.3 % ( 93 %) Slider(Revmat{all})
27.4 % ( 23 %) Dirichlet(Pi{all})
29.6 % ( 27 %) Slider(Pi{all})
58.9 % ( 39 %) Multiplier(Alpha{1,2})
80.2 % ( 52 %) Multiplier(Alpha{3})
26.7 % ( 29 %) Slider(Pinvar{all})
97.5 % ( 97 %) ExtSPR(Tau{all},V{all})
69.7 % ( 63 %) ExtTBR(Tau{all},V{all})
98.6 % ( 98 %) NNI(Tau{all},V{all})
88.3 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
93.8 % ( 92 %) Nodeslider(V{all})
30.2 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 74 %) Dirichlet(Revmat{all})
97.9 % ( 99 %) Slider(Revmat{all})
28.1 % ( 21 %) Dirichlet(Pi{all})
29.7 % ( 27 %) Slider(Pi{all})
59.0 % ( 32 %) Multiplier(Alpha{1,2})
80.0 % ( 63 %) Multiplier(Alpha{3})
26.2 % ( 23 %) Slider(Pinvar{all})
97.5 % ( 97 %) ExtSPR(Tau{all},V{all})
69.3 % ( 68 %) ExtTBR(Tau{all},V{all})
98.5 % ( 99 %) NNI(Tau{all},V{all})
88.3 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
93.8 % ( 93 %) Nodeslider(V{all})
30.4 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 167064 0.82 0.65
3 | 167023 166433 0.83
4 | 166276 166827 166377
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.49
2 | 166478 0.81 0.65
3 | 166604 166831 0.83
4 | 166681 167089 166317
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -960.96
| 2 1 |
| 2 |
| 11 |
| 1 2 1 22 2 1 2 1 1 |
| 2 2 21 1 11 12 2 *1 2 |
| 22112 22 1 2 1 12 1 |
| 21 2 1 1 2 22 22 2|
|1 2 2 2 2 1 1* 2 2 * 2 |
| 22 1 11 1 1 2 1 1 1 2 2 1 |
| * 2 1 1 2 2 2 11 1 |
|2 2 1 2 1 1 2 1|
| 1 1 2 12 2* 11 1 |
| 1 1 2 1 |
| 1 2 |
| 2 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -963.08
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -960.80 -964.51
2 -960.73 -965.94
--------------------------------------
TOTAL -960.76 -965.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865234 0.086321 0.328548 1.454788 0.833379 1435.17 1449.10 1.000
r(A<->C){all} 0.169455 0.020431 0.000016 0.451708 0.130662 364.30 390.96 1.000
r(A<->G){all} 0.168210 0.020840 0.000033 0.467182 0.127915 151.15 166.38 1.000
r(A<->T){all} 0.129645 0.014397 0.000024 0.378183 0.093504 212.10 272.31 1.000
r(C<->G){all} 0.172446 0.020243 0.000008 0.456181 0.136488 243.53 279.37 1.005
r(C<->T){all} 0.138734 0.016294 0.000026 0.403007 0.100266 155.51 226.84 1.010
r(G<->T){all} 0.221510 0.023819 0.000028 0.525740 0.194500 124.02 239.71 1.000
pi(A){all} 0.186343 0.000202 0.157136 0.212604 0.186300 1242.99 1276.20 1.000
pi(C){all} 0.340647 0.000305 0.306976 0.375705 0.340429 1056.40 1192.00 1.000
pi(G){all} 0.300136 0.000294 0.268114 0.333155 0.299848 1289.35 1302.00 1.000
pi(T){all} 0.172874 0.000203 0.145854 0.200270 0.172177 1254.13 1303.04 1.000
alpha{1,2} 0.221034 0.063450 0.004801 0.578018 0.157725 1191.84 1346.42 1.001
alpha{3} 0.397749 0.215608 0.000114 1.389900 0.230739 1178.38 1219.26 1.000
pinvar{all} 0.994574 0.000019 0.986051 0.999887 0.995732 1272.76 1277.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- .**...
9 -- ..*.*.
10 -- ..****
11 -- ...**.
12 -- .****.
13 -- .*...*
14 -- ....**
15 -- .*.***
16 -- .***.*
17 -- .*..*.
18 -- ..**..
19 -- ..*..*
20 -- .**.**
21 -- ...*.*
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.004711 0.149900 0.156562 2
8 450 0.149900 0.000942 0.149234 0.150566 2
9 443 0.147568 0.000471 0.147235 0.147901 2
10 438 0.145903 0.004711 0.142572 0.149234 2
11 436 0.145237 0.010364 0.137908 0.152565 2
12 434 0.144570 0.002827 0.142572 0.146569 2
13 426 0.141905 0.003769 0.139241 0.144570 2
14 425 0.141572 0.003298 0.139241 0.143904 2
15 422 0.140573 0.000942 0.139907 0.141239 2
16 421 0.140240 0.013662 0.130580 0.149900 2
17 419 0.139574 0.003298 0.137242 0.141905 2
18 418 0.139241 0.008480 0.133245 0.145237 2
19 413 0.137575 0.008009 0.131912 0.143238 2
20 402 0.133911 0.002827 0.131912 0.135909 2
21 402 0.133911 0.002827 0.131912 0.135909 2
22 283 0.094270 0.008951 0.087941 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.084824 0.007440 0.000024 0.254689 0.056925 1.001 2
length{all}[2] 0.085184 0.008054 0.000008 0.267155 0.058165 1.001 2
length{all}[3] 0.088086 0.008533 0.000000 0.271361 0.058595 1.002 2
length{all}[4] 0.084776 0.007596 0.000012 0.258550 0.056456 1.000 2
length{all}[5] 0.087241 0.007830 0.000092 0.266734 0.060306 1.000 2
length{all}[6] 0.166190 0.017065 0.001283 0.426014 0.131626 1.000 2
length{all}[7] 0.084709 0.006600 0.000298 0.237303 0.063614 1.000 2
length{all}[8] 0.086102 0.008875 0.000194 0.277547 0.055614 1.001 2
length{all}[9] 0.088304 0.008697 0.000119 0.260150 0.058372 1.000 2
length{all}[10] 0.089864 0.009319 0.000082 0.268508 0.060435 1.000 2
length{all}[11] 0.090740 0.008425 0.000231 0.259309 0.063755 1.000 2
length{all}[12] 0.085584 0.007672 0.000351 0.247240 0.057875 1.000 2
length{all}[13] 0.086675 0.007774 0.000017 0.289920 0.058545 0.999 2
length{all}[14] 0.092759 0.008947 0.000121 0.267859 0.060474 0.998 2
length{all}[15] 0.084701 0.006537 0.000107 0.249173 0.064716 1.007 2
length{all}[16] 0.082281 0.006994 0.000225 0.277462 0.054263 0.998 2
length{all}[17] 0.092385 0.008904 0.000023 0.269816 0.064943 1.010 2
length{all}[18] 0.089795 0.006934 0.000440 0.265675 0.066800 0.998 2
length{all}[19] 0.097397 0.009541 0.000387 0.284217 0.071963 0.998 2
length{all}[20] 0.095347 0.009729 0.000048 0.295062 0.068299 1.000 2
length{all}[21] 0.086400 0.007958 0.000066 0.274414 0.058673 0.999 2
length{all}[22] 0.094485 0.008270 0.000326 0.277406 0.070950 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005005
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------- C1 (1)
|
|-------------------------------- C2 (2)
|
|-------------------------------- C3 (3)
+
|------------------------------- C4 (4)
|
|--------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 705
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 235 / 235 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 235 / 235 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.025692 0.049885 0.047644 0.065968 0.048040 0.089670 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -996.502675
Iterating by ming2
Initial: fx= 996.502675
x= 0.02569 0.04989 0.04764 0.06597 0.04804 0.08967 0.30000 1.30000
1 h-m-p 0.0000 0.0001 557.4491 ++ 961.857460 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 11355.0474 ++ 934.494737 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 153.5102 ++ 934.201366 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0000 218.1414 ++ 933.162437 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0001 230.2786 ++ 929.075155 m 0.0001 57 | 5/8
6 h-m-p 0.0033 0.1416 1.6246 ++CYYYYC 925.258196 5 0.1206 77 | 5/8
7 h-m-p 0.2583 1.2914 0.3775 ++ 925.049180 m 1.2914 88 | 6/8
8 h-m-p 0.1633 1.8806 1.0602 CCC 925.032447 2 0.2765 106 | 6/8
9 h-m-p 0.3475 8.0000 0.8435 +YYCC 924.971142 3 2.0406 122 | 6/8
10 h-m-p 1.6000 8.0000 0.4493 CCC 924.945934 2 2.4518 139 | 6/8
11 h-m-p 1.6000 8.0000 0.6182 +C 924.923237 0 6.4000 153 | 6/8
12 h-m-p 1.6000 8.0000 1.2152 CCC 924.912207 2 1.9908 170 | 6/8
13 h-m-p 1.6000 8.0000 1.4745 +YY 924.901937 1 6.7211 183 | 6/8
14 h-m-p 1.6000 8.0000 2.8874 CCC 924.897502 2 1.9026 198 | 6/8
15 h-m-p 1.6000 8.0000 3.4196 +YC 924.893066 1 7.1850 211 | 6/8
16 h-m-p 1.6000 8.0000 6.7780 CC 924.891265 1 1.8611 224 | 6/8
17 h-m-p 1.5600 8.0000 8.0859 ++ 924.889352 m 8.0000 235 | 6/8
18 h-m-p 1.6000 8.0000 15.6488 C 924.888627 0 1.7164 246 | 6/8
19 h-m-p 1.3919 8.0000 19.2973 ++ 924.887748 m 8.0000 257 | 6/8
20 h-m-p 1.6000 8.0000 49.3188 YC 924.887503 1 2.4823 269 | 6/8
21 h-m-p 1.6000 8.0000 57.7934 +YC 924.887266 1 4.0253 282 | 6/8
22 h-m-p 0.6919 3.4593 96.6560 +Y 924.887124 0 2.9390 294 | 6/8
23 h-m-p 0.0716 0.3580 140.4566 ++ 924.887104 m 0.3580 305 | 7/8
24 h-m-p 0.2305 8.0000 0.0000 +C 924.887091 0 1.0209 317 | 7/8
25 h-m-p 1.6000 8.0000 0.0000 ---------C 924.887091 0 0.0000 338
Out..
lnL = -924.887091
339 lfun, 339 eigenQcodon, 2034 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.109786 0.026645 0.057945 0.022716 0.092648 0.033063 0.000100 0.759818 0.306509
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.519835
np = 9
lnL0 = -998.180962
Iterating by ming2
Initial: fx= 998.180962
x= 0.10979 0.02664 0.05794 0.02272 0.09265 0.03306 0.00011 0.75982 0.30651
1 h-m-p 0.0000 0.0000 513.0464 ++ 997.640242 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 4159.1816 +CCYYCYCCC 975.239266 8 0.0000 40 | 1/9
3 h-m-p 0.0000 0.0000 419.6897 ++ 969.917165 m 0.0000 52 | 2/9
4 h-m-p 0.0000 0.0000 2668.6802 ++ 966.696057 m 0.0000 64 | 3/9
5 h-m-p 0.0000 0.0000 118008.0076 ++ 946.859838 m 0.0000 76 | 4/9
6 h-m-p 0.0000 0.0000 216497.9640 ++ 930.577376 m 0.0000 88 | 5/9
7 h-m-p 0.0000 0.0001 1513.3256 ++ 926.219645 m 0.0001 100 | 6/9
8 h-m-p 0.0029 0.0146 1.9194 ++ 926.114420 m 0.0146 112 | 6/9
9 h-m-p 0.0224 0.5277 1.2496 +++ 925.628452 m 0.5277 125 | 6/9
10 h-m-p 0.0000 0.0000 64.6618
h-m-p: 0.00000000e+00 0.00000000e+00 6.46617736e+01 925.628452
.. | 6/9
11 h-m-p 0.0003 0.1294 386.4708 -YYCYCCC 925.269870 6 0.0000 156 | 6/9
12 h-m-p 0.0047 0.7592 0.5792 ++++ 925.131065 m 0.7592 170 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 Y 925.131064 0 2.7947 185 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ---Y 925.131064 0 0.0063 202
Out..
lnL = -925.131064
203 lfun, 609 eigenQcodon, 2436 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.090547 0.035296 0.093012 0.096939 0.029518 0.018334 0.000100 1.157613 0.103117 0.351203 1154.586331
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.056739
np = 11
lnL0 = -962.179841
Iterating by ming2
Initial: fx= 962.179841
x= 0.09055 0.03530 0.09301 0.09694 0.02952 0.01833 0.00011 1.15761 0.10312 0.35120 951.42857
1 h-m-p 0.0000 0.0000 100.8071 ++ 962.150087 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 120.2022 ++++ 956.965473 m 0.0009 32 | 2/11
3 h-m-p 0.0000 0.0002 61.1949 ++ 955.750398 m 0.0002 46 | 3/11
4 h-m-p 0.0003 0.0108 49.9205 +++ 943.037130 m 0.0108 61 | 4/11
5 h-m-p 0.0000 0.0000 174292.5110 ++ 942.761318 m 0.0000 75 | 5/11
6 h-m-p 0.0001 0.0005 11.8224 ++ 942.337069 m 0.0005 89 | 6/11
7 h-m-p 0.0000 0.0017 740.1358 ++++ 930.874822 m 0.0017 105 | 6/11
8 h-m-p 0.6396 8.0000 1.9952 CYCYYCCC 924.927653 7 0.0228 131 | 6/11
9 h-m-p 1.6000 8.0000 0.0061 -------------Y 924.927653 0 0.0000 158 | 6/11
10 h-m-p 0.0070 3.5123 1.7662 +++++ 924.892566 m 3.5123 180 | 6/11
11 h-m-p -0.0000 -0.0000 0.7528
h-m-p: -1.30731600e-16 -6.53658002e-16 7.52787115e-01 924.892566
.. | 7/11
12 h-m-p 0.0000 0.0048 0.9051 Y 924.892558 0 0.0000 210 | 7/11
13 h-m-p 0.0160 8.0000 0.0055 +++++ 924.892323 m 8.0000 231 | 7/11
14 h-m-p 0.0455 8.0000 0.9636 +++YC 924.887287 1 5.3377 253 | 7/11
15 h-m-p 1.6000 8.0000 0.0189 YC 924.887146 1 0.9834 272 | 7/11
16 h-m-p 0.6355 8.0000 0.0293 ++ 924.887140 m 8.0000 290 | 7/11
17 h-m-p 0.2634 8.0000 0.8886 +++ 924.887116 m 8.0000 309 | 7/11
18 h-m-p 1.6000 8.0000 0.0142 Y 924.887116 0 0.7239 327 | 7/11
19 h-m-p 0.5345 8.0000 0.0192 Y 924.887116 0 0.2529 345 | 7/11
20 h-m-p 0.1308 8.0000 0.0371 Y 924.887116 0 0.3149 363 | 7/11
21 h-m-p 0.1976 8.0000 0.0592 Y 924.887116 0 0.4177 381 | 7/11
22 h-m-p 0.2697 8.0000 0.0916 Y 924.887116 0 0.5882 399 | 7/11
23 h-m-p 0.3726 8.0000 0.1446 Y 924.887116 0 0.8735 417 | 7/11
24 h-m-p 0.5787 8.0000 0.2183 +Y 924.887116 0 1.9106 436 | 7/11
25 h-m-p 0.9463 8.0000 0.4408 ++ 924.887116 m 8.0000 454 | 7/11
26 h-m-p 1.6000 8.0000 2.0725 ++ 924.887116 m 8.0000 472 | 7/11
27 h-m-p 0.0623 0.3116 213.9827 ++ 924.887114 m 0.3116 486 | 7/11
28 h-m-p -0.0000 -0.0000 187.2415
h-m-p: -0.00000000e+00 -0.00000000e+00 1.87241543e+02 924.887114
.. | 7/11
29 h-m-p 0.0160 8.0000 0.0733 ----C 924.887114 0 0.0000 515 | 7/11
30 h-m-p 0.1915 8.0000 0.0000 -C 924.887114 0 0.0120 534
Out..
lnL = -924.887114
535 lfun, 2140 eigenQcodon, 9630 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -929.823580 S = -928.384704 -2.367427
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:04
did 20 / 58 patterns 0:04
did 30 / 58 patterns 0:04
did 40 / 58 patterns 0:04
did 50 / 58 patterns 0:04
did 58 / 58 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.084637 0.080638 0.100838 0.105990 0.061941 0.036358 0.000100 0.554762 1.026926
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.143818
np = 9
lnL0 = -1022.944525
Iterating by ming2
Initial: fx= 1022.944525
x= 0.08464 0.08064 0.10084 0.10599 0.06194 0.03636 0.00011 0.55476 1.02693
1 h-m-p 0.0000 0.0000 477.5899 ++ 1022.660622 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 720.1269 +CYCCYCCC 1011.164286 7 0.0001 40 | 1/9
3 h-m-p 0.0004 0.0055 99.5607 ++ 974.204687 m 0.0055 52 | 1/9
4 h-m-p 0.2294 1.1468 1.5745 --
QuantileBeta(0.05, 0.00787, 1.01719) = 5.461731e-161 2000 rounds
CCYC 973.345680 3 0.0038 71 | 1/9
5 h-m-p 0.0025 0.0123 2.3876 ------------.. | 1/9
6 h-m-p 0.0000 0.0001 1155.1957 ++ 952.803074 m 0.0001 105 | 2/9
7 h-m-p 0.0000 0.0001 547.5930 ++ 937.108392 m 0.0001 117 | 3/9
8 h-m-p 0.0000 0.0000 3725.1294 ++ 934.674284 m 0.0000 129 | 4/9
9 h-m-p 0.0000 0.0000 5021.5965 ++ 928.274181 m 0.0000 141 | 5/9
10 h-m-p 0.0000 0.0000 172.3441 ++ 927.215007 m 0.0000 153 | 6/9
11 h-m-p 0.0027 1.3271 0.7636 +++++ 925.373149 m 1.3271 168 | 7/9
12 h-m-p 1.4601 8.0000 0.0007 +YCCC 925.154199 3 3.8867 189 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ++ 925.154182 m 8.0000 203 | 7/9
14 h-m-p 0.3751 8.0000 0.0003 +C 925.154136 0 2.2619 218 | 7/9
15 h-m-p 1.6000 8.0000 0.0003 ++ 925.153610 m 8.0000 232 | 7/9
16 h-m-p 0.2990 8.0000 0.0079 ---------------.. | 7/9
17 h-m-p 0.0160 8.0000 4.0628 ----C 925.153459 0 0.0000 277 | 7/9
18 h-m-p 0.0160 8.0000 0.2978 +++Y 925.131074 0 1.0240 292 | 7/9
19 h-m-p 1.6000 8.0000 0.0001 Y 925.131070 0 1.0446 306 | 7/9
20 h-m-p 1.1519 8.0000 0.0000 Y 925.131070 0 0.8843 320 | 7/9
21 h-m-p 0.2762 8.0000 0.0002 +C 925.131070 0 1.6020 335 | 7/9
22 h-m-p 0.6010 8.0000 0.0004 +Y 925.131070 0 4.1232 350 | 7/9
23 h-m-p 1.0078 8.0000 0.0017 ++ 925.131070 m 8.0000 364 | 7/9
24 h-m-p 0.4350 8.0000 0.0318 ++C 925.131067 0 6.0785 380 | 7/9
25 h-m-p 1.6000 8.0000 0.0198 C 925.131066 0 2.2536 394 | 7/9
26 h-m-p 1.2659 8.0000 0.0353 ++ 925.131065 m 8.0000 408 | 7/9
27 h-m-p 1.6000 8.0000 0.0871 C 925.131065 0 2.0144 422 | 7/9
28 h-m-p 1.6000 8.0000 0.0822 Y 925.131064 0 3.4727 436 | 7/9
29 h-m-p 1.6000 8.0000 0.1758
QuantileBeta(0.85, 2.50315, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.78439, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
Y 925.131064 0 4.3512 451
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14304, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14316, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14292, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
30 h-m-p 1.6000 8.0000 0.1964
QuantileBeta(0.85, 2.45730, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.40008, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
C 925.131064 0 1.7960 465
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49592, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49567, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.49579, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
31 h-m-p 1.0666 8.0000 0.3307
QuantileBeta(0.85, 2.84855, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.90680, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
+ 925.131064 m 8.0000 479
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14171, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14134, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.14152, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
32 h-m-p 1.6000 8.0000 0.6174
QuantileBeta(0.85, 6.12941, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.09305, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
Y 925.131064 0 2.6775 493
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79491, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79447, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.79469, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
33 h-m-p 1.6000 8.0000 0.4036
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.37794, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44526, 0.00500) = 1.000000e+00 2000 rounds
C 925.131064 0 1.6000 507
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44074, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44027, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.44050, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
34 h-m-p 0.4712 8.0000 1.3706
QuantileBeta(0.85, 8.08632, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.02376, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 17.77353, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
C 925.131064 0 2.9382 522
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.46769, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
35 h-m-p 1.6000 8.0000 0.1154
QuantileBeta(0.85, 11.65227, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.20601, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
C 925.131064 0 1.4502 534
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63529, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63468, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.63498, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
36 h-m-p 0.1256 8.0000 1.3322
QuantileBeta(0.85, 11.80228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 12.30417, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 14.31172, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
+ 925.131064 m 8.0000 549
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29296, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.29295, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
37 h-m-p 1.6000 8.0000 0.1701
QuantileBeta(0.85, 22.56514, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.38169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
C 925.131064 0 1.2955 561
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51381, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51288, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.51334, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
38 h-m-p 0.1201 8.0000 1.8347
QuantileBeta(0.85, 22.73373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 23.39491, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 26.03961, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 36.61840, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
C 925.131064 0 2.5212 577
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13919, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
39 h-m-p 1.6000 8.0000 2.4603
QuantileBeta(0.85, 23.20269, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 26.15506, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 26.89315, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.07767, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.12380, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.13534, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.13822, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.13894, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.13912, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.13916, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
C 925.131064 0 0.0000 599
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13919, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.13918, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
40 h-m-p 0.0048 2.4108 29.8082
QuantileBeta(0.85, 27.28290, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.71407, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 29.43873, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 36.33736, 0.00500) = 1.000000e+00 2000 rounds
+++ 925.131064 m 2.4108 614 | 8/9
41 h-m-p 0.0232 8.0000 0.0000 ++C 925.131064 0 0.5187 628 | 8/9
42 h-m-p 1.6000 8.0000 0.0000 ---Y 925.131064 0 0.0063 644
Out..
lnL = -925.131064
645 lfun, 7095 eigenQcodon, 38700 P(t)
Time used: 0:15
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.086089 0.021487 0.033047 0.044200 0.091204 0.085163 0.000100 0.900000 0.760284 1.239764 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.106956
np = 11
lnL0 = -947.374433
Iterating by ming2
Initial: fx= 947.374433
x= 0.08609 0.02149 0.03305 0.04420 0.09120 0.08516 0.00011 0.90000 0.76028 1.23976 951.42857
1 h-m-p 0.0000 0.0000 169.7715 ++ 947.285468 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 387739.4270 +YYYYCYYYCC 930.968470 10 0.0000 43 | 1/11
3 h-m-p 0.0006 0.0032 12.1169 ++ 930.573964 m 0.0032 57 | 2/11
4 h-m-p 0.0009 0.0045 5.2260 ++ 929.927312 m 0.0045 71 | 3/11
5 h-m-p 0.0008 0.0038 4.0291 ++ 929.754833 m 0.0038 85 | 4/11
6 h-m-p 0.0017 0.0144 5.5709 ++ 927.754240 m 0.0144 99 | 5/11
7 h-m-p 0.0383 0.5791 1.5088 --------------.. | 5/11
8 h-m-p 0.0000 0.0001 97.9079 +YYCCC 927.581475 4 0.0000 146 | 5/11
9 h-m-p 0.0000 0.0001 43.0122 ++ 927.390326 m 0.0001 160 | 6/11
10 h-m-p 0.0026 1.3140 0.6648 ------------.. | 6/11
11 h-m-p 0.0000 0.0080 22.0003 YCC 927.383726 2 0.0000 206 | 6/11
12 h-m-p 0.0000 0.0051 22.7299 +++CYYCYYYCYY 925.524914 10 0.0049 236 | 6/11
13 h-m-p 0.0717 0.5657 1.5380 --------------.. | 6/11
14 h-m-p 0.0000 0.0002 125.1606 +CYCC 925.155982 3 0.0001 282 | 6/11
15 h-m-p 0.0001 0.0134 100.4010 YYCCC 925.073709 4 0.0000 302 | 6/11
16 h-m-p 0.1779 8.0000 0.0165 +++ 924.979067 m 8.0000 317 | 6/11
17 h-m-p 1.6000 8.0000 0.0484 +CCC 924.939195 2 5.8831 341 | 6/11
18 h-m-p 1.5873 7.9365 0.0579 CCC 924.923674 2 1.5466 364 | 6/11
19 h-m-p 0.9961 4.9805 0.0742 ++ 924.909050 m 4.9805 383 | 6/11
20 h-m-p 0.0000 0.0000 0.2378
h-m-p: 4.30600033e-18 2.15300016e-17 2.37751585e-01 924.909050
.. | 6/11
21 h-m-p 0.0064 3.1955 2.8102 ---C 924.908970 0 0.0000 421 | 6/11
22 h-m-p 0.0064 3.1839 0.2868 ++++CYC 924.890514 2 1.4443 442 | 6/11
23 h-m-p 0.0991 0.4953 0.0110 ++ 924.889365 m 0.4953 461 | 6/11
24 h-m-p -0.0000 -0.0000 0.0166
h-m-p: -0.00000000e+00 -0.00000000e+00 1.66416146e-02 924.889365
.. | 6/11
25 h-m-p 0.0160 8.0000 5.6496 ----C 924.889077 0 0.0000 500 | 6/11
26 h-m-p 0.0160 8.0000 0.0079 +++++ 924.888640 m 8.0000 517 | 6/11
27 h-m-p 0.2752 1.8715 0.2299 ++ 924.887108 m 1.8715 536 | 7/11
28 h-m-p 0.5144 8.0000 0.0001 ++ 924.887105 m 8.0000 555 | 7/11
29 h-m-p 1.2198 6.0990 0.0001 C 924.887105 0 1.1054 573 | 7/11
30 h-m-p 1.6000 8.0000 0.0000 ------C 924.887105 0 0.0001 597
Out..
lnL = -924.887105
598 lfun, 7176 eigenQcodon, 39468 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -929.566541 S = -928.388777 -1.981237
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:25
did 20 / 58 patterns 0:26
did 30 / 58 patterns 0:26
did 40 / 58 patterns 0:26
did 50 / 58 patterns 0:26
did 58 / 58 patterns 0:26
Time used: 0:26
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=235
NC_011896_1_WP_010907971_1_898_MLBR_RS04225 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
NC_002677_1_NP_301647_1_519_lipB MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
NZ_AP014567_1_WP_119607926_1_933_lipB MDSIRSSPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP
****** *******************************************
NC_011896_1_WP_010907971_1_898_MLBR_RS04225 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
NC_002677_1_NP_301647_1_519_lipB VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655 VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
NZ_AP014567_1_WP_119607926_1_933_lipB VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE
**************************************************
NC_011896_1_WP_010907971_1_898_MLBR_RS04225 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
NC_002677_1_NP_301647_1_519_lipB PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655 PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
NZ_AP014567_1_WP_119607926_1_933_lipB PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA
**************************************************
NC_011896_1_WP_010907971_1_898_MLBR_RS04225 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
NC_002677_1_NP_301647_1_519_lipB IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655 IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
NZ_AP014567_1_WP_119607926_1_933_lipB IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA
**************************************************
NC_011896_1_WP_010907971_1_898_MLBR_RS04225 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
NC_002677_1_NP_301647_1_519_lipB VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655 VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
NZ_AP014567_1_WP_119607926_1_933_lipB VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
***********************************
>NC_011896_1_WP_010907971_1_898_MLBR_RS04225 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA CACTG >NC_002677_1_NP_301647_1_519_lipB ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA CACTG >NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA CACTG >NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA CACTG >NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655 ATGGATTCCATCCGGTCGATCCCGACCGCGATCGATGTCCGCCAGCTAGG CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA CACTG >NZ_AP014567_1_WP_119607926_1_933_lipB ATGGATTCCATCCGGTCGAGCCCGACCGCGATCGATGTCCGCCAGCTAGG CACCGTCGACTACCACATCGCCTGGCAACTACAGCGAGACCTGGCCGACG CCAGGGTCGCCGGCGGACCCGACACGCTGCTGCTACTGCAGCACCCGCCA GTCTACACCGCCGGACGGCGAACTCAGCCACACGAACGACCAAACCCGTC GCTGCACGGCGTTCCCGTTGTGGAAACCGACCGCGGAGGCAAGATCACCT GGCATGGCCCAGGGCAGTTGGTCGGCTACCCGATCATTGGGCTTGCCGAG CCGCTCGACGTAGTCAACTATGTTCGACGCCTCGAGGAAGCATTGATCAA GGTCTGTGCGGAACTGGGCCTGGACACCAGCCGAGTCAACGGCCGCTCCG GGATCTGGGTGCCGGGCAGTGCCGGTCAGCCTGCGCGCAAAATCGCCGCT ATCGGCGTCCGGGTGTCACGTGCGACGACGATGCACGGATTCGCGCTTAA TTGCCAGTGCGATCTGGACGCCTTCCACGCCATCGTACCTTGCGGCATCA GCGACGCCGGGGTGACATCGTTGTCCGCCGAACTCGGACGCACCGTTGCC GTCAACGATGTCCGCTCAGCGATCGCCGAGGCCGTCAACGACGCTTTGGA CGGTTGGTTAGCCCTGAGCTGGCTGTCCACTCCTGCCAGCGTAACATCGA CACTG
>NC_011896_1_WP_010907971_1_898_MLBR_RS04225 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL >NC_002677_1_NP_301647_1_519_lipB MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL >NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL >NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL >NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655 MDSIRSIPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL >NZ_AP014567_1_WP_119607926_1_933_lipB MDSIRSSPTAIDVRQLGTVDYHIAWQLQRDLADARVAGGPDTLLLLQHPP VYTAGRRTQPHERPNPSLHGVPVVETDRGGKITWHGPGQLVGYPIIGLAE PLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGSAGQPARKIAA IGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVA VNDVRSAIAEAVNDALDGWLALSWLSTPASVTSTL
#NEXUS
[ID: 0033211629]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907971_1_898_MLBR_RS04225
NC_002677_1_NP_301647_1_519_lipB
NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245
NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875
NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655
NZ_AP014567_1_WP_119607926_1_933_lipB
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907971_1_898_MLBR_RS04225,
2 NC_002677_1_NP_301647_1_519_lipB,
3 NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245,
4 NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875,
5 NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655,
6 NZ_AP014567_1_WP_119607926_1_933_lipB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05692483,2:0.05816516,3:0.05859471,4:0.05645646,5:0.06030559,6:0.1316257);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05692483,2:0.05816516,3:0.05859471,4:0.05645646,5:0.06030559,6:0.1316257);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -960.80 -964.51
2 -960.73 -965.94
--------------------------------------
TOTAL -960.76 -965.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lipB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865234 0.086321 0.328548 1.454788 0.833379 1435.17 1449.10 1.000
r(A<->C){all} 0.169455 0.020431 0.000016 0.451708 0.130662 364.30 390.96 1.000
r(A<->G){all} 0.168210 0.020840 0.000033 0.467182 0.127915 151.15 166.38 1.000
r(A<->T){all} 0.129645 0.014397 0.000024 0.378183 0.093504 212.10 272.31 1.000
r(C<->G){all} 0.172446 0.020243 0.000008 0.456181 0.136488 243.53 279.37 1.005
r(C<->T){all} 0.138734 0.016294 0.000026 0.403007 0.100266 155.51 226.84 1.010
r(G<->T){all} 0.221510 0.023819 0.000028 0.525740 0.194500 124.02 239.71 1.000
pi(A){all} 0.186343 0.000202 0.157136 0.212604 0.186300 1242.99 1276.20 1.000
pi(C){all} 0.340647 0.000305 0.306976 0.375705 0.340429 1056.40 1192.00 1.000
pi(G){all} 0.300136 0.000294 0.268114 0.333155 0.299848 1289.35 1302.00 1.000
pi(T){all} 0.172874 0.000203 0.145854 0.200270 0.172177 1254.13 1303.04 1.000
alpha{1,2} 0.221034 0.063450 0.004801 0.578018 0.157725 1191.84 1346.42 1.001
alpha{3} 0.397749 0.215608 0.000114 1.389900 0.230739 1178.38 1219.26 1.000
pinvar{all} 0.994574 0.000019 0.986051 0.999887 0.995732 1272.76 1277.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/lipB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 235
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 4 4 4 4 4 4 | TAC 3 3 3 3 3 3 | TGC 3 3 3 3 3 3
Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 6 6 6 6 6 6 | CGC 7 7 7 7 7 7
CTA 3 3 3 3 3 3 | CCA 4 4 4 4 4 4 | Gln CAA 1 1 1 1 1 1 | CGA 5 5 5 5 5 5
CTG 11 11 11 11 11 11 | CCG 6 6 6 6 6 6 | CAG 7 7 7 7 7 7 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 13 13 13 13 13 12 | ACC 7 7 7 7 7 7 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 5
ATA 0 0 0 0 0 0 | ACA 3 3 3 3 3 3 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 2 2 2 2 2 2
GTC 12 12 12 12 12 12 | GCC 17 17 17 17 17 17 | GAC 11 11 11 11 11 11 | GGC 11 11 11 11 11 11
GTA 3 3 3 3 3 3 | GCA 1 1 1 1 1 1 | Glu GAA 5 5 5 5 5 5 | GGA 5 5 5 5 5 5
GTG 4 4 4 4 4 4 | GCG 6 6 6 6 6 6 | GAG 3 3 3 3 3 3 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907971_1_898_MLBR_RS04225
position 1: T:0.12766 C:0.27660 A:0.19574 G:0.40000
position 2: T:0.27660 C:0.28085 A:0.21702 G:0.22553
position 3: T:0.11064 C:0.46809 A:0.14468 G:0.27660
Average T:0.17163 C:0.34184 A:0.18582 G:0.30071
#2: NC_002677_1_NP_301647_1_519_lipB
position 1: T:0.12766 C:0.27660 A:0.19574 G:0.40000
position 2: T:0.27660 C:0.28085 A:0.21702 G:0.22553
position 3: T:0.11064 C:0.46809 A:0.14468 G:0.27660
Average T:0.17163 C:0.34184 A:0.18582 G:0.30071
#3: NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245
position 1: T:0.12766 C:0.27660 A:0.19574 G:0.40000
position 2: T:0.27660 C:0.28085 A:0.21702 G:0.22553
position 3: T:0.11064 C:0.46809 A:0.14468 G:0.27660
Average T:0.17163 C:0.34184 A:0.18582 G:0.30071
#4: NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875
position 1: T:0.12766 C:0.27660 A:0.19574 G:0.40000
position 2: T:0.27660 C:0.28085 A:0.21702 G:0.22553
position 3: T:0.11064 C:0.46809 A:0.14468 G:0.27660
Average T:0.17163 C:0.34184 A:0.18582 G:0.30071
#5: NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655
position 1: T:0.12766 C:0.27660 A:0.19574 G:0.40000
position 2: T:0.27660 C:0.28085 A:0.21702 G:0.22553
position 3: T:0.11064 C:0.46809 A:0.14468 G:0.27660
Average T:0.17163 C:0.34184 A:0.18582 G:0.30071
#6: NZ_AP014567_1_WP_119607926_1_933_lipB
position 1: T:0.12766 C:0.27660 A:0.19574 G:0.40000
position 2: T:0.27234 C:0.28085 A:0.21702 G:0.22979
position 3: T:0.11064 C:0.46809 A:0.14468 G:0.27660
Average T:0.17021 C:0.34184 A:0.18582 G:0.30213
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 12 | TCC 24 | TAC 18 | TGC 18
Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 6 | Arg R CGT 6
CTC 18 | CCC 12 | CAC 36 | CGC 42
CTA 18 | CCA 24 | Gln Q CAA 6 | CGA 30
CTG 66 | CCG 36 | CAG 42 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 6
ATC 77 | ACC 42 | AAC 30 | AGC 25
ATA 0 | ACA 18 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 18 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 12
GTC 72 | GCC 102 | GAC 66 | GGC 66
GTA 18 | GCA 6 | Glu E GAA 30 | GGA 30
GTG 24 | GCG 36 | GAG 18 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12766 C:0.27660 A:0.19574 G:0.40000
position 2: T:0.27589 C:0.28085 A:0.21702 G:0.22624
position 3: T:0.11064 C:0.46809 A:0.14468 G:0.27660
Average T:0.17139 C:0.34184 A:0.18582 G:0.30095
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -924.887091 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004304 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004324
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004304);
(NC_011896_1_WP_010907971_1_898_MLBR_RS04225: 0.000004, NC_002677_1_NP_301647_1_519_lipB: 0.000004, NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245: 0.000004, NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875: 0.000004, NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655: 0.000004, NZ_AP014567_1_WP_119607926_1_933_lipB: 0.004304);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 156.2 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 156.2 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 156.2 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 156.2 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 156.2 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 548.8 156.2 999.0000 0.0018 0.0000 1.0 0.0
tree length for dN: 0.0019
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -925.131064 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004330 0.000100 0.834608 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004350
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004330);
(NC_011896_1_WP_010907971_1_898_MLBR_RS04225: 0.000004, NC_002677_1_NP_301647_1_519_lipB: 0.000004, NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245: 0.000004, NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875: 0.000004, NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655: 0.000004, NZ_AP014567_1_WP_119607926_1_933_lipB: 0.004330);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.83461 0.16539
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 548.8 156.2 1.0000 0.0014 0.0014 0.8 0.2
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -924.887114 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004304 0.000100 0.000000 0.004097 0.000001 951.452312
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004324
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004304);
(NC_011896_1_WP_010907971_1_898_MLBR_RS04225: 0.000004, NC_002677_1_NP_301647_1_519_lipB: 0.000004, NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245: 0.000004, NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875: 0.000004, NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655: 0.000004, NZ_AP014567_1_WP_119607926_1_933_lipB: 0.004304);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00410 0.99590
w: 0.00000 1.00000 951.45231
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 156.2 947.5584 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 156.2 947.5584 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 156.2 947.5584 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 156.2 947.5584 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 156.2 947.5584 0.0000 0.0000 0.0 0.0
7..6 0.004 548.8 156.2 947.5584 0.0018 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907971_1_898_MLBR_RS04225)
Pr(w>1) post mean +- SE for w
1 M 0.996** 947.543
2 D 0.996** 947.546
3 S 0.996** 947.540
4 I 0.996** 947.539
5 R 0.996** 947.547
6 S 0.996** 947.549
7 I 1.000** 951.448
8 P 0.996** 947.544
9 T 0.996** 947.542
10 A 0.996** 947.544
11 I 0.996** 947.539
12 D 0.996** 947.546
13 V 0.996** 947.535
14 R 0.996** 947.535
15 Q 0.996** 947.539
16 L 0.996** 947.551
17 G 0.996** 947.533
18 T 0.996** 947.542
19 V 0.996** 947.535
20 D 0.996** 947.526
21 Y 0.996** 947.542
22 H 0.996** 947.531
23 I 0.996** 947.539
24 A 0.996** 947.534
25 W 0.996** 947.545
26 Q 0.996** 947.545
27 L 0.996** 947.551
28 Q 0.996** 947.539
29 R 0.996** 947.552
30 D 0.996** 947.526
31 L 0.996** 947.544
32 A 0.996** 947.534
33 D 0.996** 947.526
34 A 0.996** 947.534
35 R 0.996** 947.547
36 V 0.996** 947.535
37 A 0.996** 947.534
38 G 0.996** 947.533
39 G 0.996** 947.551
40 P 0.996** 947.535
41 D 0.996** 947.526
42 T 0.996** 947.549
43 L 0.996** 947.544
44 L 0.996** 947.544
45 L 0.996** 947.551
46 L 0.996** 947.544
47 Q 0.996** 947.539
48 H 0.996** 947.531
49 P 0.996** 947.544
50 P 0.996** 947.551
51 V 0.996** 947.535
52 Y 0.996** 947.542
53 T 0.996** 947.542
54 A 0.996** 947.534
55 G 0.996** 947.551
56 R 0.996** 947.547
57 R 0.996** 947.552
58 T 0.996** 947.554
59 Q 0.996** 947.539
60 P 0.996** 947.551
61 H 0.996** 947.531
62 E 0.996** 947.542
63 R 0.996** 947.552
64 P 0.996** 947.551
65 N 0.996** 947.539
66 P 0.996** 947.544
67 S 0.996** 947.549
68 L 0.996** 947.544
69 H 0.996** 947.531
70 G 0.996** 947.533
71 V 0.996** 947.553
72 P 0.996** 947.535
73 V 0.996** 947.553
74 V 0.996** 947.544
75 E 0.996** 947.542
76 T 0.996** 947.542
77 D 0.996** 947.526
78 R 0.996** 947.535
79 G 0.996** 947.551
80 G 0.996** 947.533
81 K 0.996** 947.546
82 I 0.996** 947.539
83 T 0.996** 947.542
84 W 0.996** 947.545
85 H 0.996** 947.548
86 G 0.996** 947.533
87 P 0.996** 947.551
88 G 0.996** 947.543
89 Q 0.996** 947.539
90 L 0.996** 947.545
91 V 0.996** 947.535
92 G 0.996** 947.533
93 Y 0.996** 947.542
94 P 0.996** 947.544
95 I 0.996** 947.539
96 I 0.996** 947.552
97 G 0.996** 947.543
98 L 0.996** 947.553
99 A 0.996** 947.534
100 E 0.996** 947.536
101 P 0.996** 947.544
102 L 0.996** 947.535
103 D 0.996** 947.526
104 V 0.996** 947.551
105 V 0.996** 947.535
106 N 0.996** 947.539
107 Y 0.996** 947.554
108 V 0.996** 947.553
109 R 0.996** 947.552
110 R 0.996** 947.535
111 L 0.996** 947.535
112 E 0.996** 947.536
113 E 0.996** 947.542
114 A 0.996** 947.551
115 L 0.996** 947.545
116 I 0.996** 947.539
117 K 0.996** 947.546
118 V 0.996** 947.535
119 C 0.996** 947.553
120 A 0.996** 947.544
121 E 0.996** 947.542
122 L 0.996** 947.544
123 G 0.996** 947.533
124 L 0.996** 947.544
125 D 0.996** 947.526
126 T 0.996** 947.542
127 S 0.996** 947.539
128 R 0.996** 947.552
129 V 0.996** 947.535
130 N 0.996** 947.539
131 G 0.996** 947.533
132 R 0.996** 947.535
133 S 0.996** 947.540
134 G 0.996** 947.543
135 I 0.996** 947.539
136 W 0.996** 947.545
137 V 0.996** 947.544
138 P 0.996** 947.544
139 G 0.996** 947.533
140 S 0.996** 947.551
141 A 0.996** 947.534
142 G 0.996** 947.552
143 Q 0.996** 947.539
144 P 0.996** 947.553
145 A 0.996** 947.544
146 R 0.996** 947.535
147 K 0.996** 947.550
148 I 0.996** 947.539
149 A 0.996** 947.534
150 A 0.996** 947.553
151 I 0.996** 947.539
152 G 0.996** 947.533
153 V 0.996** 947.535
154 R 0.996** 947.547
155 V 0.996** 947.544
156 S 0.996** 947.554
157 R 0.996** 947.553
158 A 0.996** 947.544
159 T 0.996** 947.549
160 T 0.996** 947.549
161 M 0.996** 947.543
162 H 0.996** 947.531
163 G 0.996** 947.551
164 F 0.996** 947.538
165 A 0.996** 947.544
166 L 0.996** 947.553
167 N 0.996** 947.551
168 C 0.996** 947.540
169 Q 0.996** 947.539
170 C 0.996** 947.540
171 D 0.996** 947.546
172 L 0.996** 947.544
173 D 0.996** 947.526
174 A 0.996** 947.534
175 F 0.996** 947.538
176 H 0.996** 947.531
177 A 0.996** 947.534
178 I 0.996** 947.539
179 V 0.996** 947.551
180 P 0.996** 947.553
181 C 0.996** 947.540
182 G 0.996** 947.533
183 I 0.996** 947.539
184 S 0.996** 947.539
185 D 0.996** 947.526
186 A 0.996** 947.534
187 G 0.996** 947.543
188 V 0.996** 947.544
189 T 0.996** 947.553
190 S 0.996** 947.549
191 L 0.996** 947.545
192 S 0.996** 947.540
193 A 0.996** 947.534
194 E 0.996** 947.542
195 L 0.996** 947.535
196 G 0.996** 947.551
197 R 0.996** 947.535
198 T 0.996** 947.542
199 V 0.996** 947.553
200 A 0.996** 947.534
201 V 0.996** 947.535
202 N 0.996** 947.539
203 D 0.996** 947.546
204 V 0.996** 947.535
205 R 0.996** 947.535
206 S 0.996** 947.554
207 A 0.996** 947.544
208 I 0.996** 947.539
209 A 0.996** 947.534
210 E 0.996** 947.536
211 A 0.996** 947.534
212 V 0.996** 947.535
213 N 0.996** 947.539
214 D 0.996** 947.526
215 A 0.996** 947.553
216 L 0.996** 947.545
217 D 0.996** 947.526
218 G 0.996** 947.552
219 W 0.996** 947.545
220 L 0.996** 947.551
221 A 0.996** 947.534
222 L 0.996** 947.544
223 S 0.996** 947.539
224 W 0.996** 947.545
225 L 0.996** 947.544
226 S 0.996** 947.540
227 T 0.996** 947.554
228 P 0.996** 947.553
229 A 0.996** 947.534
230 S 0.996** 947.539
231 V 0.996** 947.551
232 T 0.996** 947.553
233 S 0.996** 947.549
234 T 0.996** 947.553
235 L 0.996** 947.544
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907971_1_898_MLBR_RS04225)
Pr(w>1) post mean +- SE for w
7 I 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -925.131064 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004330 0.000100 99.000000 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004350
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004330);
(NC_011896_1_WP_010907971_1_898_MLBR_RS04225: 0.000004, NC_002677_1_NP_301647_1_519_lipB: 0.000004, NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245: 0.000004, NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875: 0.000004, NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655: 0.000004, NZ_AP014567_1_WP_119607926_1_933_lipB: 0.004330);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 99.00000 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 156.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 548.8 156.2 1.0000 0.0014 0.0014 0.8 0.2
Time used: 0:15
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -924.887105 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004304 0.000100 0.000010 0.005002 1.704441 951.431102
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004324
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004304);
(NC_011896_1_WP_010907971_1_898_MLBR_RS04225: 0.000004, NC_002677_1_NP_301647_1_519_lipB: 0.000004, NZ_LVXE01000007_1_WP_010907971_1_2570_A3216_RS04245: 0.000004, NZ_LYPH01000011_1_WP_010907971_1_392_A8144_RS01875: 0.000004, NZ_CP029543_1_WP_010907971_1_916_DIJ64_RS04655: 0.000004, NZ_AP014567_1_WP_119607926_1_933_lipB: 0.004304);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.70444
(p1 = 0.99999) w = 951.43110
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 951.43110
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 548.8 156.2 951.4216 0.0000 0.0000 0.0 0.0
7..2 0.000 548.8 156.2 951.4216 0.0000 0.0000 0.0 0.0
7..3 0.000 548.8 156.2 951.4216 0.0000 0.0000 0.0 0.0
7..4 0.000 548.8 156.2 951.4216 0.0000 0.0000 0.0 0.0
7..5 0.000 548.8 156.2 951.4216 0.0000 0.0000 0.0 0.0
7..6 0.004 548.8 156.2 951.4216 0.0018 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907971_1_898_MLBR_RS04225)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.422
2 D 1.000** 951.422
3 S 1.000** 951.422
4 I 1.000** 951.422
5 R 1.000** 951.422
6 S 1.000** 951.422
7 I 1.000** 951.431
8 P 1.000** 951.422
9 T 1.000** 951.422
10 A 1.000** 951.422
11 I 1.000** 951.422
12 D 1.000** 951.422
13 V 1.000** 951.422
14 R 1.000** 951.422
15 Q 1.000** 951.422
16 L 1.000** 951.422
17 G 1.000** 951.422
18 T 1.000** 951.422
19 V 1.000** 951.422
20 D 1.000** 951.422
21 Y 1.000** 951.422
22 H 1.000** 951.422
23 I 1.000** 951.422
24 A 1.000** 951.422
25 W 1.000** 951.422
26 Q 1.000** 951.422
27 L 1.000** 951.422
28 Q 1.000** 951.422
29 R 1.000** 951.422
30 D 1.000** 951.422
31 L 1.000** 951.422
32 A 1.000** 951.422
33 D 1.000** 951.422
34 A 1.000** 951.422
35 R 1.000** 951.422
36 V 1.000** 951.422
37 A 1.000** 951.422
38 G 1.000** 951.422
39 G 1.000** 951.422
40 P 1.000** 951.422
41 D 1.000** 951.422
42 T 1.000** 951.422
43 L 1.000** 951.422
44 L 1.000** 951.422
45 L 1.000** 951.422
46 L 1.000** 951.422
47 Q 1.000** 951.422
48 H 1.000** 951.422
49 P 1.000** 951.422
50 P 1.000** 951.422
51 V 1.000** 951.422
52 Y 1.000** 951.422
53 T 1.000** 951.422
54 A 1.000** 951.422
55 G 1.000** 951.422
56 R 1.000** 951.422
57 R 1.000** 951.422
58 T 1.000** 951.422
59 Q 1.000** 951.422
60 P 1.000** 951.422
61 H 1.000** 951.422
62 E 1.000** 951.422
63 R 1.000** 951.422
64 P 1.000** 951.422
65 N 1.000** 951.422
66 P 1.000** 951.422
67 S 1.000** 951.422
68 L 1.000** 951.422
69 H 1.000** 951.422
70 G 1.000** 951.422
71 V 1.000** 951.422
72 P 1.000** 951.422
73 V 1.000** 951.422
74 V 1.000** 951.422
75 E 1.000** 951.422
76 T 1.000** 951.422
77 D 1.000** 951.422
78 R 1.000** 951.422
79 G 1.000** 951.422
80 G 1.000** 951.422
81 K 1.000** 951.422
82 I 1.000** 951.422
83 T 1.000** 951.422
84 W 1.000** 951.422
85 H 1.000** 951.422
86 G 1.000** 951.422
87 P 1.000** 951.422
88 G 1.000** 951.422
89 Q 1.000** 951.422
90 L 1.000** 951.422
91 V 1.000** 951.422
92 G 1.000** 951.422
93 Y 1.000** 951.422
94 P 1.000** 951.422
95 I 1.000** 951.422
96 I 1.000** 951.422
97 G 1.000** 951.422
98 L 1.000** 951.422
99 A 1.000** 951.422
100 E 1.000** 951.422
101 P 1.000** 951.422
102 L 1.000** 951.422
103 D 1.000** 951.422
104 V 1.000** 951.422
105 V 1.000** 951.422
106 N 1.000** 951.422
107 Y 1.000** 951.422
108 V 1.000** 951.422
109 R 1.000** 951.422
110 R 1.000** 951.422
111 L 1.000** 951.422
112 E 1.000** 951.422
113 E 1.000** 951.422
114 A 1.000** 951.422
115 L 1.000** 951.422
116 I 1.000** 951.422
117 K 1.000** 951.422
118 V 1.000** 951.422
119 C 1.000** 951.422
120 A 1.000** 951.422
121 E 1.000** 951.422
122 L 1.000** 951.422
123 G 1.000** 951.422
124 L 1.000** 951.422
125 D 1.000** 951.422
126 T 1.000** 951.422
127 S 1.000** 951.422
128 R 1.000** 951.422
129 V 1.000** 951.422
130 N 1.000** 951.422
131 G 1.000** 951.422
132 R 1.000** 951.422
133 S 1.000** 951.422
134 G 1.000** 951.422
135 I 1.000** 951.422
136 W 1.000** 951.422
137 V 1.000** 951.422
138 P 1.000** 951.422
139 G 1.000** 951.422
140 S 1.000** 951.422
141 A 1.000** 951.422
142 G 1.000** 951.422
143 Q 1.000** 951.422
144 P 1.000** 951.422
145 A 1.000** 951.422
146 R 1.000** 951.422
147 K 1.000** 951.422
148 I 1.000** 951.422
149 A 1.000** 951.422
150 A 1.000** 951.422
151 I 1.000** 951.422
152 G 1.000** 951.422
153 V 1.000** 951.422
154 R 1.000** 951.422
155 V 1.000** 951.422
156 S 1.000** 951.422
157 R 1.000** 951.422
158 A 1.000** 951.422
159 T 1.000** 951.422
160 T 1.000** 951.422
161 M 1.000** 951.422
162 H 1.000** 951.422
163 G 1.000** 951.422
164 F 1.000** 951.422
165 A 1.000** 951.422
166 L 1.000** 951.422
167 N 1.000** 951.422
168 C 1.000** 951.422
169 Q 1.000** 951.422
170 C 1.000** 951.422
171 D 1.000** 951.422
172 L 1.000** 951.422
173 D 1.000** 951.422
174 A 1.000** 951.422
175 F 1.000** 951.422
176 H 1.000** 951.422
177 A 1.000** 951.422
178 I 1.000** 951.422
179 V 1.000** 951.422
180 P 1.000** 951.422
181 C 1.000** 951.422
182 G 1.000** 951.422
183 I 1.000** 951.422
184 S 1.000** 951.422
185 D 1.000** 951.422
186 A 1.000** 951.422
187 G 1.000** 951.422
188 V 1.000** 951.422
189 T 1.000** 951.422
190 S 1.000** 951.422
191 L 1.000** 951.422
192 S 1.000** 951.422
193 A 1.000** 951.422
194 E 1.000** 951.422
195 L 1.000** 951.422
196 G 1.000** 951.422
197 R 1.000** 951.422
198 T 1.000** 951.422
199 V 1.000** 951.422
200 A 1.000** 951.422
201 V 1.000** 951.422
202 N 1.000** 951.422
203 D 1.000** 951.422
204 V 1.000** 951.422
205 R 1.000** 951.422
206 S 1.000** 951.422
207 A 1.000** 951.422
208 I 1.000** 951.422
209 A 1.000** 951.422
210 E 1.000** 951.422
211 A 1.000** 951.422
212 V 1.000** 951.422
213 N 1.000** 951.422
214 D 1.000** 951.422
215 A 1.000** 951.422
216 L 1.000** 951.422
217 D 1.000** 951.422
218 G 1.000** 951.422
219 W 1.000** 951.422
220 L 1.000** 951.422
221 A 1.000** 951.422
222 L 1.000** 951.422
223 S 1.000** 951.422
224 W 1.000** 951.422
225 L 1.000** 951.422
226 S 1.000** 951.422
227 T 1.000** 951.422
228 P 1.000** 951.422
229 A 1.000** 951.422
230 S 1.000** 951.422
231 V 1.000** 951.422
232 T 1.000** 951.422
233 S 1.000** 951.422
234 T 1.000** 951.422
235 L 1.000** 951.422
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907971_1_898_MLBR_RS04225)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 D 0.639 4.860 +- 3.856
3 S 0.639 4.860 +- 3.856
4 I 0.639 4.860 +- 3.856
5 R 0.639 4.860 +- 3.856
6 S 0.639 4.860 +- 3.856
7 I 0.923 6.858 +- 3.003
8 P 0.639 4.860 +- 3.856
9 T 0.639 4.860 +- 3.856
10 A 0.639 4.860 +- 3.856
11 I 0.639 4.860 +- 3.856
12 D 0.639 4.860 +- 3.856
13 V 0.639 4.860 +- 3.856
14 R 0.639 4.860 +- 3.856
15 Q 0.639 4.860 +- 3.856
16 L 0.639 4.860 +- 3.856
17 G 0.639 4.860 +- 3.856
18 T 0.639 4.860 +- 3.856
19 V 0.639 4.860 +- 3.856
20 D 0.639 4.860 +- 3.856
21 Y 0.639 4.860 +- 3.856
22 H 0.639 4.860 +- 3.856
23 I 0.639 4.860 +- 3.856
24 A 0.639 4.860 +- 3.856
25 W 0.639 4.860 +- 3.856
26 Q 0.639 4.860 +- 3.856
27 L 0.639 4.860 +- 3.856
28 Q 0.639 4.860 +- 3.856
29 R 0.639 4.860 +- 3.856
30 D 0.639 4.860 +- 3.856
31 L 0.639 4.860 +- 3.856
32 A 0.639 4.860 +- 3.856
33 D 0.639 4.860 +- 3.856
34 A 0.639 4.860 +- 3.856
35 R 0.639 4.860 +- 3.856
36 V 0.639 4.860 +- 3.856
37 A 0.639 4.860 +- 3.856
38 G 0.639 4.860 +- 3.856
39 G 0.639 4.860 +- 3.856
40 P 0.639 4.860 +- 3.856
41 D 0.639 4.860 +- 3.856
42 T 0.639 4.860 +- 3.856
43 L 0.639 4.860 +- 3.856
44 L 0.639 4.860 +- 3.856
45 L 0.639 4.860 +- 3.856
46 L 0.639 4.860 +- 3.856
47 Q 0.639 4.860 +- 3.856
48 H 0.639 4.860 +- 3.856
49 P 0.639 4.860 +- 3.856
50 P 0.639 4.860 +- 3.856
51 V 0.639 4.860 +- 3.856
52 Y 0.639 4.860 +- 3.856
53 T 0.639 4.860 +- 3.856
54 A 0.639 4.860 +- 3.856
55 G 0.639 4.860 +- 3.856
56 R 0.639 4.860 +- 3.856
57 R 0.639 4.860 +- 3.856
58 T 0.639 4.860 +- 3.856
59 Q 0.639 4.860 +- 3.856
60 P 0.639 4.860 +- 3.856
61 H 0.639 4.860 +- 3.856
62 E 0.639 4.860 +- 3.856
63 R 0.639 4.860 +- 3.856
64 P 0.639 4.860 +- 3.856
65 N 0.639 4.860 +- 3.856
66 P 0.639 4.860 +- 3.856
67 S 0.639 4.860 +- 3.856
68 L 0.639 4.860 +- 3.856
69 H 0.639 4.860 +- 3.856
70 G 0.639 4.860 +- 3.856
71 V 0.639 4.860 +- 3.856
72 P 0.639 4.860 +- 3.856
73 V 0.639 4.860 +- 3.856
74 V 0.639 4.860 +- 3.856
75 E 0.639 4.860 +- 3.856
76 T 0.639 4.860 +- 3.856
77 D 0.639 4.860 +- 3.856
78 R 0.639 4.860 +- 3.856
79 G 0.639 4.860 +- 3.856
80 G 0.639 4.860 +- 3.856
81 K 0.639 4.860 +- 3.856
82 I 0.639 4.860 +- 3.856
83 T 0.639 4.860 +- 3.856
84 W 0.639 4.860 +- 3.856
85 H 0.639 4.860 +- 3.856
86 G 0.639 4.860 +- 3.856
87 P 0.639 4.860 +- 3.856
88 G 0.639 4.860 +- 3.856
89 Q 0.639 4.860 +- 3.856
90 L 0.639 4.860 +- 3.856
91 V 0.639 4.860 +- 3.856
92 G 0.639 4.860 +- 3.856
93 Y 0.639 4.860 +- 3.856
94 P 0.639 4.860 +- 3.856
95 I 0.639 4.860 +- 3.856
96 I 0.639 4.860 +- 3.856
97 G 0.639 4.860 +- 3.856
98 L 0.639 4.860 +- 3.856
99 A 0.639 4.860 +- 3.856
100 E 0.639 4.860 +- 3.856
101 P 0.639 4.860 +- 3.856
102 L 0.639 4.860 +- 3.856
103 D 0.639 4.860 +- 3.856
104 V 0.639 4.860 +- 3.856
105 V 0.639 4.860 +- 3.856
106 N 0.639 4.860 +- 3.856
107 Y 0.639 4.860 +- 3.856
108 V 0.639 4.860 +- 3.856
109 R 0.639 4.860 +- 3.856
110 R 0.639 4.860 +- 3.856
111 L 0.639 4.860 +- 3.856
112 E 0.639 4.860 +- 3.856
113 E 0.639 4.860 +- 3.856
114 A 0.639 4.860 +- 3.856
115 L 0.639 4.860 +- 3.856
116 I 0.639 4.860 +- 3.856
117 K 0.639 4.860 +- 3.856
118 V 0.639 4.860 +- 3.856
119 C 0.639 4.860 +- 3.856
120 A 0.639 4.860 +- 3.856
121 E 0.639 4.860 +- 3.856
122 L 0.639 4.860 +- 3.856
123 G 0.639 4.860 +- 3.856
124 L 0.639 4.860 +- 3.856
125 D 0.639 4.860 +- 3.856
126 T 0.639 4.860 +- 3.856
127 S 0.639 4.860 +- 3.856
128 R 0.639 4.860 +- 3.856
129 V 0.639 4.860 +- 3.856
130 N 0.639 4.860 +- 3.856
131 G 0.639 4.860 +- 3.856
132 R 0.639 4.860 +- 3.856
133 S 0.639 4.860 +- 3.856
134 G 0.639 4.860 +- 3.856
135 I 0.639 4.860 +- 3.856
136 W 0.639 4.860 +- 3.856
137 V 0.639 4.860 +- 3.856
138 P 0.639 4.860 +- 3.856
139 G 0.639 4.860 +- 3.856
140 S 0.639 4.860 +- 3.856
141 A 0.639 4.860 +- 3.856
142 G 0.639 4.860 +- 3.856
143 Q 0.639 4.860 +- 3.856
144 P 0.639 4.860 +- 3.856
145 A 0.639 4.860 +- 3.856
146 R 0.639 4.860 +- 3.856
147 K 0.639 4.860 +- 3.856
148 I 0.639 4.860 +- 3.856
149 A 0.639 4.860 +- 3.856
150 A 0.639 4.860 +- 3.856
151 I 0.639 4.860 +- 3.856
152 G 0.639 4.860 +- 3.856
153 V 0.639 4.860 +- 3.856
154 R 0.639 4.860 +- 3.856
155 V 0.639 4.860 +- 3.856
156 S 0.639 4.860 +- 3.856
157 R 0.639 4.860 +- 3.856
158 A 0.639 4.860 +- 3.856
159 T 0.639 4.860 +- 3.856
160 T 0.639 4.860 +- 3.856
161 M 0.639 4.860 +- 3.856
162 H 0.639 4.860 +- 3.856
163 G 0.639 4.860 +- 3.856
164 F 0.639 4.860 +- 3.856
165 A 0.639 4.860 +- 3.856
166 L 0.639 4.860 +- 3.856
167 N 0.639 4.860 +- 3.856
168 C 0.639 4.860 +- 3.856
169 Q 0.639 4.860 +- 3.856
170 C 0.639 4.860 +- 3.856
171 D 0.639 4.860 +- 3.856
172 L 0.639 4.860 +- 3.856
173 D 0.639 4.860 +- 3.856
174 A 0.639 4.860 +- 3.856
175 F 0.639 4.860 +- 3.856
176 H 0.639 4.860 +- 3.856
177 A 0.639 4.860 +- 3.856
178 I 0.639 4.860 +- 3.856
179 V 0.639 4.860 +- 3.856
180 P 0.639 4.860 +- 3.856
181 C 0.639 4.860 +- 3.856
182 G 0.639 4.860 +- 3.856
183 I 0.639 4.860 +- 3.856
184 S 0.639 4.860 +- 3.856
185 D 0.639 4.860 +- 3.856
186 A 0.639 4.860 +- 3.856
187 G 0.639 4.860 +- 3.856
188 V 0.639 4.860 +- 3.856
189 T 0.639 4.860 +- 3.856
190 S 0.639 4.860 +- 3.856
191 L 0.639 4.860 +- 3.856
192 S 0.639 4.860 +- 3.856
193 A 0.639 4.860 +- 3.856
194 E 0.639 4.860 +- 3.856
195 L 0.639 4.860 +- 3.856
196 G 0.639 4.860 +- 3.856
197 R 0.639 4.860 +- 3.856
198 T 0.639 4.860 +- 3.856
199 V 0.639 4.860 +- 3.856
200 A 0.639 4.860 +- 3.856
201 V 0.639 4.860 +- 3.856
202 N 0.639 4.860 +- 3.856
203 D 0.639 4.860 +- 3.856
204 V 0.639 4.860 +- 3.856
205 R 0.639 4.860 +- 3.856
206 S 0.639 4.860 +- 3.856
207 A 0.639 4.860 +- 3.856
208 I 0.639 4.860 +- 3.856
209 A 0.639 4.860 +- 3.856
210 E 0.639 4.860 +- 3.856
211 A 0.639 4.860 +- 3.856
212 V 0.639 4.860 +- 3.856
213 N 0.639 4.860 +- 3.856
214 D 0.639 4.860 +- 3.856
215 A 0.639 4.860 +- 3.856
216 L 0.639 4.860 +- 3.856
217 D 0.639 4.860 +- 3.856
218 G 0.639 4.860 +- 3.856
219 W 0.639 4.860 +- 3.856
220 L 0.639 4.860 +- 3.856
221 A 0.639 4.860 +- 3.856
222 L 0.639 4.860 +- 3.856
223 S 0.639 4.860 +- 3.856
224 W 0.639 4.860 +- 3.856
225 L 0.639 4.860 +- 3.856
226 S 0.639 4.860 +- 3.856
227 T 0.639 4.860 +- 3.856
228 P 0.639 4.860 +- 3.856
229 A 0.639 4.860 +- 3.856
230 S 0.639 4.860 +- 3.856
231 V 0.639 4.860 +- 3.856
232 T 0.639 4.860 +- 3.856
233 S 0.639 4.860 +- 3.856
234 T 0.639 4.860 +- 3.856
235 L 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:26
Model 1: NearlyNeutral -925.131064 Model 2: PositiveSelection -924.887114 Model 0: one-ratio -924.887091 Model 7: beta -925.131064 Model 8: beta&w>1 -924.887105 Model 0 vs 1 0.48794599999996535 Model 2 vs 1 0.4879000000000815 Model 8 vs 7 0.48791800000003605
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
