--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:04:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lpqE/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -749.43 -752.95
2 -749.44 -752.83
--------------------------------------
TOTAL -749.43 -752.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898465 0.087113 0.380262 1.474698 0.865149 1481.87 1491.43 1.000
r(A<->C){all} 0.163160 0.019344 0.000011 0.437850 0.125165 232.91 236.47 1.006
r(A<->G){all} 0.171746 0.020952 0.000033 0.446796 0.130924 211.82 258.22 1.000
r(A<->T){all} 0.174831 0.021608 0.000008 0.477342 0.134048 114.57 172.05 1.004
r(C<->G){all} 0.160289 0.018310 0.000030 0.427387 0.128548 355.07 368.61 1.003
r(C<->T){all} 0.170025 0.020477 0.000001 0.467853 0.133263 106.51 187.84 1.005
r(G<->T){all} 0.159950 0.017585 0.000022 0.420643 0.128694 298.47 354.88 1.000
pi(A){all} 0.233613 0.000324 0.200038 0.268363 0.233836 1261.45 1343.21 1.000
pi(C){all} 0.336367 0.000402 0.294890 0.372343 0.336655 1175.94 1338.47 1.000
pi(G){all} 0.247722 0.000327 0.214047 0.284398 0.247265 1337.26 1341.14 1.000
pi(T){all} 0.182298 0.000271 0.148977 0.213472 0.181850 1218.68 1352.40 1.000
alpha{1,2} 0.413912 0.218203 0.000130 1.420727 0.243545 1138.35 1152.98 1.000
alpha{3} 0.465027 0.255495 0.000116 1.496414 0.290208 1016.07 1045.23 1.000
pinvar{all} 0.997076 0.000013 0.990551 0.999999 0.998204 1450.98 1475.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -716.627812
Model 2: PositiveSelection -716.627816
Model 0: one-ratio -716.627811
Model 7: beta -716.627812
Model 8: beta&w>1 -716.62781
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 8.000000207175617E-6
Model 8 vs 7 3.999999989900971E-6
>C1
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C2
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C3
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C4
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C5
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C6
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=183
C1 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C2 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C3 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C4 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C5 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C6 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
**************************************************
C1 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C2 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C3 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C4 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C5 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C6 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
**************************************************
C1 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C2 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C3 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C4 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C5 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C6 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
**************************************************
C1 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C2 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C3 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C4 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C5 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C6 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
*********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 183 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 183 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5490]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5490]--->[5490]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.723 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C2 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C3 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C4 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C5 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C6 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
**************************************************
C1 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C2 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C3 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C4 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C5 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C6 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
**************************************************
C1 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C2 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C3 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C4 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C5 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C6 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
**************************************************
C1 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C2 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C3 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C4 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C5 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C6 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
*********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C2 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C3 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C4 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C5 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C6 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
**************************************************
C1 CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C2 CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C3 CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C4 CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C5 CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C6 CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
**************************************************
C1 GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C2 GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C3 GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C4 GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C5 GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C6 GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
**************************************************
C1 GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C2 GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C3 GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C4 GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C5 GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C6 GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
**************************************************
C1 GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C2 GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C3 GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C4 GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C5 GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C6 GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
**************************************************
C1 CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C2 CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C3 CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C4 CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C5 CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C6 CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
**************************************************
C1 GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C2 GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C3 GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C4 GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C5 GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C6 GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
**************************************************
C1 GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C2 GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C3 GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C4 GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C5 GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C6 GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
**************************************************
C1 TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C2 TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C3 TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C4 TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C5 TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C6 TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
**************************************************
C1 ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C2 ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C3 ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C4 ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C5 ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C6 ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
**************************************************
C1 AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C2 AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C3 AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C4 AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C5 AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C6 AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
*************************************************
>C1
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C2
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C3
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C4
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C5
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C6
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C1
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C2
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C3
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C4
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C5
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C6
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 549 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791776
Setting output file names to "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 990593298
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0994188740
Seed = 664850199
Swapseed = 1579791776
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1228.688325 -- -24.965149
Chain 2 -- -1228.688325 -- -24.965149
Chain 3 -- -1228.688325 -- -24.965149
Chain 4 -- -1228.688325 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1228.688256 -- -24.965149
Chain 2 -- -1228.688256 -- -24.965149
Chain 3 -- -1228.688137 -- -24.965149
Chain 4 -- -1228.688137 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1228.688] (-1228.688) (-1228.688) (-1228.688) * [-1228.688] (-1228.688) (-1228.688) (-1228.688)
500 -- [-755.450] (-767.140) (-763.380) (-767.673) * (-764.042) (-767.488) [-761.143] (-763.153) -- 0:00:00
1000 -- (-763.886) (-757.011) [-762.739] (-775.608) * (-767.639) (-767.709) [-757.119] (-763.066) -- 0:00:00
1500 -- (-753.187) (-765.398) [-763.901] (-770.615) * (-763.974) [-760.444] (-756.260) (-755.468) -- 0:00:00
2000 -- [-756.125] (-754.793) (-756.427) (-764.219) * (-753.136) (-761.194) (-759.088) [-766.041] -- 0:08:19
2500 -- [-756.578] (-767.531) (-755.064) (-759.979) * (-755.295) (-759.819) [-759.942] (-763.292) -- 0:06:39
3000 -- (-760.524) (-762.287) [-763.186] (-754.362) * [-756.234] (-760.951) (-756.955) (-762.958) -- 0:05:32
3500 -- [-757.947] (-754.506) (-762.547) (-760.542) * (-759.199) (-768.833) (-755.427) [-758.374] -- 0:04:44
4000 -- (-761.142) (-760.600) [-758.987] (-760.153) * (-758.110) [-760.487] (-760.230) (-759.228) -- 0:04:09
4500 -- (-762.235) (-759.173) [-756.975] (-763.366) * (-760.419) [-760.497] (-759.099) (-760.026) -- 0:03:41
5000 -- (-759.996) [-756.845] (-757.115) (-758.162) * [-756.798] (-770.260) (-760.975) (-755.518) -- 0:03:19
Average standard deviation of split frequencies: 0.115784
5500 -- (-758.325) [-759.265] (-762.190) (-757.554) * [-754.586] (-755.881) (-763.559) (-754.550) -- 0:03:00
6000 -- [-758.825] (-756.815) (-758.866) (-761.467) * [-755.061] (-762.609) (-757.978) (-764.449) -- 0:02:45
6500 -- [-754.104] (-757.003) (-764.267) (-757.500) * [-759.876] (-765.273) (-758.093) (-764.539) -- 0:02:32
7000 -- (-759.305) (-757.145) [-761.494] (-759.524) * [-755.118] (-759.559) (-757.815) (-755.920) -- 0:02:21
7500 -- [-769.149] (-756.047) (-763.701) (-761.789) * [-756.267] (-757.395) (-773.221) (-759.628) -- 0:02:12
8000 -- (-759.939) (-757.222) [-754.204] (-759.580) * (-764.204) [-765.826] (-750.716) (-755.795) -- 0:02:04
8500 -- [-758.343] (-758.151) (-759.730) (-761.930) * [-754.301] (-758.209) (-750.974) (-758.779) -- 0:01:56
9000 -- (-759.498) (-767.480) [-759.705] (-755.625) * (-754.879) (-760.631) (-749.005) [-762.033] -- 0:01:50
9500 -- (-760.943) [-760.898] (-761.344) (-763.217) * (-759.096) (-756.938) [-749.361] (-758.894) -- 0:01:44
10000 -- (-757.209) (-756.229) (-759.277) [-755.082] * (-759.000) [-759.548] (-753.737) (-765.271) -- 0:01:39
Average standard deviation of split frequencies: 0.083189
10500 -- [-754.014] (-762.223) (-762.536) (-764.007) * (-762.235) [-760.810] (-751.438) (-755.698) -- 0:01:34
11000 -- (-764.155) (-758.180) (-758.928) [-755.785] * [-757.645] (-756.319) (-749.360) (-761.048) -- 0:01:29
11500 -- [-757.313] (-760.330) (-760.076) (-761.909) * (-760.786) [-762.191] (-752.271) (-765.805) -- 0:01:25
12000 -- (-755.885) (-766.758) [-760.498] (-762.341) * (-758.851) (-765.749) (-753.110) [-757.235] -- 0:01:22
12500 -- (-756.854) (-762.450) [-757.138] (-755.986) * (-765.482) (-756.490) [-749.719] (-753.195) -- 0:01:19
13000 -- (-752.913) (-760.628) (-756.434) [-752.494] * [-756.802] (-756.715) (-751.623) (-755.996) -- 0:01:15
13500 -- [-750.325] (-759.018) (-758.239) (-756.107) * [-755.027] (-759.975) (-757.433) (-768.733) -- 0:01:13
14000 -- (-754.191) [-757.310] (-761.744) (-758.700) * [-754.122] (-763.505) (-748.748) (-762.747) -- 0:01:10
14500 -- (-753.408) (-764.368) [-761.413] (-757.537) * (-756.124) [-760.412] (-747.935) (-759.788) -- 0:01:07
15000 -- (-752.743) (-758.192) [-761.057] (-769.181) * (-763.374) (-763.004) (-748.637) [-758.429] -- 0:01:05
Average standard deviation of split frequencies: 0.070383
15500 -- [-754.972] (-761.545) (-759.254) (-772.055) * (-759.249) (-759.810) (-752.078) [-756.715] -- 0:01:03
16000 -- (-748.914) [-760.113] (-763.891) (-757.502) * (-757.004) (-763.873) (-749.542) [-758.012] -- 0:02:03
16500 -- (-748.637) (-758.190) [-765.075] (-755.805) * (-769.857) (-761.388) [-749.170] (-760.363) -- 0:01:59
17000 -- (-747.999) (-757.753) (-759.534) [-764.202] * (-761.102) (-755.362) [-748.669] (-770.564) -- 0:01:55
17500 -- (-750.648) (-762.244) (-756.629) [-759.773] * (-758.707) [-758.859] (-752.811) (-756.212) -- 0:01:52
18000 -- (-753.298) (-757.284) (-754.876) [-759.362] * (-757.111) (-759.728) (-751.622) [-760.139] -- 0:01:49
18500 -- (-754.535) [-764.155] (-761.902) (-761.687) * (-767.112) (-760.408) [-753.460] (-751.406) -- 0:01:46
19000 -- [-753.668] (-759.454) (-763.689) (-757.780) * [-763.906] (-762.050) (-756.815) (-748.770) -- 0:01:43
19500 -- (-749.757) (-764.845) (-761.095) [-757.179] * (-758.745) (-765.516) (-748.773) [-750.253] -- 0:01:40
20000 -- [-748.007] (-755.917) (-759.526) (-764.986) * (-759.205) (-758.337) (-751.025) [-748.242] -- 0:01:38
Average standard deviation of split frequencies: 0.059559
20500 -- (-750.478) (-757.921) [-762.680] (-762.070) * [-752.879] (-759.344) (-749.047) (-748.291) -- 0:01:35
21000 -- [-751.036] (-762.250) (-758.201) (-764.267) * (-763.046) [-755.868] (-750.398) (-750.955) -- 0:01:33
21500 -- (-748.574) (-756.481) [-759.941] (-762.196) * (-765.890) (-763.647) (-749.130) [-748.017] -- 0:01:31
22000 -- (-748.705) (-755.558) [-761.990] (-757.040) * (-763.933) (-759.043) [-749.434] (-750.148) -- 0:01:28
22500 -- (-753.691) (-766.300) [-763.676] (-764.869) * (-752.677) (-755.908) (-751.046) [-747.994] -- 0:01:26
23000 -- (-748.497) (-761.842) (-758.670) [-760.223] * [-747.955] (-771.100) (-752.643) (-750.850) -- 0:01:24
23500 -- (-753.374) [-757.497] (-764.307) (-760.341) * [-747.943] (-766.412) (-753.213) (-749.299) -- 0:01:23
24000 -- (-754.163) (-757.443) [-760.085] (-757.214) * [-750.839] (-757.498) (-750.411) (-750.909) -- 0:01:21
24500 -- (-751.347) (-753.333) [-756.867] (-758.219) * (-753.744) (-761.170) [-750.560] (-753.412) -- 0:01:19
25000 -- [-751.801] (-748.634) (-761.429) (-757.873) * (-750.729) (-761.246) (-750.107) [-750.001] -- 0:01:18
Average standard deviation of split frequencies: 0.037086
25500 -- [-750.598] (-750.827) (-761.915) (-761.925) * (-751.842) [-756.384] (-749.230) (-750.317) -- 0:01:16
26000 -- (-751.572) (-748.912) (-758.009) [-758.745] * [-753.070] (-757.099) (-755.053) (-750.958) -- 0:01:14
26500 -- [-752.516] (-747.965) (-763.917) (-773.439) * (-750.482) (-763.804) (-750.290) [-748.938] -- 0:01:13
27000 -- (-749.817) (-749.031) [-758.200] (-759.876) * [-752.651] (-762.049) (-749.877) (-748.368) -- 0:01:12
27500 -- [-749.593] (-749.817) (-777.709) (-758.439) * (-752.939) (-758.665) (-748.653) [-748.410] -- 0:01:10
28000 -- (-751.967) (-748.518) (-760.869) [-757.151] * (-752.982) [-759.484] (-749.255) (-748.565) -- 0:01:09
28500 -- (-752.403) (-749.007) (-756.088) [-754.684] * (-749.917) [-763.651] (-751.117) (-752.672) -- 0:01:08
29000 -- (-754.435) [-748.896] (-760.408) (-762.486) * (-750.048) (-755.302) (-752.145) [-751.091] -- 0:01:06
29500 -- (-749.566) (-748.604) (-757.839) [-755.829] * (-750.577) (-758.749) [-754.608] (-751.004) -- 0:01:05
30000 -- (-749.471) (-747.978) (-756.920) [-758.476] * (-752.515) (-748.675) [-752.052] (-749.001) -- 0:01:37
Average standard deviation of split frequencies: 0.032141
30500 -- [-748.972] (-753.756) (-759.183) (-769.839) * (-749.754) (-751.585) (-748.718) [-751.936] -- 0:01:35
31000 -- (-749.021) (-754.147) [-753.894] (-757.832) * (-749.260) (-748.896) (-748.818) [-751.275] -- 0:01:33
31500 -- [-749.224] (-754.714) (-765.651) (-755.878) * (-747.946) (-749.096) [-750.112] (-751.625) -- 0:01:32
32000 -- (-748.801) (-750.739) [-756.404] (-761.888) * (-750.839) (-749.543) [-749.620] (-749.640) -- 0:01:30
32500 -- (-748.272) (-749.556) (-760.471) [-756.737] * (-749.727) (-749.616) (-748.283) [-754.253] -- 0:01:29
33000 -- (-749.597) (-749.567) (-757.161) [-757.672] * [-748.345] (-752.446) (-749.285) (-752.796) -- 0:01:27
33500 -- (-752.653) [-748.715] (-759.247) (-756.571) * (-748.265) (-752.012) [-748.578] (-754.216) -- 0:01:26
34000 -- [-748.247] (-754.279) (-755.591) (-762.367) * (-749.691) (-751.231) [-749.899] (-752.916) -- 0:01:25
34500 -- (-748.276) (-754.635) [-760.039] (-758.413) * [-748.615] (-750.867) (-750.400) (-754.605) -- 0:01:23
35000 -- (-754.975) (-750.234) [-755.085] (-754.287) * (-750.309) [-751.315] (-750.120) (-750.975) -- 0:01:22
Average standard deviation of split frequencies: 0.028808
35500 -- (-754.861) (-752.955) [-756.679] (-756.848) * (-752.403) (-751.068) [-751.130] (-749.322) -- 0:01:21
36000 -- (-749.136) (-750.272) (-759.234) [-760.639] * (-750.256) (-750.143) (-752.337) [-752.926] -- 0:01:20
36500 -- (-750.949) (-751.409) (-755.503) [-758.584] * (-754.970) [-751.665] (-752.898) (-749.562) -- 0:01:19
37000 -- (-751.013) (-749.819) [-756.188] (-765.521) * (-750.062) [-752.939] (-751.678) (-755.028) -- 0:01:18
37500 -- (-749.155) [-748.695] (-758.270) (-758.967) * (-748.460) (-749.845) [-750.601] (-753.792) -- 0:01:17
38000 -- (-750.055) (-749.352) [-758.980] (-761.741) * (-754.809) (-750.480) (-750.006) [-753.391] -- 0:01:15
38500 -- (-755.279) [-748.424] (-770.307) (-761.035) * (-749.798) (-750.666) [-752.368] (-749.393) -- 0:01:14
39000 -- (-750.932) (-757.399) [-761.465] (-759.608) * [-753.651] (-750.950) (-750.242) (-749.515) -- 0:01:13
39500 -- (-750.062) [-749.845] (-759.700) (-755.873) * (-752.014) [-749.632] (-750.080) (-750.756) -- 0:01:12
40000 -- [-751.329] (-750.219) (-765.169) (-755.483) * (-750.792) (-750.630) [-753.446] (-749.894) -- 0:01:12
Average standard deviation of split frequencies: 0.032335
40500 -- (-752.205) (-749.556) [-761.880] (-755.025) * [-752.815] (-750.852) (-754.129) (-749.670) -- 0:01:11
41000 -- (-749.657) [-753.121] (-760.752) (-756.318) * (-757.133) (-750.931) (-750.488) [-748.825] -- 0:01:10
41500 -- (-750.278) [-755.195] (-756.538) (-758.416) * (-758.632) (-749.414) (-749.756) [-750.689] -- 0:01:09
42000 -- [-748.587] (-751.545) (-755.841) (-759.958) * (-752.371) [-752.294] (-749.149) (-750.820) -- 0:01:08
42500 -- (-749.465) [-750.824] (-760.227) (-762.974) * (-751.979) (-749.308) [-750.481] (-752.408) -- 0:01:07
43000 -- [-749.189] (-750.974) (-755.500) (-765.102) * (-749.723) (-750.423) (-754.990) [-748.928] -- 0:01:06
43500 -- [-749.531] (-752.497) (-762.459) (-755.083) * [-748.322] (-748.195) (-750.358) (-749.468) -- 0:01:05
44000 -- (-748.539) [-750.714] (-761.743) (-766.907) * (-751.850) (-749.639) [-750.390] (-751.014) -- 0:01:05
44500 -- (-750.541) (-749.877) [-759.657] (-758.798) * (-750.340) [-749.592] (-748.610) (-749.495) -- 0:01:04
45000 -- (-750.610) [-752.624] (-764.532) (-762.536) * (-750.012) [-752.062] (-752.800) (-749.788) -- 0:01:03
Average standard deviation of split frequencies: 0.031232
45500 -- (-749.931) (-748.415) (-765.689) [-751.892] * (-750.897) (-751.035) [-749.913] (-751.348) -- 0:01:23
46000 -- (-749.037) (-748.468) (-763.219) [-766.873] * (-749.372) (-751.002) [-748.747] (-750.613) -- 0:01:22
46500 -- (-748.046) (-751.742) [-755.028] (-766.091) * (-752.845) [-749.070] (-748.485) (-753.006) -- 0:01:22
47000 -- (-748.349) [-752.428] (-764.507) (-762.264) * (-748.616) (-748.890) [-749.418] (-749.790) -- 0:01:21
47500 -- (-749.251) (-749.105) (-762.663) [-759.237] * (-750.977) (-750.026) (-749.438) [-751.893] -- 0:01:20
48000 -- (-749.872) (-749.324) [-750.151] (-760.075) * [-748.949] (-750.176) (-749.781) (-753.269) -- 0:01:19
48500 -- (-750.815) (-748.023) (-750.954) [-762.142] * (-752.547) [-750.248] (-748.918) (-750.230) -- 0:01:18
49000 -- (-749.523) [-748.515] (-752.175) (-757.958) * (-756.011) (-749.474) [-749.814] (-751.216) -- 0:01:17
49500 -- (-750.733) (-749.052) (-750.512) [-756.969] * (-753.944) (-749.871) (-749.786) [-749.850] -- 0:01:16
50000 -- (-748.333) [-750.344] (-750.722) (-772.454) * (-751.198) (-749.875) [-749.252] (-750.327) -- 0:01:16
Average standard deviation of split frequencies: 0.026220
50500 -- (-749.109) (-750.080) [-751.766] (-760.883) * [-749.816] (-749.910) (-747.734) (-751.214) -- 0:01:15
51000 -- [-748.886] (-752.486) (-750.607) (-753.398) * (-749.353) [-749.679] (-749.423) (-756.032) -- 0:01:14
51500 -- (-748.138) (-749.255) [-753.138] (-749.763) * [-749.903] (-755.059) (-750.043) (-751.250) -- 0:01:13
52000 -- (-748.738) (-749.798) [-749.858] (-749.515) * (-754.068) [-749.419] (-752.366) (-752.408) -- 0:01:12
52500 -- [-750.411] (-749.579) (-749.570) (-749.721) * (-754.199) [-748.981] (-750.814) (-749.438) -- 0:01:12
53000 -- [-750.174] (-748.756) (-750.690) (-750.977) * (-752.287) [-749.536] (-750.724) (-749.738) -- 0:01:11
53500 -- (-748.981) (-754.090) [-748.580] (-750.797) * (-752.708) (-752.837) [-749.421] (-752.913) -- 0:01:10
54000 -- (-748.461) (-750.158) [-750.245] (-751.296) * (-753.510) (-751.656) [-749.263] (-750.232) -- 0:01:10
54500 -- (-748.740) (-749.950) (-752.796) [-750.359] * (-750.750) (-751.508) [-749.871] (-749.932) -- 0:01:09
55000 -- [-749.413] (-749.312) (-758.445) (-750.927) * [-752.283] (-750.435) (-751.407) (-751.241) -- 0:01:08
Average standard deviation of split frequencies: 0.027550
55500 -- (-754.688) (-748.943) (-755.723) [-751.953] * (-751.852) (-750.329) (-750.441) [-749.190] -- 0:01:08
56000 -- (-749.426) (-748.986) (-753.629) [-749.988] * (-751.602) [-752.615] (-749.528) (-749.133) -- 0:01:07
56500 -- (-751.947) (-749.780) [-751.009] (-752.350) * (-750.582) (-752.311) [-750.192] (-749.801) -- 0:01:06
57000 -- (-749.310) (-750.820) (-758.990) [-749.791] * (-751.031) (-750.098) (-750.763) [-749.431] -- 0:01:06
57500 -- (-750.516) (-750.036) (-749.050) [-749.638] * (-751.549) [-755.033] (-749.092) (-752.058) -- 0:01:05
58000 -- (-748.502) (-749.003) [-750.156] (-750.147) * [-751.050] (-750.509) (-749.518) (-749.867) -- 0:01:04
58500 -- [-750.650] (-751.752) (-754.142) (-753.492) * (-754.204) [-750.958] (-750.141) (-749.863) -- 0:01:04
59000 -- (-750.383) [-753.211] (-750.478) (-751.462) * (-749.594) (-749.612) [-751.488] (-750.046) -- 0:01:03
59500 -- [-748.800] (-753.144) (-750.194) (-750.153) * (-752.104) (-750.106) (-750.294) [-748.326] -- 0:01:03
60000 -- [-749.338] (-749.426) (-756.352) (-749.341) * (-752.572) (-748.763) (-751.765) [-750.882] -- 0:01:02
Average standard deviation of split frequencies: 0.024791
60500 -- (-750.346) (-749.334) [-750.487] (-751.053) * (-750.794) (-755.982) [-750.524] (-754.663) -- 0:01:02
61000 -- (-752.005) (-751.553) (-754.033) [-751.738] * (-749.332) [-749.472] (-750.999) (-749.066) -- 0:01:01
61500 -- (-748.812) [-749.378] (-761.592) (-748.972) * (-749.507) [-750.382] (-749.264) (-749.129) -- 0:01:01
62000 -- [-750.085] (-748.582) (-752.187) (-752.380) * [-749.590] (-749.356) (-753.374) (-751.899) -- 0:01:15
62500 -- (-748.490) [-748.611] (-749.159) (-754.391) * (-751.494) (-748.518) [-749.195] (-752.649) -- 0:01:15
63000 -- [-748.862] (-751.029) (-750.385) (-750.291) * [-749.162] (-749.269) (-749.548) (-749.871) -- 0:01:14
63500 -- [-748.540] (-750.604) (-749.389) (-750.941) * [-750.797] (-752.166) (-752.261) (-750.274) -- 0:01:13
64000 -- (-748.694) [-750.474] (-753.777) (-751.814) * (-753.743) [-751.400] (-750.896) (-750.612) -- 0:01:13
64500 -- (-749.011) [-748.958] (-753.627) (-751.325) * [-751.978] (-751.652) (-750.693) (-751.122) -- 0:01:12
65000 -- (-749.041) [-750.206] (-752.959) (-749.126) * [-754.211] (-749.964) (-749.700) (-750.299) -- 0:01:11
Average standard deviation of split frequencies: 0.023808
65500 -- (-749.527) (-749.504) [-751.096] (-748.839) * (-751.229) [-750.419] (-751.777) (-751.931) -- 0:01:11
66000 -- (-749.159) (-750.510) [-750.042] (-749.801) * (-752.220) [-752.101] (-752.086) (-751.265) -- 0:01:10
66500 -- (-749.150) (-750.485) [-750.057] (-756.026) * [-750.153] (-751.072) (-751.845) (-754.655) -- 0:01:10
67000 -- (-751.443) (-748.561) [-751.524] (-752.183) * (-748.016) (-749.237) [-749.578] (-753.353) -- 0:01:09
67500 -- [-752.153] (-748.620) (-750.745) (-751.848) * [-749.162] (-749.133) (-749.854) (-752.466) -- 0:01:09
68000 -- (-751.373) (-748.212) [-750.542] (-749.562) * (-748.156) [-753.370] (-748.752) (-753.621) -- 0:01:08
68500 -- (-752.014) (-752.508) (-747.861) [-751.567] * (-752.343) (-750.637) [-748.064] (-749.948) -- 0:01:07
69000 -- (-749.660) (-750.075) [-748.406] (-751.053) * (-751.616) [-749.390] (-750.386) (-751.170) -- 0:01:07
69500 -- (-750.601) [-751.391] (-749.013) (-752.874) * [-750.943] (-749.527) (-750.456) (-749.015) -- 0:01:06
70000 -- (-748.568) (-748.934) (-748.621) [-749.318] * (-748.351) (-749.196) (-749.417) [-751.344] -- 0:01:06
Average standard deviation of split frequencies: 0.023348
70500 -- (-748.517) [-749.161] (-752.498) (-751.557) * (-750.642) (-748.536) [-748.490] (-750.065) -- 0:01:05
71000 -- [-748.995] (-749.408) (-751.721) (-750.782) * (-749.768) (-750.015) [-750.704] (-749.095) -- 0:01:05
71500 -- (-749.892) [-750.224] (-751.230) (-751.902) * (-750.989) (-749.158) [-749.330] (-749.426) -- 0:01:04
72000 -- [-747.989] (-749.645) (-750.421) (-751.611) * [-752.532] (-748.132) (-750.149) (-756.106) -- 0:01:04
72500 -- (-752.621) (-749.997) (-750.492) [-750.224] * (-751.750) (-748.566) (-752.009) [-751.678] -- 0:01:03
73000 -- [-748.680] (-748.208) (-750.773) (-749.718) * (-751.431) (-749.159) (-751.337) [-749.242] -- 0:01:03
73500 -- [-752.018] (-750.931) (-748.478) (-749.142) * (-749.622) (-749.996) (-753.511) [-751.247] -- 0:01:03
74000 -- [-750.501] (-751.300) (-750.064) (-749.863) * (-750.022) (-750.628) [-751.923] (-752.205) -- 0:01:02
74500 -- [-749.144] (-752.229) (-751.223) (-749.986) * (-749.303) (-749.606) [-747.928] (-749.170) -- 0:01:02
75000 -- [-748.860] (-749.245) (-749.347) (-755.933) * (-753.466) (-749.792) (-748.601) [-754.179] -- 0:01:01
Average standard deviation of split frequencies: 0.022950
75500 -- (-750.047) (-748.440) (-749.925) [-749.949] * (-751.025) (-751.039) (-749.345) [-748.942] -- 0:01:01
76000 -- (-749.215) (-753.500) [-749.386] (-748.450) * (-751.041) [-749.525] (-750.383) (-750.701) -- 0:01:00
76500 -- (-749.784) [-748.561] (-749.200) (-748.449) * (-751.035) [-749.936] (-751.350) (-748.553) -- 0:01:00
77000 -- (-748.155) [-748.183] (-750.740) (-748.727) * (-748.984) (-750.660) (-752.183) [-750.208] -- 0:00:59
77500 -- (-748.698) (-749.121) (-757.444) [-749.346] * (-748.745) (-754.632) (-749.761) [-750.832] -- 0:00:59
78000 -- (-749.033) (-748.655) (-752.656) [-749.894] * (-752.251) (-748.502) (-749.404) [-750.121] -- 0:00:59
78500 -- [-750.458] (-753.179) (-754.132) (-748.010) * (-751.963) (-748.400) (-748.245) [-750.433] -- 0:00:58
79000 -- (-751.133) [-749.826] (-753.930) (-747.902) * (-749.699) [-748.797] (-748.334) (-748.586) -- 0:01:09
79500 -- (-749.544) (-750.728) (-751.791) [-749.211] * (-749.095) (-748.921) [-748.280] (-748.392) -- 0:01:09
80000 -- (-749.122) (-750.328) [-750.149] (-750.139) * (-748.231) (-750.042) [-748.730] (-750.554) -- 0:01:09
Average standard deviation of split frequencies: 0.020300
80500 -- (-753.789) (-749.715) [-750.992] (-751.471) * (-749.697) (-748.350) [-748.095] (-750.191) -- 0:01:08
81000 -- [-748.362] (-751.093) (-749.610) (-751.025) * (-749.563) (-753.082) [-751.075] (-748.987) -- 0:01:08
81500 -- (-750.086) (-752.227) (-749.428) [-750.199] * (-750.112) [-753.525] (-752.531) (-750.063) -- 0:01:07
82000 -- (-751.655) [-751.515] (-751.585) (-749.641) * (-752.694) [-749.969] (-749.869) (-750.840) -- 0:01:07
82500 -- (-752.392) (-752.542) (-751.301) [-750.735] * (-751.866) [-748.994] (-750.779) (-750.263) -- 0:01:06
83000 -- (-751.398) (-753.921) (-750.922) [-751.122] * [-749.709] (-749.798) (-752.762) (-749.136) -- 0:01:06
83500 -- (-753.036) [-755.768] (-752.036) (-750.828) * (-748.950) (-749.168) (-749.657) [-749.371] -- 0:01:05
84000 -- [-750.943] (-751.857) (-748.924) (-750.601) * [-752.458] (-749.881) (-753.671) (-753.525) -- 0:01:05
84500 -- [-749.777] (-751.601) (-750.036) (-749.013) * (-752.679) [-749.330] (-750.743) (-753.857) -- 0:01:05
85000 -- (-750.039) (-749.462) [-748.921] (-751.340) * (-748.774) (-748.446) (-749.458) [-750.969] -- 0:01:04
Average standard deviation of split frequencies: 0.019041
85500 -- (-749.824) (-750.263) [-748.880] (-750.837) * (-752.383) (-749.612) (-748.577) [-750.216] -- 0:01:04
86000 -- (-749.768) (-750.591) (-750.076) [-751.017] * (-751.360) (-749.854) (-748.630) [-751.711] -- 0:01:03
86500 -- (-753.641) [-749.194] (-756.124) (-754.182) * (-749.310) (-752.767) (-753.029) [-749.027] -- 0:01:03
87000 -- (-749.911) (-753.393) (-752.139) [-748.562] * (-750.129) (-751.370) (-751.877) [-750.108] -- 0:01:02
87500 -- (-751.791) (-750.840) (-752.228) [-749.022] * [-749.436] (-750.000) (-750.803) (-750.586) -- 0:01:02
88000 -- (-751.012) (-751.345) (-750.470) [-749.305] * (-752.499) [-749.967] (-750.200) (-748.655) -- 0:01:02
88500 -- (-753.283) (-750.560) (-751.752) [-750.250] * (-749.107) [-749.868] (-750.672) (-751.125) -- 0:01:01
89000 -- (-749.507) [-748.794] (-751.133) (-752.139) * (-748.506) [-753.018] (-751.796) (-748.242) -- 0:01:01
89500 -- (-750.811) (-749.918) (-752.426) [-750.363] * (-750.020) (-749.392) [-750.351] (-751.582) -- 0:01:01
90000 -- (-751.057) (-751.175) (-751.023) [-748.174] * [-754.410] (-752.079) (-748.033) (-750.388) -- 0:01:00
Average standard deviation of split frequencies: 0.017678
90500 -- (-750.115) (-750.851) [-749.478] (-748.221) * [-749.522] (-750.857) (-750.196) (-749.780) -- 0:01:00
91000 -- (-749.982) (-751.538) [-751.501] (-748.501) * [-752.241] (-751.015) (-750.338) (-749.994) -- 0:00:59
91500 -- [-749.959] (-751.438) (-754.718) (-753.215) * [-750.476] (-754.023) (-748.380) (-748.875) -- 0:00:59
92000 -- (-751.732) [-750.216] (-754.102) (-750.525) * (-748.923) (-752.664) [-750.739] (-750.093) -- 0:00:59
92500 -- (-750.854) (-747.780) (-751.438) [-750.811] * [-749.218] (-752.167) (-752.063) (-749.025) -- 0:00:58
93000 -- (-749.433) [-748.036] (-752.735) (-749.210) * (-750.057) [-749.393] (-749.097) (-752.389) -- 0:00:58
93500 -- (-751.658) [-750.344] (-751.242) (-748.412) * [-750.102] (-749.650) (-750.013) (-750.278) -- 0:00:58
94000 -- [-750.095] (-750.314) (-751.550) (-749.120) * [-748.332] (-753.023) (-750.470) (-751.903) -- 0:00:57
94500 -- (-748.275) (-749.620) (-749.197) [-750.093] * [-749.815] (-753.845) (-752.662) (-749.357) -- 0:00:57
95000 -- (-750.096) (-752.059) [-752.067] (-749.469) * (-749.179) (-750.845) [-749.711] (-748.803) -- 0:00:57
Average standard deviation of split frequencies: 0.018905
95500 -- (-752.087) [-750.009] (-753.501) (-748.280) * [-748.710] (-750.086) (-750.477) (-752.747) -- 0:01:06
96000 -- [-752.434] (-753.215) (-752.802) (-751.759) * (-753.129) (-750.393) (-752.708) [-749.572] -- 0:01:05
96500 -- [-753.441] (-750.449) (-750.825) (-749.350) * (-750.733) [-748.537] (-755.143) (-751.529) -- 0:01:05
97000 -- (-753.068) [-750.697] (-752.563) (-752.307) * [-750.231] (-748.913) (-755.822) (-750.226) -- 0:01:05
97500 -- [-750.603] (-750.536) (-751.988) (-750.175) * (-750.477) (-749.474) (-751.865) [-748.917] -- 0:01:04
98000 -- [-752.597] (-748.918) (-750.083) (-748.873) * (-754.510) (-750.016) (-750.215) [-749.344] -- 0:01:04
98500 -- [-749.538] (-750.269) (-749.442) (-749.822) * (-756.818) [-748.981] (-748.142) (-749.742) -- 0:01:04
99000 -- (-750.517) (-748.915) (-749.780) [-751.464] * (-751.566) [-749.762] (-748.255) (-756.319) -- 0:01:03
99500 -- (-751.747) [-748.706] (-750.254) (-749.983) * (-750.774) [-750.058] (-749.728) (-751.895) -- 0:01:03
100000 -- (-748.535) (-750.263) [-751.125] (-749.542) * (-750.755) (-749.613) (-749.280) [-750.981] -- 0:01:02
Average standard deviation of split frequencies: 0.017795
100500 -- [-748.744] (-751.299) (-750.926) (-750.231) * (-749.915) (-753.650) [-748.863] (-751.409) -- 0:01:02
101000 -- [-748.145] (-750.306) (-750.344) (-750.805) * (-749.605) (-750.394) (-748.523) [-749.976] -- 0:01:02
101500 -- [-748.968] (-751.357) (-749.466) (-752.190) * (-748.415) (-748.444) [-748.911] (-749.497) -- 0:01:01
102000 -- (-749.450) (-748.670) [-748.492] (-753.355) * (-750.444) (-748.730) [-749.996] (-750.793) -- 0:01:01
102500 -- (-749.230) (-749.135) [-748.795] (-748.941) * (-750.466) (-749.232) [-750.681] (-748.244) -- 0:01:01
103000 -- [-747.817] (-749.507) (-751.622) (-748.618) * [-750.019] (-749.127) (-757.979) (-750.792) -- 0:01:00
103500 -- (-749.342) (-753.465) (-754.655) [-749.210] * (-750.276) (-750.217) (-751.492) [-749.787] -- 0:01:00
104000 -- [-748.243] (-756.037) (-751.041) (-750.300) * [-750.046] (-750.488) (-757.171) (-750.047) -- 0:01:00
104500 -- (-749.595) (-750.688) (-749.020) [-749.036] * (-752.022) [-748.984] (-749.119) (-751.237) -- 0:00:59
105000 -- [-750.231] (-752.973) (-755.032) (-750.466) * (-751.590) [-749.003] (-749.963) (-752.078) -- 0:00:59
Average standard deviation of split frequencies: 0.016455
105500 -- (-750.209) (-752.132) (-748.278) [-750.580] * (-753.808) (-748.932) (-748.824) [-751.370] -- 0:00:59
106000 -- (-748.744) (-755.553) [-748.305] (-753.577) * (-750.839) (-748.352) (-754.695) [-750.271] -- 0:00:59
106500 -- (-753.894) (-752.552) [-750.096] (-751.291) * (-749.563) [-748.927] (-751.699) (-754.886) -- 0:00:58
107000 -- [-755.109] (-757.049) (-749.323) (-751.507) * (-748.331) (-751.344) (-752.223) [-753.387] -- 0:00:58
107500 -- (-751.527) (-757.256) [-749.320] (-753.339) * (-748.477) (-752.148) [-751.052] (-750.240) -- 0:00:58
108000 -- (-748.380) (-750.466) [-749.350] (-751.735) * [-750.041] (-753.498) (-749.672) (-752.371) -- 0:00:57
108500 -- (-752.552) (-748.771) [-748.261] (-749.896) * (-748.201) (-748.927) (-752.158) [-750.292] -- 0:00:57
109000 -- (-751.973) (-753.094) [-749.961] (-752.156) * (-748.371) [-751.967] (-751.916) (-749.700) -- 0:00:57
109500 -- [-749.430] (-754.144) (-751.783) (-753.574) * [-748.871] (-748.994) (-750.240) (-749.196) -- 0:00:56
110000 -- (-749.435) (-753.850) [-749.515] (-748.651) * (-749.256) (-749.802) [-748.755] (-748.687) -- 0:00:56
Average standard deviation of split frequencies: 0.018530
110500 -- (-753.084) (-750.202) (-749.926) [-750.553] * (-749.049) (-750.045) (-752.625) [-750.130] -- 0:00:56
111000 -- [-750.458] (-751.336) (-754.768) (-750.154) * (-749.639) (-752.832) [-750.381] (-748.928) -- 0:00:56
111500 -- [-750.792] (-751.068) (-751.906) (-753.367) * (-748.345) (-749.634) (-751.389) [-749.812] -- 0:00:55
112000 -- (-752.453) (-754.002) [-749.700] (-752.695) * (-753.056) (-755.030) [-751.671] (-749.674) -- 0:01:03
112500 -- [-748.996] (-753.759) (-749.898) (-751.916) * (-750.872) [-749.485] (-752.224) (-750.329) -- 0:01:03
113000 -- (-750.098) (-750.598) [-749.865] (-756.916) * (-751.494) (-748.241) [-750.113] (-754.195) -- 0:01:02
113500 -- (-749.356) [-749.994] (-748.440) (-752.026) * [-749.455] (-752.942) (-750.722) (-750.903) -- 0:01:02
114000 -- [-748.649] (-751.877) (-748.978) (-751.111) * (-750.905) (-751.296) [-755.951] (-750.658) -- 0:01:02
114500 -- [-748.836] (-751.271) (-753.168) (-749.761) * (-749.973) (-751.753) [-752.720] (-753.255) -- 0:01:01
115000 -- [-750.323] (-749.577) (-751.037) (-750.922) * (-749.952) (-750.352) (-752.929) [-748.524] -- 0:01:01
Average standard deviation of split frequencies: 0.018287
115500 -- (-748.994) (-749.295) (-753.585) [-750.140] * (-751.091) (-751.316) (-750.516) [-749.391] -- 0:01:01
116000 -- (-750.497) (-748.844) (-748.416) [-748.351] * (-753.855) [-753.366] (-750.279) (-749.724) -- 0:01:00
116500 -- [-753.727] (-749.860) (-748.214) (-751.738) * (-749.960) (-753.694) [-749.586] (-750.616) -- 0:01:00
117000 -- (-754.228) (-752.085) [-748.562] (-753.082) * [-749.799] (-753.259) (-748.168) (-749.717) -- 0:01:00
117500 -- (-750.612) (-749.040) (-749.224) [-751.073] * (-753.121) (-750.688) [-749.262] (-749.652) -- 0:01:00
118000 -- (-750.398) (-750.493) [-748.077] (-747.999) * (-753.140) (-749.997) [-751.599] (-749.703) -- 0:00:59
118500 -- (-750.464) (-751.616) [-750.322] (-750.847) * [-753.181] (-752.188) (-750.592) (-749.613) -- 0:00:59
119000 -- (-749.037) [-749.640] (-750.823) (-751.711) * (-750.256) (-753.388) (-749.366) [-748.486] -- 0:00:59
119500 -- (-748.560) (-751.834) (-748.838) [-749.603] * (-752.994) [-749.891] (-751.410) (-749.729) -- 0:00:58
120000 -- (-749.140) [-749.773] (-748.781) (-751.310) * (-750.986) (-750.924) (-749.773) [-750.690] -- 0:00:58
Average standard deviation of split frequencies: 0.017775
120500 -- (-752.780) (-749.317) (-749.963) [-755.089] * (-750.998) (-750.873) [-748.829] (-754.419) -- 0:00:58
121000 -- (-754.540) (-749.901) (-749.794) [-751.494] * (-753.070) (-752.521) (-751.119) [-749.259] -- 0:00:58
121500 -- (-751.884) (-749.126) [-750.470] (-751.442) * (-749.901) (-748.627) (-751.466) [-749.465] -- 0:00:57
122000 -- (-752.629) (-750.601) (-749.037) [-752.868] * (-748.157) (-750.392) [-749.249] (-749.434) -- 0:00:57
122500 -- (-749.818) (-750.338) (-748.822) [-750.079] * (-749.798) [-749.658] (-750.294) (-749.224) -- 0:00:57
123000 -- [-750.844] (-750.447) (-750.313) (-752.583) * (-751.944) (-749.951) (-750.121) [-751.392] -- 0:00:57
123500 -- [-749.749] (-751.138) (-749.466) (-750.377) * (-748.511) [-750.122] (-748.847) (-751.349) -- 0:00:56
124000 -- (-749.684) (-751.075) (-752.087) [-748.577] * (-748.735) (-748.726) [-748.730] (-751.154) -- 0:00:56
124500 -- [-750.064] (-750.562) (-756.550) (-749.340) * [-750.097] (-748.586) (-749.658) (-753.292) -- 0:00:56
125000 -- (-749.336) [-750.378] (-750.013) (-751.242) * [-751.360] (-751.637) (-749.501) (-750.865) -- 0:00:56
Average standard deviation of split frequencies: 0.017584
125500 -- [-748.882] (-752.771) (-750.585) (-749.223) * [-749.294] (-749.638) (-751.369) (-749.809) -- 0:00:55
126000 -- [-749.695] (-750.207) (-749.600) (-748.746) * (-753.295) (-751.464) (-751.069) [-748.760] -- 0:00:55
126500 -- (-750.730) (-750.582) [-750.336] (-750.825) * (-750.836) (-752.324) (-749.413) [-748.359] -- 0:00:55
127000 -- [-749.141] (-750.292) (-749.204) (-752.574) * [-751.440] (-750.117) (-747.926) (-753.692) -- 0:00:54
127500 -- (-749.072) [-750.183] (-748.739) (-751.415) * (-749.296) (-750.842) [-747.892] (-749.097) -- 0:00:54
128000 -- [-750.261] (-752.046) (-749.215) (-753.437) * (-748.387) [-755.536] (-755.565) (-751.857) -- 0:00:54
128500 -- [-749.565] (-759.897) (-749.201) (-750.349) * (-749.222) [-749.757] (-751.239) (-749.202) -- 0:01:01
129000 -- (-748.854) (-748.310) (-749.805) [-751.062] * (-748.489) [-749.438] (-750.619) (-749.801) -- 0:01:00
129500 -- (-748.911) [-748.170] (-753.091) (-749.250) * (-749.318) [-749.771] (-751.333) (-750.841) -- 0:01:00
130000 -- (-750.573) (-748.280) [-749.887] (-750.873) * [-750.667] (-748.797) (-750.418) (-748.923) -- 0:01:00
Average standard deviation of split frequencies: 0.017437
130500 -- (-752.326) (-752.034) (-750.886) [-749.363] * [-750.764] (-747.756) (-750.674) (-750.391) -- 0:00:59
131000 -- [-748.923] (-751.020) (-749.587) (-749.638) * (-749.771) (-750.186) [-748.273] (-749.016) -- 0:00:59
131500 -- (-749.705) (-750.330) (-751.255) [-750.934] * (-749.451) (-749.805) [-748.279] (-749.896) -- 0:00:59
132000 -- (-755.000) (-750.656) [-749.947] (-748.977) * [-752.614] (-749.488) (-750.013) (-752.926) -- 0:00:59
132500 -- (-752.690) [-754.021] (-753.772) (-748.391) * [-750.992] (-749.830) (-751.571) (-750.554) -- 0:00:58
133000 -- (-756.901) [-749.879] (-750.787) (-752.000) * (-749.021) (-750.526) [-749.395] (-750.294) -- 0:00:58
133500 -- [-749.524] (-751.029) (-751.075) (-751.237) * (-751.077) (-751.099) (-750.305) [-749.417] -- 0:00:58
134000 -- (-750.884) [-750.424] (-749.593) (-749.199) * (-749.533) (-750.847) (-749.959) [-750.361] -- 0:00:58
134500 -- (-750.511) (-752.235) [-751.226] (-748.130) * (-749.912) [-752.035] (-749.877) (-752.769) -- 0:00:57
135000 -- (-749.705) [-751.109] (-750.753) (-750.917) * (-750.600) [-753.652] (-752.871) (-749.373) -- 0:00:57
Average standard deviation of split frequencies: 0.016946
135500 -- [-751.606] (-750.679) (-751.450) (-751.211) * (-750.081) [-749.558] (-754.272) (-748.750) -- 0:00:57
136000 -- [-750.910] (-750.271) (-751.826) (-750.802) * (-749.922) (-751.438) (-750.244) [-749.513] -- 0:00:57
136500 -- (-754.088) (-753.035) (-749.542) [-749.748] * (-748.454) (-749.848) [-752.750] (-750.927) -- 0:00:56
137000 -- (-751.579) [-749.882] (-749.210) (-749.680) * (-748.706) (-748.725) (-754.982) [-751.671] -- 0:00:56
137500 -- [-749.727] (-751.391) (-749.189) (-750.625) * (-748.966) (-749.345) [-753.811] (-757.862) -- 0:00:56
138000 -- (-750.082) (-751.942) (-749.295) [-749.129] * (-748.555) (-750.045) (-755.765) [-750.645] -- 0:00:56
138500 -- (-750.808) (-751.661) (-750.501) [-752.048] * (-750.168) (-749.776) (-750.253) [-751.049] -- 0:00:55
139000 -- (-751.514) (-751.669) [-750.314] (-750.451) * (-751.502) (-749.203) [-748.569] (-752.671) -- 0:00:55
139500 -- (-752.096) (-752.332) (-752.824) [-752.932] * (-758.055) (-750.426) (-749.216) [-753.117] -- 0:00:55
140000 -- (-753.665) (-748.741) [-750.287] (-749.244) * (-750.726) [-749.257] (-755.613) (-748.549) -- 0:00:55
Average standard deviation of split frequencies: 0.016011
140500 -- (-753.508) (-749.951) (-749.978) [-750.601] * (-750.269) (-749.752) (-757.898) [-750.090] -- 0:00:55
141000 -- (-750.776) [-749.108] (-751.609) (-749.865) * (-749.413) (-750.746) (-756.457) [-750.606] -- 0:00:54
141500 -- (-751.544) (-749.492) (-749.717) [-750.290] * (-752.613) (-748.023) [-749.938] (-751.652) -- 0:00:54
142000 -- (-750.075) (-750.505) [-749.711] (-750.863) * (-753.029) [-748.821] (-749.882) (-750.395) -- 0:00:54
142500 -- (-753.572) [-751.044] (-752.642) (-751.676) * (-750.158) [-755.114] (-749.580) (-750.010) -- 0:00:54
143000 -- (-750.749) [-748.708] (-749.559) (-749.930) * [-751.058] (-749.798) (-749.889) (-751.466) -- 0:00:53
143500 -- (-752.913) [-750.881] (-749.501) (-750.131) * (-752.793) (-752.053) [-749.321] (-748.978) -- 0:00:53
144000 -- (-749.318) (-751.496) (-752.952) [-751.576] * (-750.850) (-750.710) (-752.770) [-752.095] -- 0:00:53
144500 -- (-749.489) (-752.878) [-752.299] (-750.171) * (-750.912) (-751.779) [-751.017] (-749.365) -- 0:00:53
145000 -- (-751.871) (-753.584) (-752.783) [-750.481] * (-751.465) [-750.908] (-750.060) (-750.107) -- 0:00:58
Average standard deviation of split frequencies: 0.016951
145500 -- (-749.917) (-752.083) [-752.893] (-749.934) * [-750.005] (-749.185) (-751.836) (-749.154) -- 0:00:58
146000 -- (-749.746) (-751.686) (-749.260) [-749.345] * (-754.031) (-749.311) [-752.480] (-749.567) -- 0:00:58
146500 -- (-750.910) [-754.742] (-750.426) (-750.148) * (-753.009) [-748.002] (-748.804) (-749.646) -- 0:00:58
147000 -- (-750.030) [-753.856] (-749.886) (-748.737) * [-752.166] (-754.531) (-756.627) (-749.489) -- 0:00:58
147500 -- (-749.696) (-751.908) [-748.995] (-756.278) * (-750.161) [-754.444] (-748.687) (-752.779) -- 0:00:57
148000 -- (-749.657) (-748.901) [-749.106] (-749.547) * (-749.603) [-750.535] (-750.200) (-752.641) -- 0:00:57
148500 -- (-751.824) [-749.811] (-751.977) (-756.065) * (-749.428) [-750.396] (-750.084) (-752.655) -- 0:00:57
149000 -- (-750.036) [-749.358] (-750.298) (-752.313) * (-749.686) [-754.561] (-748.768) (-755.247) -- 0:00:57
149500 -- (-753.581) [-749.258] (-750.442) (-750.796) * (-751.460) (-748.549) (-750.739) [-751.723] -- 0:00:56
150000 -- (-749.640) (-748.281) (-751.404) [-749.661] * [-748.643] (-749.187) (-750.936) (-751.326) -- 0:00:56
Average standard deviation of split frequencies: 0.016961
150500 -- (-750.454) (-749.385) (-748.886) [-749.912] * (-748.468) (-752.650) (-755.590) [-749.158] -- 0:00:56
151000 -- [-750.668] (-749.705) (-749.850) (-750.684) * [-748.109] (-752.658) (-754.791) (-751.493) -- 0:00:56
151500 -- (-749.898) (-749.714) [-751.236] (-750.467) * [-748.947] (-751.196) (-751.089) (-749.477) -- 0:00:56
152000 -- (-749.194) (-751.013) [-750.300] (-748.840) * (-748.981) (-752.543) (-751.720) [-750.545] -- 0:00:55
152500 -- (-751.132) (-752.131) (-750.412) [-749.212] * (-749.023) (-749.137) (-750.846) [-749.745] -- 0:00:55
153000 -- (-751.516) (-751.985) (-750.835) [-749.589] * (-750.629) (-750.561) (-749.027) [-749.210] -- 0:00:55
153500 -- (-753.244) (-750.678) (-749.025) [-750.172] * [-748.314] (-749.331) (-750.762) (-750.158) -- 0:00:55
154000 -- (-750.759) (-749.269) (-755.094) [-750.632] * [-748.036] (-749.235) (-748.696) (-750.981) -- 0:00:54
154500 -- (-751.657) [-748.318] (-752.909) (-750.299) * [-748.243] (-753.295) (-750.178) (-752.457) -- 0:00:54
155000 -- [-751.106] (-748.739) (-754.984) (-749.107) * [-749.553] (-751.931) (-749.200) (-751.683) -- 0:00:54
Average standard deviation of split frequencies: 0.016620
155500 -- (-748.201) [-748.923] (-747.922) (-748.168) * (-749.021) [-752.838] (-752.201) (-749.200) -- 0:00:54
156000 -- (-750.108) (-750.096) [-749.033] (-748.032) * (-751.264) (-751.480) [-749.904] (-747.980) -- 0:00:54
156500 -- [-749.648] (-752.921) (-749.769) (-748.146) * (-750.543) (-751.939) [-751.551] (-747.867) -- 0:00:53
157000 -- [-750.119] (-748.613) (-748.701) (-749.633) * (-748.518) (-751.751) [-751.261] (-748.277) -- 0:00:53
157500 -- (-753.130) [-748.968] (-750.448) (-754.943) * (-749.726) (-752.153) [-749.446] (-752.844) -- 0:00:53
158000 -- (-756.649) (-748.721) [-749.120] (-748.686) * [-754.577] (-751.475) (-751.532) (-749.168) -- 0:00:53
158500 -- (-749.858) [-750.667] (-751.765) (-748.830) * (-754.014) [-750.380] (-751.312) (-752.337) -- 0:00:53
159000 -- (-750.611) [-753.208] (-749.661) (-748.997) * (-750.831) (-748.884) (-753.862) [-749.675] -- 0:00:52
159500 -- (-750.493) (-750.068) (-751.107) [-748.914] * (-749.537) (-748.986) (-751.613) [-748.818] -- 0:00:52
160000 -- (-748.783) (-748.956) [-750.091] (-749.037) * (-751.251) [-750.500] (-752.001) (-749.301) -- 0:00:52
Average standard deviation of split frequencies: 0.015257
160500 -- (-751.093) [-749.821] (-752.864) (-753.364) * (-753.103) (-753.176) (-750.803) [-748.553] -- 0:00:52
161000 -- [-752.238] (-750.210) (-751.088) (-751.733) * (-753.477) [-751.620] (-748.068) (-749.097) -- 0:00:52
161500 -- (-755.490) [-748.790] (-752.721) (-750.540) * (-749.954) [-748.606] (-748.033) (-748.317) -- 0:00:51
162000 -- (-749.347) (-748.483) [-753.402] (-748.615) * (-748.377) [-749.758] (-747.734) (-748.837) -- 0:00:56
162500 -- (-751.250) [-754.045] (-750.204) (-748.900) * (-749.330) (-751.993) (-749.252) [-748.350] -- 0:00:56
163000 -- (-750.124) [-755.444] (-752.274) (-750.955) * (-750.826) (-749.141) [-750.510] (-748.036) -- 0:00:56
163500 -- (-748.229) [-751.978] (-754.523) (-749.448) * (-753.222) (-749.396) (-750.530) [-750.882] -- 0:00:56
164000 -- (-748.455) [-751.322] (-749.580) (-749.429) * [-751.125] (-753.839) (-749.562) (-755.234) -- 0:00:56
164500 -- (-749.010) (-748.961) (-749.524) [-752.523] * (-749.056) [-750.153] (-749.819) (-753.780) -- 0:00:55
165000 -- (-751.438) [-749.057] (-751.837) (-749.985) * (-750.055) [-750.719] (-750.637) (-751.687) -- 0:00:55
Average standard deviation of split frequencies: 0.014348
165500 -- [-754.227] (-749.088) (-752.362) (-749.174) * [-749.506] (-751.618) (-748.718) (-750.856) -- 0:00:55
166000 -- [-751.160] (-749.292) (-750.561) (-748.356) * [-748.443] (-752.205) (-748.985) (-751.373) -- 0:00:55
166500 -- (-751.630) (-749.999) (-750.171) [-748.839] * (-750.500) (-748.899) (-751.209) [-750.352] -- 0:00:55
167000 -- (-753.253) (-749.422) [-749.847] (-751.160) * (-752.346) (-750.392) (-750.211) [-750.014] -- 0:00:54
167500 -- (-752.790) [-750.586] (-752.443) (-751.079) * (-752.962) (-755.384) (-752.469) [-748.603] -- 0:00:54
168000 -- (-751.244) (-751.011) [-751.405] (-751.561) * (-749.315) (-751.839) (-752.858) [-751.808] -- 0:00:54
168500 -- (-753.948) (-752.175) (-753.977) [-749.489] * (-751.811) (-748.634) (-751.236) [-753.476] -- 0:00:54
169000 -- (-751.017) (-749.329) (-749.050) [-750.943] * (-752.328) (-749.791) [-751.272] (-750.692) -- 0:00:54
169500 -- (-752.407) [-748.719] (-750.421) (-749.208) * (-751.716) (-748.373) (-749.105) [-751.426] -- 0:00:53
170000 -- (-756.621) (-750.640) [-752.703] (-752.172) * (-751.658) (-748.058) [-750.192] (-752.013) -- 0:00:53
Average standard deviation of split frequencies: 0.014600
170500 -- [-752.486] (-750.104) (-753.728) (-750.120) * (-750.273) (-750.534) (-750.217) [-749.271] -- 0:00:53
171000 -- (-753.053) (-749.882) [-753.744] (-751.653) * (-752.185) [-749.400] (-751.265) (-753.269) -- 0:00:53
171500 -- [-750.896] (-750.332) (-753.754) (-756.311) * (-754.027) [-750.520] (-751.342) (-750.767) -- 0:00:53
172000 -- (-749.240) (-750.431) [-750.233] (-751.812) * [-750.149] (-750.919) (-749.897) (-750.241) -- 0:00:52
172500 -- [-750.709] (-749.715) (-750.370) (-748.585) * (-748.727) (-750.798) [-749.897] (-753.572) -- 0:00:52
173000 -- (-749.506) (-752.048) (-752.374) [-748.638] * (-749.227) (-750.471) [-751.161] (-753.395) -- 0:00:52
173500 -- (-750.864) (-751.559) [-749.829] (-750.714) * (-750.333) (-751.156) (-752.282) [-750.807] -- 0:00:52
174000 -- (-750.475) (-750.133) [-749.010] (-749.366) * (-749.031) [-750.233] (-748.451) (-748.545) -- 0:00:52
174500 -- [-752.977] (-748.563) (-750.702) (-749.281) * (-749.070) (-749.998) (-750.149) [-748.739] -- 0:00:52
175000 -- (-751.356) (-749.251) (-751.922) [-750.656] * (-750.006) [-749.217] (-751.607) (-752.883) -- 0:00:51
Average standard deviation of split frequencies: 0.012546
175500 -- (-750.122) [-748.855] (-750.623) (-750.386) * (-749.463) [-751.611] (-755.579) (-750.896) -- 0:00:51
176000 -- (-752.890) (-750.739) [-751.384] (-748.913) * [-749.060] (-751.888) (-752.736) (-750.053) -- 0:00:51
176500 -- (-750.640) (-750.721) (-749.094) [-749.749] * (-748.524) (-750.808) (-754.226) [-748.626] -- 0:00:51
177000 -- (-749.312) [-750.357] (-749.314) (-751.818) * (-748.680) (-749.815) (-750.060) [-749.386] -- 0:00:51
177500 -- [-750.107] (-757.129) (-748.362) (-751.871) * (-748.521) [-748.084] (-754.529) (-749.381) -- 0:00:55
178000 -- (-750.517) (-751.988) (-748.694) [-750.012] * (-748.274) (-749.064) (-754.118) [-750.763] -- 0:00:55
178500 -- (-748.887) [-750.270] (-750.381) (-750.327) * [-750.583] (-749.206) (-751.025) (-751.194) -- 0:00:55
179000 -- (-749.383) (-752.898) [-749.127] (-749.938) * (-755.164) (-749.455) [-749.654] (-750.268) -- 0:00:55
179500 -- (-752.961) [-752.538] (-750.381) (-752.227) * [-750.408] (-750.045) (-749.647) (-749.679) -- 0:00:54
180000 -- [-749.283] (-748.656) (-751.627) (-749.572) * [-755.164] (-750.307) (-750.336) (-749.847) -- 0:00:54
Average standard deviation of split frequencies: 0.013626
180500 -- [-752.658] (-748.949) (-753.342) (-751.164) * (-750.914) (-749.031) (-752.892) [-751.798] -- 0:00:54
181000 -- [-748.896] (-749.661) (-749.071) (-751.114) * (-749.539) (-749.622) (-752.947) [-749.115] -- 0:00:54
181500 -- (-753.782) (-749.337) [-751.755] (-751.957) * [-748.973] (-751.908) (-751.202) (-749.683) -- 0:00:54
182000 -- (-748.053) (-749.284) [-747.938] (-753.014) * [-749.176] (-749.871) (-751.312) (-749.186) -- 0:00:53
182500 -- (-748.369) (-752.984) (-748.411) [-749.987] * (-748.490) (-753.631) (-751.715) [-748.359] -- 0:00:53
183000 -- [-749.904] (-748.663) (-749.724) (-749.969) * (-749.222) (-754.003) (-748.470) [-752.676] -- 0:00:53
183500 -- [-752.195] (-749.850) (-752.507) (-749.947) * (-750.357) [-749.224] (-748.443) (-751.561) -- 0:00:53
184000 -- (-761.234) [-750.687] (-751.604) (-750.584) * (-749.270) [-752.181] (-749.425) (-749.109) -- 0:00:53
184500 -- (-752.513) [-751.383] (-749.785) (-752.133) * (-748.132) (-753.303) (-750.233) [-749.120] -- 0:00:53
185000 -- (-749.004) (-751.461) (-750.067) [-749.900] * [-749.087] (-751.064) (-751.971) (-748.811) -- 0:00:52
Average standard deviation of split frequencies: 0.016548
185500 -- (-749.967) [-748.957] (-748.729) (-750.832) * (-748.317) (-752.732) (-750.889) [-749.145] -- 0:00:52
186000 -- (-750.106) (-749.045) [-748.747] (-750.385) * (-749.242) [-749.278] (-750.601) (-749.711) -- 0:00:52
186500 -- (-750.748) (-749.371) [-749.446] (-752.139) * (-749.864) (-749.378) (-755.314) [-750.290] -- 0:00:52
187000 -- [-750.912] (-748.700) (-754.148) (-751.059) * [-750.140] (-753.951) (-751.533) (-749.240) -- 0:00:52
187500 -- (-750.004) [-748.716] (-751.729) (-754.597) * (-750.561) [-752.247] (-756.147) (-751.360) -- 0:00:52
188000 -- [-749.597] (-750.159) (-750.853) (-753.666) * (-752.685) (-751.450) (-752.357) [-751.416] -- 0:00:51
188500 -- (-752.036) (-749.504) [-748.572] (-750.948) * [-749.887] (-755.311) (-751.134) (-748.786) -- 0:00:51
189000 -- (-749.151) (-749.928) (-751.553) [-748.870] * (-749.166) [-752.321] (-749.942) (-749.712) -- 0:00:51
189500 -- [-749.372] (-750.704) (-751.394) (-754.759) * (-748.885) (-751.906) (-749.991) [-749.449] -- 0:00:51
190000 -- (-749.263) (-749.850) [-747.944] (-752.147) * (-750.090) (-748.939) [-749.304] (-750.308) -- 0:00:51
Average standard deviation of split frequencies: 0.015109
190500 -- (-748.863) (-748.569) (-749.395) [-749.711] * (-749.657) (-747.840) (-747.948) [-750.053] -- 0:00:50
191000 -- (-749.617) (-751.394) [-749.863] (-750.666) * (-749.553) [-748.246] (-749.716) (-751.032) -- 0:00:55
191500 -- [-751.300] (-749.975) (-748.931) (-748.550) * (-749.734) (-749.216) (-750.093) [-754.241] -- 0:00:54
192000 -- (-752.082) (-752.291) [-751.119] (-750.303) * (-749.641) [-749.743] (-750.739) (-750.129) -- 0:00:54
192500 -- [-750.068] (-749.370) (-751.005) (-748.832) * [-753.957] (-751.658) (-754.282) (-749.333) -- 0:00:54
193000 -- (-748.486) [-749.954] (-748.554) (-749.540) * (-749.763) (-750.580) (-749.819) [-750.128] -- 0:00:54
193500 -- (-748.725) (-749.974) [-749.749] (-749.413) * (-749.920) (-749.217) [-750.642] (-750.254) -- 0:00:54
194000 -- (-748.457) [-749.252] (-749.375) (-751.369) * (-749.481) [-748.340] (-749.082) (-754.277) -- 0:00:54
194500 -- (-749.142) [-749.828] (-750.193) (-751.718) * [-750.699] (-748.352) (-749.625) (-751.036) -- 0:00:53
195000 -- [-752.985] (-751.863) (-749.206) (-748.060) * (-751.151) [-748.525] (-749.307) (-748.971) -- 0:00:53
Average standard deviation of split frequencies: 0.017437
195500 -- [-752.400] (-755.125) (-751.264) (-748.715) * (-753.814) (-749.055) [-750.950] (-753.086) -- 0:00:53
196000 -- (-751.863) (-753.075) (-754.254) [-748.956] * (-753.289) [-749.479] (-753.752) (-748.353) -- 0:00:53
196500 -- (-749.944) (-749.621) [-749.753] (-750.505) * (-755.505) [-750.335] (-750.917) (-749.563) -- 0:00:53
197000 -- (-749.461) (-748.575) [-749.292] (-752.253) * (-753.425) (-749.485) (-749.631) [-748.804] -- 0:00:52
197500 -- [-753.268] (-749.353) (-748.432) (-749.967) * (-748.930) [-749.688] (-753.996) (-749.559) -- 0:00:52
198000 -- (-752.286) [-748.984] (-752.785) (-751.537) * [-749.629] (-749.087) (-748.246) (-749.303) -- 0:00:52
198500 -- (-750.685) (-749.458) (-749.183) [-753.413] * [-750.378] (-751.956) (-750.501) (-750.961) -- 0:00:52
199000 -- [-750.250] (-754.100) (-750.991) (-753.435) * (-757.534) [-751.530] (-749.423) (-748.359) -- 0:00:52
199500 -- (-749.609) (-755.488) (-750.541) [-754.568] * [-752.055] (-750.340) (-749.402) (-752.352) -- 0:00:52
200000 -- [-751.702] (-755.490) (-752.697) (-750.531) * (-750.048) [-752.448] (-751.061) (-750.676) -- 0:00:51
Average standard deviation of split frequencies: 0.016601
200500 -- (-752.615) (-752.667) [-750.138] (-750.536) * (-749.170) [-750.370] (-750.393) (-754.855) -- 0:00:51
201000 -- (-750.227) [-749.372] (-748.529) (-749.677) * (-754.322) (-754.050) (-750.955) [-750.091] -- 0:00:51
201500 -- [-749.288] (-753.391) (-748.416) (-749.322) * (-750.796) [-748.500] (-751.604) (-750.822) -- 0:00:51
202000 -- (-748.870) (-750.460) (-752.925) [-752.427] * (-756.404) [-748.174] (-750.545) (-758.837) -- 0:00:51
202500 -- (-748.491) [-751.505] (-749.748) (-752.472) * (-751.108) (-752.773) [-749.421] (-751.081) -- 0:00:51
203000 -- (-748.719) [-750.905] (-748.799) (-755.718) * (-750.202) (-750.209) [-750.095] (-748.881) -- 0:00:51
203500 -- (-750.081) (-751.850) (-759.706) [-753.952] * (-750.158) (-750.531) [-749.256] (-748.598) -- 0:00:50
204000 -- (-751.484) (-749.298) [-753.341] (-750.891) * (-755.255) (-750.507) (-756.580) [-750.154] -- 0:00:50
204500 -- (-753.414) (-753.558) [-752.505] (-752.524) * (-756.102) [-750.515] (-753.831) (-749.524) -- 0:00:50
205000 -- (-751.335) (-750.738) (-749.553) [-750.887] * (-749.837) (-748.376) (-749.526) [-748.977] -- 0:00:54
Average standard deviation of split frequencies: 0.014588
205500 -- (-750.621) (-748.957) (-748.866) [-754.878] * [-751.369] (-753.866) (-754.723) (-751.723) -- 0:00:54
206000 -- (-749.582) (-749.387) (-750.032) [-750.962] * (-748.080) (-752.060) (-751.206) [-751.426] -- 0:00:53
206500 -- [-748.490] (-749.503) (-751.084) (-748.346) * (-749.137) (-750.372) [-752.099] (-749.587) -- 0:00:53
207000 -- (-750.536) (-748.882) [-754.760] (-748.775) * (-751.122) (-749.153) [-750.612] (-748.629) -- 0:00:53
207500 -- (-749.488) (-750.511) [-749.916] (-751.257) * (-753.107) (-750.316) [-751.647] (-749.571) -- 0:00:53
208000 -- (-749.109) (-753.238) (-748.833) [-750.211] * (-751.425) [-754.210] (-748.529) (-752.818) -- 0:00:53
208500 -- (-750.937) (-750.566) (-749.186) [-749.773] * (-749.031) (-754.513) (-749.802) [-750.222] -- 0:00:53
209000 -- (-751.276) (-750.946) (-750.618) [-750.965] * (-750.136) (-751.220) [-750.611] (-751.452) -- 0:00:52
209500 -- (-750.739) (-750.149) [-751.110] (-752.009) * (-748.675) (-756.144) [-752.371] (-751.861) -- 0:00:52
210000 -- (-749.731) (-753.030) (-751.885) [-749.710] * (-750.564) (-752.798) (-749.223) [-749.101] -- 0:00:52
Average standard deviation of split frequencies: 0.014545
210500 -- (-750.591) (-749.216) (-749.877) [-753.746] * (-752.493) (-752.588) (-748.614) [-749.218] -- 0:00:52
211000 -- [-750.072] (-748.180) (-750.076) (-749.389) * (-759.459) (-751.993) [-750.317] (-750.629) -- 0:00:52
211500 -- (-751.892) (-748.862) [-748.756] (-751.109) * (-751.369) [-748.373] (-748.939) (-749.602) -- 0:00:52
212000 -- (-752.476) (-751.993) (-750.967) [-753.200] * [-750.284] (-751.802) (-748.788) (-750.354) -- 0:00:52
212500 -- (-751.575) (-752.846) (-748.832) [-752.085] * (-750.314) (-752.505) (-749.613) [-752.623] -- 0:00:51
213000 -- (-751.392) [-748.450] (-748.205) (-750.363) * [-748.654] (-753.245) (-749.784) (-748.488) -- 0:00:51
213500 -- [-750.738] (-748.472) (-749.326) (-753.338) * (-749.296) (-752.864) [-750.387] (-751.791) -- 0:00:51
214000 -- (-752.136) (-749.105) [-749.631] (-751.292) * (-749.391) (-752.471) [-753.898] (-748.408) -- 0:00:51
214500 -- (-752.687) (-749.076) [-748.653] (-748.891) * (-750.771) (-748.593) [-752.632] (-749.405) -- 0:00:51
215000 -- (-748.996) (-749.958) [-748.390] (-754.692) * (-749.803) [-749.107] (-748.623) (-748.717) -- 0:00:51
Average standard deviation of split frequencies: 0.011731
215500 -- (-752.227) (-749.276) [-749.595] (-754.057) * (-748.481) [-749.596] (-748.963) (-753.202) -- 0:00:50
216000 -- [-748.292] (-753.643) (-753.338) (-754.313) * (-748.865) [-750.118] (-751.864) (-755.149) -- 0:00:50
216500 -- [-748.924] (-752.715) (-754.830) (-749.970) * [-751.267] (-753.774) (-751.081) (-750.827) -- 0:00:50
217000 -- (-748.726) (-752.474) [-751.481] (-750.779) * [-749.280] (-752.980) (-748.123) (-752.339) -- 0:00:50
217500 -- (-749.787) [-749.046] (-749.513) (-751.082) * (-750.579) [-752.523] (-749.221) (-752.216) -- 0:00:53
218000 -- (-750.635) (-750.201) [-750.749] (-750.293) * (-750.305) [-752.018] (-750.747) (-751.386) -- 0:00:53
218500 -- (-750.244) (-750.567) (-751.503) [-748.384] * (-750.109) (-749.257) (-751.823) [-753.850] -- 0:00:53
219000 -- [-749.105] (-752.447) (-749.810) (-749.765) * (-751.271) (-750.469) (-750.074) [-756.343] -- 0:00:53
219500 -- (-748.928) (-751.416) (-749.487) [-749.839] * (-752.178) [-749.663] (-749.452) (-750.244) -- 0:00:53
220000 -- (-753.944) [-750.244] (-748.636) (-749.871) * [-751.394] (-748.943) (-748.624) (-747.956) -- 0:00:53
Average standard deviation of split frequencies: 0.011109
220500 -- (-751.273) [-751.685] (-748.701) (-748.424) * (-748.076) [-748.496] (-748.904) (-748.849) -- 0:00:53
221000 -- (-749.826) (-749.878) [-752.383] (-751.253) * (-750.952) (-752.032) [-750.944] (-750.516) -- 0:00:52
221500 -- (-754.139) (-751.598) [-749.269] (-751.571) * (-753.333) (-751.194) [-751.405] (-749.588) -- 0:00:52
222000 -- (-753.009) [-748.615] (-748.902) (-749.025) * (-749.988) [-750.252] (-754.821) (-749.778) -- 0:00:52
222500 -- (-752.585) (-747.928) [-748.691] (-748.848) * (-755.825) [-752.218] (-753.322) (-749.579) -- 0:00:52
223000 -- (-750.264) (-747.985) [-751.730] (-752.415) * [-751.565] (-751.804) (-754.156) (-748.227) -- 0:00:52
223500 -- [-750.944] (-751.852) (-752.331) (-752.322) * (-749.731) (-749.128) [-748.830] (-748.448) -- 0:00:52
224000 -- (-748.789) (-749.853) (-752.102) [-747.981] * (-750.541) (-749.909) (-751.914) [-749.972] -- 0:00:51
224500 -- (-750.924) (-749.004) [-749.543] (-750.254) * (-750.175) (-749.197) (-749.407) [-749.176] -- 0:00:51
225000 -- (-751.863) (-748.702) [-749.797] (-751.722) * (-750.776) (-748.845) (-751.668) [-748.052] -- 0:00:51
Average standard deviation of split frequencies: 0.011656
225500 -- (-753.005) [-749.843] (-749.908) (-750.028) * [-749.938] (-750.864) (-751.203) (-749.165) -- 0:00:51
226000 -- (-748.772) [-752.900] (-750.918) (-752.417) * (-749.335) (-750.777) [-750.577] (-751.313) -- 0:00:51
226500 -- (-749.278) (-751.397) (-752.228) [-750.493] * (-749.843) (-750.147) [-749.810] (-750.513) -- 0:00:51
227000 -- (-753.219) (-750.048) (-749.995) [-752.006] * [-749.945] (-752.853) (-749.343) (-748.911) -- 0:00:51
227500 -- [-749.833] (-752.123) (-749.611) (-749.789) * (-750.344) (-750.235) (-748.299) [-748.533] -- 0:00:50
228000 -- (-752.939) (-750.912) (-751.243) [-751.075] * (-752.118) [-750.579] (-750.836) (-751.044) -- 0:00:50
228500 -- (-749.449) (-749.637) [-749.625] (-754.450) * (-749.628) (-749.445) [-750.678] (-750.256) -- 0:00:50
229000 -- (-750.517) [-752.683] (-749.344) (-752.003) * (-751.686) [-750.492] (-751.808) (-750.101) -- 0:00:50
229500 -- (-756.255) (-760.028) [-750.867] (-752.736) * (-752.196) [-748.089] (-749.722) (-749.978) -- 0:00:50
230000 -- (-750.929) (-753.145) [-753.275] (-749.497) * (-750.182) (-748.194) [-748.106] (-753.066) -- 0:00:50
Average standard deviation of split frequencies: 0.012035
230500 -- [-748.447] (-749.830) (-749.924) (-748.487) * [-750.793] (-749.748) (-750.030) (-751.962) -- 0:00:50
231000 -- (-748.501) (-750.114) (-748.107) [-750.414] * (-750.484) [-750.550] (-749.191) (-750.547) -- 0:00:53
231500 -- (-748.749) (-752.832) (-749.879) [-748.638] * (-749.507) (-750.505) (-748.810) [-749.747] -- 0:00:53
232000 -- [-753.275] (-749.888) (-749.843) (-750.180) * (-752.717) (-749.968) (-749.169) [-750.351] -- 0:00:52
232500 -- (-755.339) [-749.397] (-752.384) (-750.496) * (-753.304) (-753.946) (-749.496) [-749.916] -- 0:00:52
233000 -- (-752.493) (-750.805) [-751.099] (-749.897) * (-750.458) (-752.633) [-750.581] (-750.339) -- 0:00:52
233500 -- (-749.512) (-751.340) (-752.128) [-749.884] * (-751.446) (-755.957) (-750.359) [-751.093] -- 0:00:52
234000 -- (-748.901) (-751.498) (-750.615) [-749.200] * (-751.423) [-748.706] (-750.319) (-750.386) -- 0:00:52
234500 -- (-749.881) [-748.365] (-748.351) (-749.252) * [-749.016] (-750.469) (-750.476) (-749.067) -- 0:00:52
235000 -- (-750.861) [-751.769] (-750.231) (-749.782) * (-752.758) (-749.573) [-750.997] (-749.052) -- 0:00:52
Average standard deviation of split frequencies: 0.012984
235500 -- (-749.061) (-749.256) (-749.496) [-753.355] * (-749.384) (-754.098) [-749.727] (-748.929) -- 0:00:51
236000 -- [-751.870] (-749.166) (-750.947) (-754.571) * [-749.299] (-750.294) (-749.180) (-750.613) -- 0:00:51
236500 -- (-749.532) (-748.261) (-748.759) [-749.619] * (-750.299) (-749.520) (-749.221) [-748.521] -- 0:00:51
237000 -- (-752.613) (-750.135) (-749.012) [-750.979] * (-749.917) (-748.180) [-749.906] (-754.780) -- 0:00:51
237500 -- [-750.377] (-749.710) (-751.438) (-750.302) * (-749.226) (-752.789) (-757.150) [-750.533] -- 0:00:51
238000 -- (-751.216) (-751.234) (-750.223) [-748.120] * (-749.399) (-751.044) [-750.714] (-749.840) -- 0:00:51
238500 -- (-754.085) [-752.530] (-752.822) (-748.135) * (-749.986) (-755.275) [-748.566] (-753.163) -- 0:00:51
239000 -- (-748.583) (-751.324) [-752.718] (-749.699) * (-748.637) (-752.842) (-751.950) [-748.198] -- 0:00:50
239500 -- (-757.641) (-751.375) (-750.448) [-749.241] * [-749.571] (-752.405) (-752.284) (-748.199) -- 0:00:50
240000 -- (-754.107) [-750.776] (-749.729) (-752.007) * (-752.245) (-751.263) [-752.452] (-750.515) -- 0:00:50
Average standard deviation of split frequencies: 0.013366
240500 -- (-750.037) (-750.560) [-750.660] (-750.335) * (-749.404) [-754.278] (-751.639) (-749.068) -- 0:00:50
241000 -- [-749.564] (-752.295) (-750.527) (-750.310) * (-749.679) [-749.372] (-751.228) (-750.480) -- 0:00:50
241500 -- (-751.224) (-749.979) [-751.365] (-760.600) * (-749.479) [-750.345] (-753.256) (-752.660) -- 0:00:50
242000 -- (-752.239) (-749.015) (-749.397) [-749.921] * (-747.852) [-749.259] (-749.181) (-749.788) -- 0:00:50
242500 -- (-751.405) (-749.019) [-749.450] (-754.053) * (-747.822) (-748.873) [-749.273] (-754.072) -- 0:00:49
243000 -- (-749.878) (-747.905) [-749.866] (-752.941) * [-748.689] (-749.317) (-748.165) (-749.921) -- 0:00:49
243500 -- (-749.142) (-748.001) (-750.887) [-750.507] * (-750.388) [-750.723] (-752.431) (-748.481) -- 0:00:49
244000 -- (-748.063) (-748.705) (-748.871) [-750.452] * [-748.639] (-750.501) (-749.814) (-748.750) -- 0:00:49
244500 -- [-748.681] (-749.298) (-750.174) (-754.411) * (-752.683) [-750.190] (-748.229) (-752.711) -- 0:00:52
245000 -- [-749.137] (-750.587) (-748.856) (-755.777) * (-749.478) [-751.051] (-748.462) (-752.632) -- 0:00:52
Average standard deviation of split frequencies: 0.013189
245500 -- (-751.507) [-749.003] (-748.296) (-750.390) * (-748.910) (-752.681) [-751.384] (-753.443) -- 0:00:52
246000 -- (-753.996) (-750.861) [-751.895] (-748.807) * (-751.136) [-751.830] (-751.103) (-748.468) -- 0:00:52
246500 -- (-750.390) (-751.834) [-749.868] (-750.252) * [-748.762] (-748.517) (-751.488) (-751.432) -- 0:00:51
247000 -- [-750.361] (-748.810) (-749.480) (-750.439) * (-749.701) [-748.300] (-749.670) (-749.327) -- 0:00:51
247500 -- (-749.074) (-748.721) (-749.580) [-749.428] * (-752.427) [-748.380] (-749.650) (-747.859) -- 0:00:51
248000 -- (-748.454) [-749.680] (-750.254) (-749.750) * [-748.956] (-749.783) (-749.494) (-750.310) -- 0:00:51
248500 -- [-751.167] (-751.233) (-750.370) (-749.930) * (-749.744) (-749.785) [-748.361] (-751.272) -- 0:00:51
249000 -- [-749.581] (-752.291) (-749.905) (-749.075) * (-749.859) (-749.903) (-748.439) [-749.118] -- 0:00:51
249500 -- (-749.162) (-752.198) (-749.578) [-749.539] * (-748.183) [-752.526] (-750.230) (-750.526) -- 0:00:51
250000 -- (-749.281) (-749.972) [-749.285] (-751.626) * (-750.137) (-752.036) [-747.983] (-754.361) -- 0:00:51
Average standard deviation of split frequencies: 0.011505
250500 -- (-750.707) [-749.319] (-749.598) (-750.698) * (-748.831) (-755.192) [-748.030] (-753.064) -- 0:00:50
251000 -- (-749.798) (-749.209) [-748.861] (-753.807) * [-749.595] (-751.553) (-750.811) (-753.559) -- 0:00:50
251500 -- (-749.891) (-748.142) (-751.172) [-751.275] * (-749.148) [-750.681] (-752.063) (-751.632) -- 0:00:50
252000 -- [-748.309] (-749.059) (-754.611) (-748.988) * [-749.213] (-750.850) (-748.872) (-750.145) -- 0:00:50
252500 -- (-752.394) (-749.118) (-750.628) [-750.060] * (-751.388) (-750.366) (-758.936) [-752.364] -- 0:00:50
253000 -- (-756.313) [-747.966] (-749.225) (-748.380) * (-756.136) (-750.369) (-751.023) [-749.149] -- 0:00:50
253500 -- (-749.559) (-750.276) (-748.472) [-749.257] * (-748.486) [-750.746] (-752.678) (-750.250) -- 0:00:50
254000 -- (-750.738) [-752.063] (-753.239) (-748.097) * (-750.135) [-749.273] (-749.391) (-752.863) -- 0:00:49
254500 -- (-749.869) (-750.568) (-750.153) [-748.409] * [-749.782] (-748.182) (-751.508) (-752.689) -- 0:00:49
255000 -- (-752.126) (-752.932) [-750.252] (-748.046) * (-751.391) [-749.024] (-750.285) (-749.427) -- 0:00:49
Average standard deviation of split frequencies: 0.011854
255500 -- (-754.278) [-750.852] (-748.917) (-751.862) * (-750.429) (-749.872) [-749.630] (-749.620) -- 0:00:49
256000 -- (-753.409) [-749.995] (-753.904) (-748.014) * (-748.915) (-749.825) (-754.294) [-749.446] -- 0:00:49
256500 -- (-755.738) [-751.251] (-750.881) (-748.946) * (-751.082) [-748.780] (-752.513) (-748.369) -- 0:00:49
257000 -- (-755.298) (-749.897) (-749.984) [-748.992] * (-749.417) (-752.707) [-749.470] (-748.925) -- 0:00:49
257500 -- [-749.618] (-749.121) (-748.777) (-751.074) * [-749.467] (-749.381) (-750.566) (-754.409) -- 0:00:51
258000 -- (-750.718) (-749.967) (-749.818) [-749.873] * (-755.788) (-751.239) [-750.616] (-750.549) -- 0:00:51
258500 -- (-748.676) [-748.098] (-748.703) (-748.256) * (-753.951) (-751.181) [-751.202] (-751.023) -- 0:00:51
259000 -- (-748.734) [-753.010] (-749.990) (-750.484) * (-751.038) [-749.050] (-751.121) (-750.239) -- 0:00:51
259500 -- (-747.901) (-749.977) [-751.854] (-749.607) * (-748.838) [-751.546] (-754.331) (-749.257) -- 0:00:51
260000 -- [-750.610] (-751.415) (-750.909) (-748.529) * (-749.262) (-749.964) [-751.895] (-752.397) -- 0:00:51
Average standard deviation of split frequencies: 0.012885
260500 -- (-750.756) [-748.785] (-750.724) (-750.196) * [-749.948] (-749.244) (-751.135) (-750.953) -- 0:00:51
261000 -- [-748.337] (-752.117) (-753.334) (-750.177) * [-749.851] (-749.922) (-749.336) (-753.655) -- 0:00:50
261500 -- (-750.272) (-752.416) (-750.355) [-751.750] * [-751.616] (-750.574) (-750.722) (-750.766) -- 0:00:50
262000 -- (-748.740) (-751.224) [-749.957] (-752.528) * (-752.206) (-751.197) [-749.864] (-753.210) -- 0:00:50
262500 -- (-751.465) [-750.712] (-752.703) (-748.000) * [-751.027] (-748.750) (-749.084) (-749.367) -- 0:00:50
263000 -- (-752.707) [-750.382] (-751.682) (-750.471) * (-752.910) [-748.104] (-752.244) (-751.437) -- 0:00:50
263500 -- (-753.997) [-752.366] (-752.300) (-748.661) * [-748.069] (-749.480) (-749.174) (-752.264) -- 0:00:50
264000 -- (-752.427) [-750.191] (-749.130) (-750.544) * [-749.307] (-749.409) (-752.114) (-755.249) -- 0:00:50
264500 -- [-752.033] (-753.337) (-750.163) (-749.602) * (-749.953) (-751.388) (-750.561) [-751.211] -- 0:00:50
265000 -- (-749.201) [-753.318] (-750.534) (-750.619) * (-748.690) (-750.544) (-750.606) [-752.456] -- 0:00:49
Average standard deviation of split frequencies: 0.013239
265500 -- [-749.183] (-750.828) (-748.433) (-750.715) * (-751.030) (-748.217) (-748.777) [-749.028] -- 0:00:49
266000 -- [-752.159] (-749.824) (-749.444) (-752.836) * (-749.343) (-749.099) [-748.813] (-748.546) -- 0:00:49
266500 -- (-751.733) [-749.372] (-752.314) (-750.554) * (-748.992) [-751.222] (-752.104) (-749.902) -- 0:00:49
267000 -- (-750.141) (-749.487) [-749.737] (-749.339) * (-755.823) (-749.004) [-752.185] (-750.110) -- 0:00:49
267500 -- (-749.512) (-751.638) (-749.575) [-749.938] * (-748.065) [-751.080] (-749.040) (-748.167) -- 0:00:49
268000 -- (-750.872) (-749.087) (-748.122) [-749.623] * (-749.795) [-750.734] (-748.843) (-749.176) -- 0:00:49
268500 -- (-750.457) [-749.463] (-752.276) (-749.334) * (-748.400) (-750.658) [-749.217] (-749.086) -- 0:00:49
269000 -- (-750.633) [-750.413] (-750.712) (-750.251) * (-750.068) (-752.789) [-749.242] (-757.693) -- 0:00:48
269500 -- [-750.166] (-752.882) (-751.700) (-752.837) * (-750.263) (-750.210) [-749.912] (-753.806) -- 0:00:48
270000 -- (-749.207) [-748.361] (-748.855) (-750.499) * (-750.388) (-749.915) [-748.525] (-749.062) -- 0:00:48
Average standard deviation of split frequencies: 0.014445
270500 -- [-749.242] (-754.067) (-751.280) (-749.862) * (-748.612) (-750.279) [-748.443] (-751.493) -- 0:00:51
271000 -- (-748.924) [-748.675] (-756.198) (-753.610) * (-748.341) [-750.991] (-749.507) (-749.836) -- 0:00:51
271500 -- [-751.323] (-750.859) (-751.031) (-752.193) * (-748.296) (-751.540) (-750.458) [-751.959] -- 0:00:50
272000 -- (-748.673) [-748.204] (-753.917) (-751.106) * [-751.885] (-749.980) (-750.816) (-749.260) -- 0:00:50
272500 -- (-750.039) (-748.276) (-754.689) [-748.887] * (-748.764) (-748.236) [-751.771] (-748.315) -- 0:00:50
273000 -- (-750.029) [-749.994] (-750.807) (-748.918) * [-748.148] (-751.914) (-751.257) (-751.056) -- 0:00:50
273500 -- (-750.153) [-748.491] (-747.914) (-747.846) * (-749.310) (-750.370) [-751.839] (-750.055) -- 0:00:50
274000 -- [-750.302] (-751.612) (-752.540) (-749.951) * (-749.197) (-751.773) (-749.650) [-749.746] -- 0:00:50
274500 -- (-751.764) [-749.978] (-748.717) (-750.095) * (-753.017) (-749.592) [-754.187] (-750.780) -- 0:00:50
275000 -- (-751.608) (-750.574) [-749.004] (-751.307) * (-755.531) (-748.422) (-749.792) [-748.892] -- 0:00:50
Average standard deviation of split frequencies: 0.013162
275500 -- (-751.085) (-750.046) (-748.991) [-748.286] * (-749.279) (-750.318) (-749.323) [-749.133] -- 0:00:49
276000 -- (-750.576) (-748.636) [-749.469] (-749.107) * (-749.643) [-748.257] (-749.120) (-749.768) -- 0:00:49
276500 -- (-751.248) (-748.137) (-754.552) [-751.578] * (-752.912) (-748.608) [-749.377] (-756.113) -- 0:00:49
277000 -- (-750.708) (-749.637) (-749.600) [-750.719] * [-749.222] (-750.744) (-749.436) (-750.001) -- 0:00:49
277500 -- (-749.112) (-748.523) (-752.314) [-749.372] * (-750.442) (-748.985) (-749.934) [-751.117] -- 0:00:49
278000 -- (-749.896) (-748.382) [-750.772] (-752.777) * (-749.055) (-750.556) [-751.650] (-752.165) -- 0:00:49
278500 -- (-751.448) (-749.558) [-749.338] (-749.721) * [-748.688] (-750.283) (-750.923) (-754.525) -- 0:00:49
279000 -- (-757.967) (-748.691) [-750.343] (-748.745) * (-749.917) (-748.700) (-751.480) [-748.919] -- 0:00:49
279500 -- [-749.602] (-751.343) (-749.461) (-756.198) * [-748.682] (-751.894) (-752.184) (-751.781) -- 0:00:48
280000 -- (-748.032) [-751.630] (-749.395) (-751.220) * (-749.523) (-749.780) (-750.067) [-752.971] -- 0:00:48
Average standard deviation of split frequencies: 0.013140
280500 -- (-749.108) [-750.685] (-752.074) (-751.503) * [-749.499] (-752.809) (-750.848) (-750.043) -- 0:00:48
281000 -- (-749.089) [-748.124] (-749.517) (-750.930) * (-749.029) (-748.693) (-750.134) [-749.874] -- 0:00:48
281500 -- (-749.429) (-752.483) [-751.088] (-752.319) * (-751.932) [-749.477] (-750.875) (-750.311) -- 0:00:48
282000 -- (-748.582) (-750.254) [-754.322] (-759.052) * [-751.739] (-749.918) (-749.148) (-749.182) -- 0:00:48
282500 -- (-751.645) [-751.843] (-752.041) (-749.318) * (-750.254) (-749.849) [-750.508] (-752.181) -- 0:00:48
283000 -- (-755.395) (-751.804) (-754.035) [-750.306] * (-749.993) [-749.439] (-753.881) (-751.268) -- 0:00:48
283500 -- (-752.706) (-750.186) [-750.737] (-748.927) * (-748.454) (-748.841) [-751.736] (-750.952) -- 0:00:48
284000 -- [-748.949] (-750.240) (-749.838) (-748.112) * (-749.071) [-748.527] (-748.520) (-754.897) -- 0:00:47
284500 -- (-755.339) (-749.875) (-754.991) [-753.647] * (-750.763) (-751.294) (-748.495) [-758.499] -- 0:00:50
285000 -- (-751.926) (-750.945) [-749.519] (-750.045) * (-749.553) (-749.944) [-748.216] (-753.804) -- 0:00:50
Average standard deviation of split frequencies: 0.012992
285500 -- (-752.333) [-748.011] (-750.598) (-751.324) * (-753.842) (-750.531) [-749.383] (-751.732) -- 0:00:50
286000 -- (-749.289) [-748.801] (-749.988) (-749.827) * (-756.735) (-748.387) (-748.844) [-749.390] -- 0:00:49
286500 -- [-750.614] (-748.772) (-748.444) (-753.416) * [-752.809] (-749.189) (-752.144) (-750.516) -- 0:00:49
287000 -- [-749.685] (-752.153) (-748.886) (-748.350) * (-751.168) (-751.862) [-749.402] (-752.398) -- 0:00:49
287500 -- (-748.786) (-751.854) [-748.324] (-749.524) * [-752.147] (-752.794) (-749.841) (-751.485) -- 0:00:49
288000 -- (-754.315) [-750.004] (-751.192) (-749.198) * [-748.916] (-750.699) (-751.046) (-754.627) -- 0:00:49
288500 -- [-753.812] (-753.386) (-748.025) (-748.524) * (-750.535) (-750.509) (-749.783) [-751.674] -- 0:00:49
289000 -- (-752.850) (-752.512) [-751.831] (-749.509) * (-749.656) (-748.569) [-748.147] (-748.747) -- 0:00:49
289500 -- [-750.860] (-751.205) (-750.847) (-748.918) * (-749.811) (-748.070) (-754.240) [-753.716] -- 0:00:49
290000 -- (-748.812) [-750.410] (-750.585) (-748.035) * (-751.883) (-748.278) (-750.440) [-750.355] -- 0:00:48
Average standard deviation of split frequencies: 0.013165
290500 -- [-748.987] (-752.098) (-750.714) (-750.115) * (-748.799) [-751.864] (-749.398) (-749.307) -- 0:00:48
291000 -- (-751.879) (-751.273) [-748.479] (-750.834) * [-750.078] (-749.035) (-750.517) (-749.707) -- 0:00:48
291500 -- [-750.121] (-749.838) (-748.474) (-749.678) * (-751.046) [-749.063] (-749.357) (-750.198) -- 0:00:48
292000 -- (-747.941) (-750.554) (-750.864) [-747.931] * (-749.131) [-750.334] (-749.751) (-749.659) -- 0:00:48
292500 -- (-748.162) (-755.727) (-750.825) [-748.333] * (-749.299) (-750.348) [-749.439] (-748.119) -- 0:00:48
293000 -- (-748.161) [-750.165] (-749.994) (-748.333) * (-748.579) [-749.773] (-751.253) (-753.675) -- 0:00:48
293500 -- (-750.147) (-752.859) (-751.552) [-749.817] * (-751.084) (-750.823) [-752.692] (-751.456) -- 0:00:48
294000 -- (-750.388) [-748.421] (-752.091) (-749.206) * (-748.462) (-749.957) (-751.882) [-750.576] -- 0:00:48
294500 -- (-750.572) [-750.546] (-749.533) (-751.436) * [-749.638] (-749.867) (-750.429) (-753.206) -- 0:00:47
295000 -- (-755.445) (-752.004) (-750.030) [-758.825] * (-752.547) (-751.335) (-751.850) [-751.492] -- 0:00:47
Average standard deviation of split frequencies: 0.013490
295500 -- (-749.867) (-749.320) [-750.655] (-751.342) * (-751.530) [-751.974] (-751.009) (-750.665) -- 0:00:47
296000 -- (-749.555) (-747.929) (-748.145) [-749.348] * [-750.401] (-753.135) (-751.813) (-752.094) -- 0:00:47
296500 -- (-748.419) (-748.317) [-749.384] (-749.436) * (-752.332) [-749.756] (-749.925) (-751.578) -- 0:00:47
297000 -- (-752.015) (-749.813) [-748.808] (-750.086) * (-749.399) (-752.207) [-750.435] (-751.982) -- 0:00:47
297500 -- (-749.115) [-750.647] (-749.191) (-752.881) * (-751.057) [-749.110] (-752.150) (-752.166) -- 0:00:49
298000 -- (-750.143) [-749.341] (-753.067) (-751.731) * (-748.623) [-750.585] (-750.532) (-752.274) -- 0:00:49
298500 -- (-750.742) (-751.513) (-751.816) [-751.025] * (-752.932) [-749.874] (-752.957) (-751.977) -- 0:00:49
299000 -- (-753.469) (-753.001) (-750.577) [-749.440] * (-750.644) (-752.592) (-749.204) [-749.998] -- 0:00:49
299500 -- (-752.424) (-753.876) [-749.751] (-749.722) * (-750.934) (-755.730) [-749.615] (-751.721) -- 0:00:49
300000 -- (-755.057) (-753.425) [-752.818] (-749.702) * (-751.398) (-751.782) (-749.454) [-749.281] -- 0:00:48
Average standard deviation of split frequencies: 0.012820
300500 -- [-749.198] (-752.415) (-748.455) (-749.277) * (-750.880) (-749.092) (-751.089) [-750.202] -- 0:00:48
301000 -- (-750.970) (-748.366) [-751.224] (-748.397) * (-752.147) [-751.269] (-749.420) (-749.807) -- 0:00:48
301500 -- (-749.947) (-748.867) [-749.590] (-749.333) * (-752.173) (-748.879) [-752.903] (-750.732) -- 0:00:48
302000 -- [-753.952] (-748.029) (-749.005) (-749.530) * (-752.382) (-749.019) (-749.934) [-750.594] -- 0:00:48
302500 -- (-748.704) [-749.658] (-750.638) (-750.440) * [-749.516] (-753.411) (-752.711) (-751.702) -- 0:00:48
303000 -- (-748.273) (-750.687) (-752.033) [-749.926] * (-749.796) (-755.455) [-748.118] (-750.332) -- 0:00:48
303500 -- [-748.273] (-748.433) (-749.355) (-749.326) * (-751.899) (-755.035) [-748.113] (-754.974) -- 0:00:48
304000 -- (-750.726) (-748.600) (-749.730) [-751.431] * [-750.436] (-751.739) (-749.565) (-755.324) -- 0:00:48
304500 -- (-749.845) [-750.065] (-747.958) (-750.052) * [-748.423] (-750.754) (-749.158) (-749.403) -- 0:00:47
305000 -- (-752.479) (-750.876) (-747.957) [-749.409] * (-749.928) (-751.326) [-749.702] (-748.368) -- 0:00:47
Average standard deviation of split frequencies: 0.011871
305500 -- (-750.493) (-751.660) [-750.783] (-750.208) * (-750.503) (-749.907) [-749.016] (-754.246) -- 0:00:47
306000 -- (-749.383) (-754.649) (-754.244) [-750.877] * [-748.621] (-753.049) (-751.550) (-755.728) -- 0:00:47
306500 -- (-749.532) (-748.869) (-752.628) [-749.449] * (-749.029) [-753.665] (-749.404) (-750.464) -- 0:00:47
307000 -- (-751.191) [-751.614] (-755.284) (-750.556) * (-748.267) (-748.218) [-752.747] (-748.926) -- 0:00:47
307500 -- (-752.430) [-748.522] (-749.252) (-750.920) * [-749.651] (-755.219) (-752.012) (-748.576) -- 0:00:47
308000 -- (-753.177) (-749.980) [-751.257] (-749.290) * (-757.671) (-752.001) (-748.906) [-749.400] -- 0:00:47
308500 -- [-751.951] (-749.020) (-751.067) (-753.458) * (-753.147) (-750.730) [-748.672] (-748.338) -- 0:00:47
309000 -- [-751.042] (-749.450) (-751.946) (-749.797) * (-751.962) [-748.026] (-751.836) (-748.631) -- 0:00:46
309500 -- (-751.136) (-752.288) [-749.889] (-750.624) * (-749.636) (-749.377) [-750.479] (-749.948) -- 0:00:46
310000 -- (-751.735) [-748.684] (-748.834) (-749.595) * (-748.999) (-749.298) [-751.307] (-749.061) -- 0:00:46
Average standard deviation of split frequencies: 0.011380
310500 -- (-754.195) (-751.088) [-748.823] (-749.690) * (-751.188) (-750.029) [-750.172] (-749.470) -- 0:00:46
311000 -- (-750.077) (-750.076) [-752.885] (-749.011) * [-750.597] (-753.933) (-749.179) (-750.430) -- 0:00:48
311500 -- (-750.315) (-751.346) (-752.366) [-749.657] * (-752.254) [-752.210] (-748.165) (-750.589) -- 0:00:48
312000 -- (-747.827) [-751.108] (-753.542) (-750.243) * (-749.980) [-752.191] (-748.626) (-748.427) -- 0:00:48
312500 -- (-750.355) (-752.321) (-755.781) [-752.876] * (-753.044) (-750.577) (-749.384) [-752.259] -- 0:00:48
313000 -- (-749.934) (-750.832) (-753.639) [-751.843] * (-752.586) (-748.978) [-753.382] (-748.370) -- 0:00:48
313500 -- (-749.631) (-749.071) [-751.119] (-751.544) * (-748.530) (-748.492) (-751.145) [-750.115] -- 0:00:48
314000 -- (-750.892) (-755.115) [-749.519] (-748.467) * (-750.269) [-749.862] (-750.014) (-749.790) -- 0:00:48
314500 -- [-749.930] (-749.330) (-750.953) (-749.514) * [-749.801] (-750.511) (-749.085) (-749.063) -- 0:00:47
315000 -- (-751.688) (-749.590) [-751.270] (-753.966) * [-750.723] (-748.652) (-748.660) (-748.801) -- 0:00:47
Average standard deviation of split frequencies: 0.010815
315500 -- (-749.706) (-750.089) [-750.909] (-755.406) * (-753.890) [-750.944] (-750.362) (-751.373) -- 0:00:47
316000 -- (-749.962) (-750.292) (-751.220) [-751.093] * (-755.141) [-750.011] (-750.645) (-751.370) -- 0:00:47
316500 -- (-751.023) (-749.287) [-749.833] (-749.137) * (-752.354) (-751.726) (-749.239) [-752.189] -- 0:00:47
317000 -- (-752.595) [-749.341] (-754.090) (-751.008) * (-752.620) (-750.267) (-748.160) [-748.996] -- 0:00:47
317500 -- (-753.037) (-749.170) (-751.881) [-750.626] * (-749.182) (-751.990) [-749.693] (-748.483) -- 0:00:47
318000 -- (-748.349) (-750.335) (-752.770) [-750.452] * (-748.096) [-749.047] (-749.564) (-750.541) -- 0:00:47
318500 -- [-750.080] (-748.373) (-748.960) (-749.437) * [-748.549] (-749.726) (-750.744) (-752.599) -- 0:00:47
319000 -- (-751.549) [-751.511] (-754.006) (-748.787) * [-749.186] (-752.581) (-749.275) (-750.264) -- 0:00:46
319500 -- (-751.572) (-751.719) (-759.364) [-748.346] * [-749.933] (-750.934) (-750.200) (-753.656) -- 0:00:46
320000 -- [-752.883] (-748.980) (-755.244) (-754.586) * (-749.060) (-748.302) [-749.035] (-749.735) -- 0:00:46
Average standard deviation of split frequencies: 0.010781
320500 -- (-751.798) [-751.311] (-756.480) (-749.677) * (-750.737) (-750.492) (-750.013) [-749.937] -- 0:00:46
321000 -- [-749.538] (-751.351) (-749.014) (-752.822) * (-748.786) [-751.585] (-753.703) (-748.804) -- 0:00:46
321500 -- (-749.976) (-749.530) (-755.155) [-752.238] * (-756.329) (-748.750) [-748.991] (-749.334) -- 0:00:46
322000 -- (-750.001) (-749.322) (-749.781) [-755.107] * (-749.151) (-751.784) (-752.113) [-748.372] -- 0:00:46
322500 -- (-750.160) (-750.664) (-751.372) [-752.869] * (-749.232) (-750.470) [-749.319] (-749.085) -- 0:00:46
323000 -- (-751.561) [-751.341] (-754.385) (-751.574) * [-749.479] (-748.924) (-747.739) (-752.166) -- 0:00:46
323500 -- (-750.848) (-748.540) (-751.782) [-749.983] * (-751.496) (-751.488) [-750.164] (-752.109) -- 0:00:46
324000 -- (-750.042) [-749.913] (-755.678) (-750.166) * [-749.381] (-749.110) (-749.433) (-751.502) -- 0:00:45
324500 -- (-752.041) [-748.870] (-752.366) (-754.015) * (-749.251) (-749.692) [-749.645] (-751.534) -- 0:00:47
325000 -- (-753.390) [-749.054] (-751.149) (-749.651) * (-750.855) [-749.721] (-752.363) (-750.267) -- 0:00:47
Average standard deviation of split frequencies: 0.010213
325500 -- [-751.751] (-749.490) (-750.655) (-749.250) * (-750.668) [-748.564] (-754.560) (-750.782) -- 0:00:47
326000 -- [-748.454] (-754.970) (-749.460) (-750.489) * (-748.341) (-749.071) [-750.784] (-751.586) -- 0:00:47
326500 -- [-748.997] (-750.223) (-749.351) (-749.966) * (-749.484) (-751.316) [-749.605] (-752.179) -- 0:00:47
327000 -- [-750.767] (-749.327) (-754.449) (-750.604) * (-749.349) [-749.819] (-753.004) (-749.794) -- 0:00:47
327500 -- (-748.966) [-748.922] (-751.956) (-752.781) * (-749.066) (-750.028) [-750.781] (-750.054) -- 0:00:47
328000 -- [-748.686] (-752.138) (-750.022) (-751.649) * (-748.820) (-751.196) [-749.258] (-748.461) -- 0:00:47
328500 -- (-752.403) (-748.803) (-750.467) [-750.460] * (-749.180) (-749.230) (-748.621) [-749.256] -- 0:00:47
329000 -- (-749.959) (-750.210) [-747.778] (-749.944) * (-749.304) [-747.945] (-751.426) (-748.616) -- 0:00:46
329500 -- (-748.444) (-750.318) (-749.938) [-751.692] * (-753.160) (-750.795) [-751.561] (-752.917) -- 0:00:46
330000 -- (-749.258) [-748.929] (-750.254) (-748.693) * [-755.757] (-749.380) (-750.184) (-750.391) -- 0:00:46
Average standard deviation of split frequencies: 0.009219
330500 -- (-752.510) (-749.622) [-748.810] (-749.246) * (-753.291) [-750.031] (-748.806) (-750.905) -- 0:00:46
331000 -- (-756.983) (-752.079) [-750.505] (-749.099) * [-749.910] (-750.254) (-749.958) (-750.698) -- 0:00:46
331500 -- (-752.730) (-750.575) (-751.286) [-748.702] * (-748.138) (-751.645) [-749.898] (-751.745) -- 0:00:46
332000 -- (-751.708) (-754.437) (-751.525) [-748.707] * (-750.123) (-749.427) (-749.114) [-750.196] -- 0:00:46
332500 -- (-751.031) (-758.013) (-749.696) [-748.953] * (-749.647) [-749.426] (-752.965) (-751.746) -- 0:00:46
333000 -- [-751.017] (-751.243) (-747.875) (-753.522) * (-752.875) [-748.277] (-750.599) (-750.541) -- 0:00:46
333500 -- (-750.636) (-752.862) (-750.352) [-751.052] * (-754.544) (-749.317) [-756.284] (-749.906) -- 0:00:45
334000 -- (-752.824) (-750.804) [-750.821] (-749.748) * (-748.887) (-749.676) [-749.127] (-751.690) -- 0:00:45
334500 -- (-748.531) [-751.662] (-750.526) (-749.684) * (-748.702) [-750.049] (-749.220) (-754.584) -- 0:00:45
335000 -- (-748.581) (-750.406) (-750.051) [-751.770] * (-749.579) [-748.863] (-748.658) (-751.648) -- 0:00:45
Average standard deviation of split frequencies: 0.008979
335500 -- (-750.328) (-750.798) [-749.652] (-748.872) * [-748.010] (-752.399) (-750.516) (-755.305) -- 0:00:47
336000 -- (-749.855) [-750.090] (-751.018) (-752.620) * [-748.866] (-748.230) (-752.686) (-752.716) -- 0:00:47
336500 -- (-748.425) (-750.827) (-748.396) [-752.043] * [-751.537] (-750.232) (-749.056) (-752.746) -- 0:00:47
337000 -- [-748.237] (-748.735) (-750.331) (-750.200) * (-749.048) [-750.094] (-756.319) (-749.868) -- 0:00:47
337500 -- [-748.308] (-748.840) (-752.047) (-748.644) * (-749.617) (-751.430) [-755.331] (-750.671) -- 0:00:47
338000 -- (-750.318) [-748.190] (-750.940) (-748.939) * (-752.842) [-750.569] (-748.163) (-748.661) -- 0:00:47
338500 -- [-749.067] (-750.008) (-750.697) (-750.461) * [-749.850] (-751.811) (-748.289) (-749.460) -- 0:00:46
339000 -- (-748.796) (-750.054) (-750.286) [-750.388] * [-752.531] (-749.143) (-752.415) (-750.367) -- 0:00:46
339500 -- (-753.134) (-753.374) [-749.970] (-748.194) * (-749.706) (-750.956) [-748.865] (-749.921) -- 0:00:46
340000 -- [-753.480] (-753.307) (-753.799) (-748.796) * (-749.612) (-750.296) [-750.165] (-749.111) -- 0:00:46
Average standard deviation of split frequencies: 0.009963
340500 -- (-753.350) (-751.782) (-752.733) [-749.584] * [-748.739] (-753.197) (-750.529) (-751.718) -- 0:00:46
341000 -- (-750.204) [-750.622] (-752.457) (-748.843) * (-748.667) [-754.041] (-749.173) (-751.538) -- 0:00:46
341500 -- (-750.447) [-749.687] (-753.882) (-755.219) * (-749.308) (-751.881) (-753.414) [-751.563] -- 0:00:46
342000 -- (-750.509) (-749.892) [-750.083] (-751.213) * [-748.427] (-752.466) (-750.241) (-749.711) -- 0:00:46
342500 -- (-754.087) [-749.034] (-748.532) (-750.375) * [-749.868] (-749.607) (-752.978) (-753.393) -- 0:00:46
343000 -- (-749.461) (-749.034) (-750.199) [-749.757] * (-749.944) [-753.300] (-748.212) (-751.595) -- 0:00:45
343500 -- (-750.968) (-751.838) [-749.589] (-752.778) * (-753.282) (-755.398) (-752.485) [-749.024] -- 0:00:45
344000 -- (-748.142) [-750.727] (-750.309) (-753.988) * (-750.867) [-751.666] (-757.901) (-748.460) -- 0:00:45
344500 -- [-751.002] (-751.089) (-751.444) (-750.589) * (-751.293) (-749.143) [-749.658] (-748.314) -- 0:00:45
345000 -- (-749.454) (-751.842) [-751.030] (-751.130) * (-752.442) [-748.992] (-750.360) (-749.256) -- 0:00:45
Average standard deviation of split frequencies: 0.011836
345500 -- (-752.791) [-754.283] (-754.712) (-750.587) * [-748.908] (-748.962) (-750.468) (-748.805) -- 0:00:45
346000 -- (-749.629) [-751.599] (-749.084) (-750.048) * [-749.153] (-747.927) (-748.557) (-749.258) -- 0:00:45
346500 -- (-748.013) (-753.347) (-751.500) [-749.729] * (-751.605) (-749.812) [-749.806] (-752.311) -- 0:00:45
347000 -- (-748.522) [-753.187] (-754.149) (-749.517) * [-750.969] (-751.662) (-749.134) (-757.478) -- 0:00:45
347500 -- (-750.100) [-751.090] (-755.743) (-749.814) * (-753.154) [-752.256] (-748.962) (-747.995) -- 0:00:45
348000 -- (-749.438) (-750.339) [-749.284] (-749.332) * (-751.168) [-749.292] (-749.656) (-757.506) -- 0:00:44
348500 -- (-748.296) (-753.280) (-751.812) [-750.683] * [-751.486] (-752.584) (-752.454) (-751.444) -- 0:00:44
349000 -- (-753.872) [-752.267] (-749.381) (-752.360) * (-749.448) (-749.836) [-749.697] (-748.149) -- 0:00:46
349500 -- (-752.169) (-748.463) [-749.222] (-749.329) * (-750.152) (-748.129) (-752.279) [-752.189] -- 0:00:46
350000 -- (-753.474) [-750.629] (-749.485) (-748.327) * (-750.400) [-748.145] (-749.129) (-748.679) -- 0:00:46
Average standard deviation of split frequencies: 0.012771
350500 -- [-748.819] (-753.934) (-749.835) (-749.601) * (-750.919) (-748.849) (-748.082) [-748.532] -- 0:00:46
351000 -- (-749.301) (-752.041) [-748.829] (-753.546) * (-749.947) (-748.315) [-748.527] (-752.024) -- 0:00:46
351500 -- (-748.381) (-751.419) [-748.672] (-753.615) * (-751.593) [-753.779] (-748.138) (-749.256) -- 0:00:46
352000 -- (-748.809) (-751.783) [-749.841] (-749.475) * [-748.935] (-750.749) (-749.959) (-749.469) -- 0:00:46
352500 -- [-750.701] (-748.872) (-749.278) (-749.704) * (-750.492) (-753.548) (-749.731) [-749.124] -- 0:00:45
353000 -- (-754.700) [-748.363] (-751.026) (-751.299) * [-749.797] (-753.043) (-750.379) (-751.103) -- 0:00:45
353500 -- (-749.934) [-749.719] (-751.588) (-756.057) * [-750.229] (-751.730) (-751.651) (-750.238) -- 0:00:45
354000 -- (-750.406) [-751.566] (-752.658) (-748.895) * (-750.329) (-747.931) [-750.087] (-749.670) -- 0:00:45
354500 -- [-749.818] (-749.414) (-748.666) (-749.924) * (-749.082) (-749.379) (-752.920) [-750.665] -- 0:00:45
355000 -- (-758.154) [-750.591] (-750.990) (-749.786) * (-750.673) (-748.923) [-748.709] (-751.572) -- 0:00:45
Average standard deviation of split frequencies: 0.013738
355500 -- (-751.581) [-749.014] (-749.630) (-752.803) * [-748.167] (-750.548) (-750.257) (-749.097) -- 0:00:45
356000 -- [-749.128] (-749.192) (-750.646) (-748.672) * (-748.678) (-751.215) (-750.661) [-751.942] -- 0:00:45
356500 -- (-753.051) (-751.063) (-752.912) [-749.387] * (-753.404) [-749.091] (-749.320) (-750.972) -- 0:00:45
357000 -- (-753.504) (-748.296) [-749.891] (-752.006) * [-749.069] (-751.383) (-752.943) (-751.656) -- 0:00:45
357500 -- (-750.877) [-749.481] (-753.332) (-754.790) * (-750.006) (-757.813) (-749.518) [-749.440] -- 0:00:44
358000 -- [-750.062] (-748.488) (-748.763) (-748.162) * (-752.037) (-758.401) [-750.108] (-753.365) -- 0:00:44
358500 -- (-751.337) (-750.583) [-750.003] (-752.707) * (-751.488) (-751.807) [-750.020] (-751.504) -- 0:00:44
359000 -- (-748.605) (-750.030) [-750.375] (-750.966) * (-751.626) [-749.905] (-755.993) (-753.289) -- 0:00:44
359500 -- [-753.777] (-750.830) (-750.303) (-749.858) * (-750.363) (-749.710) (-754.620) [-748.559] -- 0:00:44
360000 -- (-748.519) [-749.137] (-748.192) (-750.308) * (-752.999) (-751.396) [-753.441] (-748.542) -- 0:00:44
Average standard deviation of split frequencies: 0.014132
360500 -- (-749.144) [-749.261] (-749.627) (-750.295) * (-750.418) (-753.723) (-749.096) [-748.119] -- 0:00:44
361000 -- (-749.559) (-750.494) [-753.439] (-750.240) * (-749.926) (-750.218) [-753.201] (-749.546) -- 0:00:44
361500 -- (-749.787) (-750.342) (-749.084) [-749.345] * [-748.955] (-750.570) (-750.567) (-751.694) -- 0:00:44
362000 -- (-749.365) (-748.652) (-749.024) [-748.697] * [-748.780] (-749.977) (-752.342) (-751.630) -- 0:00:44
362500 -- (-752.949) [-748.911] (-749.676) (-749.144) * (-748.638) (-749.336) [-750.772] (-748.942) -- 0:00:43
363000 -- (-748.871) [-750.895] (-750.554) (-749.211) * (-750.158) [-749.203] (-751.132) (-749.560) -- 0:00:43
363500 -- (-754.842) [-750.153] (-751.362) (-749.472) * (-751.332) (-749.757) (-751.120) [-748.684] -- 0:00:43
364000 -- [-750.232] (-748.513) (-750.552) (-748.815) * (-748.597) (-750.819) [-751.156] (-748.567) -- 0:00:43
364500 -- (-753.343) (-749.273) (-751.221) [-748.002] * (-749.619) [-752.407] (-748.828) (-750.694) -- 0:00:43
365000 -- (-750.348) (-747.824) [-751.979] (-748.952) * (-750.984) (-750.709) [-748.953] (-751.813) -- 0:00:45
Average standard deviation of split frequencies: 0.014016
365500 -- [-754.031] (-753.626) (-757.657) (-751.705) * (-749.433) [-750.156] (-749.932) (-750.334) -- 0:00:45
366000 -- [-749.442] (-750.271) (-752.264) (-748.709) * (-751.263) (-750.162) [-751.493] (-749.314) -- 0:00:45
366500 -- (-753.986) [-747.962] (-756.448) (-749.425) * (-751.433) (-755.627) [-749.275] (-748.901) -- 0:00:44
367000 -- (-752.500) [-749.162] (-753.506) (-752.352) * [-750.044] (-749.079) (-751.477) (-750.221) -- 0:00:44
367500 -- (-749.712) (-750.705) (-750.770) [-749.710] * (-751.674) (-748.359) [-748.532] (-749.796) -- 0:00:44
368000 -- [-749.485] (-751.845) (-753.560) (-754.950) * [-749.974] (-747.739) (-749.664) (-749.289) -- 0:00:44
368500 -- [-749.229] (-750.120) (-750.737) (-749.624) * (-752.393) (-750.117) [-750.036] (-752.664) -- 0:00:44
369000 -- (-748.684) [-750.783] (-750.899) (-748.273) * [-749.184] (-749.283) (-748.621) (-749.419) -- 0:00:44
369500 -- (-748.937) [-748.740] (-751.850) (-754.143) * (-749.037) (-749.682) [-748.576] (-749.538) -- 0:00:44
370000 -- (-751.844) [-752.029] (-751.400) (-749.410) * (-749.245) (-751.225) (-748.492) [-748.567] -- 0:00:44
Average standard deviation of split frequencies: 0.013690
370500 -- (-751.176) (-752.498) (-750.580) [-749.365] * (-749.667) (-750.103) [-748.709] (-752.140) -- 0:00:44
371000 -- (-756.102) (-752.892) (-749.412) [-749.848] * (-749.732) [-748.410] (-748.637) (-750.777) -- 0:00:44
371500 -- (-755.071) (-753.133) [-749.726] (-751.027) * (-751.274) [-754.015] (-749.950) (-751.253) -- 0:00:43
372000 -- (-755.470) (-748.905) (-747.967) [-750.147] * [-748.834] (-750.024) (-749.186) (-749.438) -- 0:00:43
372500 -- (-750.670) (-753.939) (-748.082) [-752.359] * (-749.281) (-750.162) (-749.179) [-748.462] -- 0:00:43
373000 -- (-749.510) (-749.381) (-753.197) [-748.758] * (-749.599) (-750.153) [-751.353] (-747.967) -- 0:00:43
373500 -- (-749.651) [-752.112] (-751.710) (-751.109) * (-750.409) (-748.627) [-749.136] (-748.836) -- 0:00:43
374000 -- (-750.398) [-751.854] (-751.000) (-756.242) * (-749.875) (-749.084) (-752.559) [-749.511] -- 0:00:43
374500 -- (-749.492) (-750.425) (-751.898) [-750.885] * (-749.582) (-748.829) [-750.130] (-748.803) -- 0:00:43
375000 -- (-750.024) (-752.032) (-750.750) [-748.779] * (-748.822) (-749.587) (-751.776) [-750.137] -- 0:00:43
Average standard deviation of split frequencies: 0.013634
375500 -- (-750.677) (-753.170) (-749.614) [-749.750] * (-754.793) [-748.401] (-749.168) (-750.640) -- 0:00:43
376000 -- (-752.082) [-753.384] (-748.369) (-750.835) * [-751.172] (-749.848) (-752.007) (-753.128) -- 0:00:43
376500 -- (-749.569) (-752.980) [-751.317] (-748.763) * [-753.901] (-748.677) (-751.077) (-747.888) -- 0:00:43
377000 -- [-749.632] (-748.418) (-754.134) (-748.522) * (-755.805) (-748.484) [-749.558] (-750.145) -- 0:00:42
377500 -- (-752.381) (-748.594) (-757.927) [-748.918] * [-751.565] (-748.504) (-750.944) (-750.695) -- 0:00:42
378000 -- [-749.639] (-751.583) (-752.536) (-749.633) * (-750.659) [-749.862] (-749.094) (-748.953) -- 0:00:42
378500 -- (-749.698) (-751.612) [-749.366] (-752.567) * (-751.070) (-752.832) (-748.542) [-749.618] -- 0:00:42
379000 -- [-753.797] (-760.680) (-748.941) (-752.360) * (-749.014) [-749.907] (-748.911) (-748.837) -- 0:00:42
379500 -- [-750.932] (-749.538) (-749.508) (-751.512) * (-749.011) (-750.239) (-748.260) [-748.799] -- 0:00:42
380000 -- (-749.153) (-750.481) [-750.367] (-748.506) * [-749.262] (-750.704) (-749.452) (-749.612) -- 0:00:42
Average standard deviation of split frequencies: 0.013913
380500 -- [-749.011] (-749.041) (-748.373) (-748.714) * (-753.055) (-752.167) [-751.000] (-749.455) -- 0:00:42
381000 -- (-750.262) [-749.938] (-748.931) (-748.741) * (-751.854) [-749.528] (-756.578) (-753.127) -- 0:00:42
381500 -- [-749.667] (-749.942) (-749.164) (-756.791) * (-749.410) (-750.743) [-756.071] (-752.968) -- 0:00:43
382000 -- [-748.483] (-750.251) (-751.175) (-749.972) * (-751.464) [-751.828] (-750.927) (-749.063) -- 0:00:43
382500 -- (-751.066) (-750.486) (-756.722) [-749.939] * [-749.440] (-752.497) (-749.467) (-748.372) -- 0:00:43
383000 -- (-753.484) (-750.589) [-749.120] (-751.920) * [-749.225] (-751.284) (-751.266) (-749.735) -- 0:00:43
383500 -- (-753.533) (-751.078) [-748.896] (-753.314) * (-748.899) [-749.454] (-750.790) (-751.445) -- 0:00:43
384000 -- [-749.300] (-750.346) (-749.950) (-752.401) * (-752.893) (-749.774) [-749.111] (-752.360) -- 0:00:43
384500 -- (-749.891) [-753.147] (-752.904) (-748.449) * (-753.719) (-748.754) (-750.164) [-749.627] -- 0:00:43
385000 -- (-751.428) (-750.005) (-750.838) [-749.077] * (-752.451) [-751.159] (-750.951) (-751.997) -- 0:00:43
Average standard deviation of split frequencies: 0.014296
385500 -- (-751.299) [-750.951] (-751.776) (-750.235) * (-748.094) (-751.999) (-750.179) [-749.195] -- 0:00:43
386000 -- [-750.895] (-750.616) (-750.385) (-751.054) * (-749.089) (-749.837) [-749.118] (-750.275) -- 0:00:42
386500 -- [-748.264] (-749.262) (-751.560) (-749.294) * (-749.369) (-752.293) [-748.865] (-749.854) -- 0:00:42
387000 -- [-748.507] (-750.575) (-751.712) (-748.460) * (-749.342) [-752.333] (-750.543) (-753.149) -- 0:00:42
387500 -- (-749.079) (-752.984) [-751.722] (-753.201) * (-749.859) [-750.086] (-748.139) (-750.625) -- 0:00:42
388000 -- (-753.161) (-749.965) [-751.927] (-749.214) * (-751.912) (-750.456) [-751.566] (-756.207) -- 0:00:42
388500 -- [-751.488] (-750.391) (-750.666) (-750.051) * [-752.122] (-751.735) (-748.566) (-753.272) -- 0:00:42
389000 -- (-748.910) (-750.466) (-749.155) [-751.799] * (-750.562) [-749.661] (-748.702) (-748.350) -- 0:00:42
389500 -- (-755.042) (-755.784) [-748.709] (-751.719) * (-750.391) (-752.636) [-749.070] (-748.534) -- 0:00:42
390000 -- (-751.667) (-751.118) [-749.957] (-750.379) * (-755.283) [-749.836] (-750.348) (-749.811) -- 0:00:42
Average standard deviation of split frequencies: 0.014125
390500 -- (-749.808) (-750.627) [-747.723] (-751.199) * [-751.374] (-750.222) (-749.681) (-750.061) -- 0:00:42
391000 -- [-750.821] (-751.282) (-747.919) (-749.254) * (-749.203) (-750.222) (-750.773) [-749.795] -- 0:00:42
391500 -- (-751.866) [-750.342] (-753.978) (-750.319) * (-749.968) (-748.024) (-749.963) [-749.701] -- 0:00:41
392000 -- (-749.372) (-755.421) [-749.093] (-750.591) * (-750.714) (-748.847) (-749.732) [-748.063] -- 0:00:41
392500 -- (-751.539) [-752.376] (-751.143) (-749.528) * (-750.631) (-753.346) [-749.360] (-749.510) -- 0:00:41
393000 -- (-751.236) [-750.095] (-750.970) (-752.207) * [-751.625] (-757.115) (-751.469) (-753.180) -- 0:00:41
393500 -- (-750.342) (-751.918) [-749.976] (-748.643) * (-750.003) [-750.546] (-750.111) (-750.461) -- 0:00:41
394000 -- (-751.448) (-748.587) (-751.402) [-748.466] * (-752.696) [-749.844] (-751.298) (-748.665) -- 0:00:41
394500 -- (-750.114) [-750.862] (-751.342) (-748.485) * [-752.024] (-752.035) (-750.114) (-750.208) -- 0:00:41
395000 -- [-752.538] (-750.727) (-753.280) (-752.433) * (-753.941) (-753.363) (-752.574) [-751.649] -- 0:00:41
Average standard deviation of split frequencies: 0.014075
395500 -- (-750.380) [-752.322] (-749.340) (-753.016) * (-749.907) (-752.113) [-751.834] (-750.310) -- 0:00:41
396000 -- (-752.046) (-750.093) (-750.045) [-753.086] * (-749.498) [-751.174] (-750.648) (-749.970) -- 0:00:41
396500 -- (-753.512) (-748.283) [-750.303] (-750.179) * (-749.525) (-749.713) (-751.932) [-749.647] -- 0:00:41
397000 -- (-751.437) (-750.170) [-750.396] (-752.447) * (-749.983) (-748.990) (-754.578) [-750.219] -- 0:00:41
397500 -- [-750.259] (-750.032) (-752.230) (-750.742) * (-748.613) (-751.695) (-751.168) [-750.962] -- 0:00:40
398000 -- (-749.896) (-750.663) (-754.098) [-754.039] * (-749.695) [-749.579] (-751.224) (-748.080) -- 0:00:42
398500 -- (-748.607) (-753.288) [-749.872] (-752.608) * [-748.712] (-750.797) (-751.347) (-749.223) -- 0:00:42
399000 -- (-751.995) (-749.158) (-751.062) [-750.457] * (-749.864) (-753.252) (-749.175) [-751.267] -- 0:00:42
399500 -- (-749.365) (-751.260) [-750.830] (-748.989) * (-751.107) [-754.147] (-751.265) (-749.011) -- 0:00:42
400000 -- (-749.323) (-752.233) (-751.153) [-751.950] * (-749.435) (-749.995) (-752.557) [-749.033] -- 0:00:41
Average standard deviation of split frequencies: 0.014560
400500 -- (-748.554) (-751.659) (-749.766) [-749.873] * (-748.121) (-749.971) (-753.753) [-750.573] -- 0:00:41
401000 -- [-752.058] (-750.221) (-748.866) (-753.633) * (-749.967) (-747.948) (-754.852) [-749.536] -- 0:00:41
401500 -- (-754.708) (-749.335) (-749.939) [-749.846] * (-753.041) [-749.887] (-749.267) (-748.124) -- 0:00:41
402000 -- (-749.780) [-749.885] (-749.924) (-749.932) * [-750.040] (-750.643) (-755.501) (-749.777) -- 0:00:41
402500 -- [-749.846] (-749.676) (-755.135) (-750.273) * (-751.032) (-752.225) (-751.618) [-750.131] -- 0:00:41
403000 -- (-748.298) [-749.619] (-749.501) (-751.222) * (-749.421) (-752.683) (-751.057) [-749.733] -- 0:00:41
403500 -- (-748.930) (-749.958) (-750.148) [-748.851] * (-750.752) (-749.030) (-753.058) [-748.039] -- 0:00:41
404000 -- [-749.721] (-752.890) (-752.431) (-755.286) * (-748.110) (-753.803) (-748.839) [-748.326] -- 0:00:41
404500 -- (-751.008) [-748.272] (-749.206) (-749.960) * (-753.666) [-748.127] (-754.326) (-748.328) -- 0:00:41
405000 -- (-750.430) [-747.997] (-749.299) (-749.090) * (-748.965) (-751.498) (-752.132) [-749.525] -- 0:00:41
Average standard deviation of split frequencies: 0.013592
405500 -- (-749.906) [-751.448] (-748.409) (-748.730) * (-754.557) (-759.451) [-751.712] (-748.587) -- 0:00:41
406000 -- (-749.816) (-752.297) [-749.710] (-749.113) * [-748.884] (-751.734) (-751.970) (-750.162) -- 0:00:40
406500 -- (-749.968) (-748.663) (-750.559) [-749.073] * (-759.237) [-749.622] (-749.675) (-750.208) -- 0:00:40
407000 -- (-750.199) (-750.576) (-751.527) [-748.468] * [-749.174] (-750.492) (-752.491) (-750.821) -- 0:00:40
407500 -- (-749.725) (-749.775) (-755.419) [-750.284] * [-749.870] (-748.754) (-752.703) (-748.559) -- 0:00:40
408000 -- (-749.964) (-751.557) (-752.466) [-752.342] * [-748.545] (-749.832) (-751.489) (-751.011) -- 0:00:40
408500 -- (-752.023) (-750.965) (-753.428) [-750.750] * (-748.884) (-749.686) (-749.940) [-752.408] -- 0:00:40
409000 -- (-750.610) (-750.427) [-750.989] (-749.578) * (-749.935) [-752.040] (-748.950) (-748.393) -- 0:00:40
409500 -- (-748.385) [-750.037] (-750.856) (-753.027) * (-749.330) (-751.950) (-749.495) [-748.203] -- 0:00:40
410000 -- [-749.695] (-749.412) (-755.219) (-749.919) * (-749.718) (-754.568) [-751.709] (-754.970) -- 0:00:40
Average standard deviation of split frequencies: 0.014653
410500 -- (-751.364) [-749.705] (-754.082) (-750.377) * [-749.073] (-756.107) (-751.722) (-754.498) -- 0:00:40
411000 -- (-750.647) (-749.867) (-750.865) [-748.534] * [-748.730] (-750.926) (-748.084) (-748.698) -- 0:00:40
411500 -- [-749.131] (-752.840) (-749.584) (-750.528) * (-750.177) (-752.274) (-748.532) [-748.767] -- 0:00:40
412000 -- (-749.799) (-754.132) (-749.463) [-752.011] * (-758.560) [-748.363] (-749.573) (-748.992) -- 0:00:39
412500 -- (-748.514) [-749.640] (-748.922) (-749.199) * (-752.642) [-750.305] (-751.031) (-750.522) -- 0:00:39
413000 -- [-748.282] (-748.340) (-750.350) (-752.486) * (-749.516) [-748.391] (-748.814) (-751.866) -- 0:00:39
413500 -- (-748.501) [-748.249] (-748.961) (-751.194) * [-749.104] (-748.006) (-752.329) (-749.514) -- 0:00:39
414000 -- (-749.394) (-752.718) [-752.121] (-748.884) * [-751.261] (-753.505) (-759.831) (-753.678) -- 0:00:39
414500 -- (-749.984) (-749.822) (-750.512) [-750.624] * (-751.310) (-752.110) [-748.438] (-751.815) -- 0:00:40
415000 -- [-748.103] (-748.098) (-750.271) (-751.135) * (-750.589) [-750.684] (-751.077) (-750.527) -- 0:00:40
Average standard deviation of split frequencies: 0.014198
415500 -- (-748.405) (-750.518) [-749.031] (-752.447) * (-750.810) [-749.684] (-748.646) (-750.129) -- 0:00:40
416000 -- [-748.326] (-750.056) (-753.709) (-749.125) * (-750.784) [-750.495] (-748.766) (-747.863) -- 0:00:40
416500 -- [-749.966] (-752.764) (-752.746) (-749.288) * (-752.791) (-749.818) (-754.201) [-751.212] -- 0:00:40
417000 -- [-748.716] (-749.489) (-748.895) (-751.775) * (-748.898) (-749.086) (-751.524) [-749.786] -- 0:00:40
417500 -- (-749.769) (-750.835) (-750.632) [-751.819] * [-749.237] (-748.935) (-750.939) (-750.623) -- 0:00:40
418000 -- (-750.585) (-749.389) [-748.689] (-751.211) * [-752.270] (-748.505) (-752.437) (-750.705) -- 0:00:40
418500 -- (-751.113) [-748.051] (-748.771) (-749.950) * (-749.267) (-750.313) [-750.940] (-749.179) -- 0:00:40
419000 -- (-749.460) [-751.669] (-751.123) (-753.021) * (-751.934) (-749.598) (-751.204) [-750.358] -- 0:00:40
419500 -- [-749.562] (-749.505) (-750.741) (-749.627) * [-749.341] (-749.025) (-751.877) (-749.596) -- 0:00:40
420000 -- (-748.539) (-748.427) [-750.766] (-748.880) * (-747.997) (-750.719) (-752.405) [-749.434] -- 0:00:40
Average standard deviation of split frequencies: 0.013307
420500 -- (-748.392) (-748.304) [-751.565] (-750.351) * (-750.187) (-751.130) (-755.335) [-748.439] -- 0:00:39
421000 -- (-748.577) (-750.624) (-749.963) [-750.823] * [-749.756] (-749.834) (-758.882) (-752.100) -- 0:00:39
421500 -- (-748.573) [-750.043] (-753.534) (-756.317) * (-752.044) (-748.991) [-753.881] (-753.664) -- 0:00:39
422000 -- (-750.854) (-755.301) (-751.853) [-748.306] * (-752.296) (-748.567) [-751.038] (-748.464) -- 0:00:39
422500 -- (-749.675) (-748.890) (-750.739) [-750.388] * (-749.710) [-748.568] (-749.803) (-751.015) -- 0:00:39
423000 -- [-749.207] (-749.538) (-748.223) (-749.003) * (-753.015) (-749.112) [-750.426] (-751.556) -- 0:00:39
423500 -- [-748.224] (-748.692) (-749.116) (-749.320) * (-751.868) (-749.485) (-749.995) [-752.229] -- 0:00:39
424000 -- (-748.670) (-750.993) (-749.737) [-748.664] * (-755.085) (-749.164) (-749.114) [-752.831] -- 0:00:39
424500 -- (-748.847) (-748.475) [-748.677] (-752.777) * (-748.949) (-748.431) [-748.819] (-753.833) -- 0:00:39
425000 -- (-748.441) (-748.616) [-748.532] (-751.652) * (-749.701) (-751.428) (-752.441) [-748.531] -- 0:00:39
Average standard deviation of split frequencies: 0.012795
425500 -- (-750.111) [-748.326] (-749.465) (-749.869) * (-752.119) [-748.413] (-748.546) (-750.808) -- 0:00:39
426000 -- (-752.753) [-752.198] (-749.416) (-752.196) * (-749.457) (-748.414) (-750.274) [-750.666] -- 0:00:39
426500 -- (-750.662) (-751.648) [-748.465] (-755.079) * (-748.522) (-750.708) [-749.166] (-752.043) -- 0:00:38
427000 -- (-751.827) [-748.314] (-750.570) (-749.492) * (-749.060) [-751.433] (-748.414) (-753.203) -- 0:00:38
427500 -- (-752.055) [-749.250] (-752.459) (-753.570) * (-748.991) [-750.035] (-749.993) (-749.470) -- 0:00:38
428000 -- (-749.789) [-755.709] (-750.430) (-754.503) * [-750.303] (-748.803) (-749.442) (-750.618) -- 0:00:38
428500 -- (-750.495) [-749.433] (-752.760) (-750.954) * (-749.547) (-748.108) [-750.010] (-754.732) -- 0:00:38
429000 -- [-748.529] (-751.112) (-749.373) (-750.769) * (-750.711) (-751.335) (-750.393) [-748.009] -- 0:00:38
429500 -- (-749.160) (-751.170) [-751.698] (-749.382) * (-750.555) (-751.267) [-750.060] (-748.506) -- 0:00:38
430000 -- (-748.528) (-752.437) [-749.537] (-752.770) * (-752.255) (-753.635) (-749.950) [-748.307] -- 0:00:38
Average standard deviation of split frequencies: 0.013067
430500 -- (-750.885) (-755.181) (-749.550) [-749.678] * [-748.455] (-751.444) (-748.802) (-753.008) -- 0:00:39
431000 -- (-750.543) (-752.819) [-749.451] (-750.306) * (-748.779) (-750.032) [-748.707] (-749.750) -- 0:00:39
431500 -- [-749.074] (-749.214) (-749.424) (-755.665) * (-749.305) [-748.482] (-749.680) (-752.046) -- 0:00:39
432000 -- (-751.216) (-748.497) [-756.388] (-752.042) * (-750.053) (-750.440) (-750.420) [-752.159] -- 0:00:39
432500 -- (-750.666) (-750.487) (-751.945) [-749.250] * [-748.588] (-750.292) (-748.502) (-750.678) -- 0:00:39
433000 -- [-750.049] (-749.200) (-754.378) (-749.001) * (-749.414) (-751.319) [-752.836] (-749.466) -- 0:00:39
433500 -- (-751.153) (-750.794) (-749.505) [-748.196] * (-749.359) (-749.118) (-751.444) [-750.392] -- 0:00:39
434000 -- (-749.555) (-748.496) [-749.913] (-749.898) * (-749.152) [-751.900] (-749.922) (-750.428) -- 0:00:39
434500 -- (-748.440) (-748.725) (-750.209) [-750.351] * [-750.261] (-748.055) (-751.641) (-754.071) -- 0:00:39
435000 -- [-752.455] (-754.977) (-749.021) (-748.103) * (-748.105) [-748.953] (-752.014) (-750.788) -- 0:00:38
Average standard deviation of split frequencies: 0.013102
435500 -- (-756.655) [-752.908] (-750.511) (-752.477) * [-748.739] (-754.241) (-748.596) (-749.570) -- 0:00:38
436000 -- (-749.288) (-750.860) (-750.105) [-749.781] * [-749.059] (-749.968) (-750.442) (-748.908) -- 0:00:38
436500 -- (-752.166) [-750.428] (-750.336) (-749.925) * (-748.201) [-749.350] (-750.274) (-750.551) -- 0:00:38
437000 -- (-750.911) (-750.107) [-748.967] (-748.690) * (-749.931) [-753.301] (-754.112) (-750.314) -- 0:00:38
437500 -- (-751.567) (-750.471) [-748.694] (-748.943) * (-749.189) (-752.012) [-752.778] (-750.189) -- 0:00:38
438000 -- (-748.770) [-749.504] (-748.862) (-749.232) * (-750.903) [-749.592] (-751.997) (-751.810) -- 0:00:38
438500 -- [-748.946] (-748.521) (-750.269) (-750.288) * (-751.143) [-748.545] (-750.480) (-749.642) -- 0:00:38
439000 -- (-749.100) (-749.020) [-752.372] (-749.720) * (-753.946) (-749.584) [-755.441] (-749.387) -- 0:00:38
439500 -- [-750.974] (-750.074) (-755.450) (-749.589) * (-750.981) (-748.910) [-750.223] (-749.386) -- 0:00:38
440000 -- [-749.434] (-751.797) (-753.265) (-748.982) * (-754.633) (-749.618) (-752.864) [-750.851] -- 0:00:38
Average standard deviation of split frequencies: 0.012711
440500 -- [-748.132] (-752.401) (-756.326) (-750.260) * [-752.615] (-750.477) (-749.139) (-749.734) -- 0:00:38
441000 -- (-751.175) (-753.013) [-749.785] (-751.656) * [-751.357] (-751.273) (-751.621) (-748.270) -- 0:00:38
441500 -- (-749.106) (-748.556) [-748.187] (-749.475) * (-750.719) (-753.709) (-751.476) [-749.773] -- 0:00:37
442000 -- (-753.118) [-748.377] (-749.104) (-749.497) * (-749.521) (-753.043) (-748.588) [-748.852] -- 0:00:37
442500 -- (-755.001) (-749.914) (-748.120) [-748.193] * (-750.638) (-750.458) (-749.299) [-749.710] -- 0:00:37
443000 -- (-749.317) (-751.592) [-753.279] (-748.575) * (-749.419) [-749.979] (-749.126) (-750.389) -- 0:00:37
443500 -- [-748.872] (-752.118) (-751.080) (-750.817) * (-752.344) [-748.773] (-749.944) (-752.376) -- 0:00:37
444000 -- (-750.042) (-749.830) (-751.493) [-749.031] * (-750.092) (-748.212) [-748.060] (-751.607) -- 0:00:37
444500 -- (-748.002) (-752.411) [-749.765] (-749.562) * (-748.799) (-751.973) (-749.989) [-752.776] -- 0:00:37
445000 -- (-749.270) (-751.758) [-750.592] (-751.310) * (-751.505) [-749.079] (-751.649) (-753.551) -- 0:00:37
Average standard deviation of split frequencies: 0.012435
445500 -- (-750.450) (-751.546) [-750.071] (-750.172) * (-751.183) [-749.449] (-750.420) (-754.049) -- 0:00:37
446000 -- (-749.760) [-749.975] (-751.912) (-750.150) * (-750.748) (-754.258) (-753.493) [-749.992] -- 0:00:37
446500 -- [-750.827] (-751.524) (-749.786) (-747.917) * (-749.020) (-748.868) [-749.309] (-750.018) -- 0:00:37
447000 -- [-749.855] (-751.554) (-748.114) (-752.086) * [-748.969] (-747.951) (-751.177) (-748.156) -- 0:00:38
447500 -- [-748.962] (-750.909) (-750.724) (-753.000) * (-748.469) (-748.738) [-749.513] (-748.585) -- 0:00:38
448000 -- [-752.389] (-749.787) (-753.232) (-750.618) * [-748.982] (-748.754) (-749.869) (-748.741) -- 0:00:38
448500 -- (-752.109) [-749.112] (-752.603) (-750.324) * (-751.365) [-755.779] (-748.621) (-755.543) -- 0:00:38
449000 -- (-750.235) (-749.112) [-750.552] (-748.295) * (-751.100) (-753.387) [-750.223] (-750.127) -- 0:00:38
449500 -- (-753.105) [-749.694] (-753.114) (-751.956) * [-753.604] (-751.842) (-749.809) (-749.055) -- 0:00:37
450000 -- [-748.606] (-748.596) (-750.961) (-752.484) * (-751.851) (-751.146) [-749.819] (-749.265) -- 0:00:37
Average standard deviation of split frequencies: 0.012356
450500 -- (-748.374) (-750.916) (-751.832) [-749.279] * [-752.909] (-752.801) (-752.776) (-751.170) -- 0:00:37
451000 -- (-751.091) [-750.106] (-749.866) (-748.640) * (-749.720) (-751.167) (-748.118) [-750.900] -- 0:00:37
451500 -- (-753.345) [-749.199] (-751.393) (-750.361) * (-748.274) [-752.598] (-748.100) (-749.936) -- 0:00:37
452000 -- (-749.384) [-748.669] (-753.311) (-749.642) * (-749.649) (-749.192) (-749.844) [-749.364] -- 0:00:37
452500 -- (-749.875) (-748.243) [-750.558] (-754.587) * (-752.042) [-754.263] (-748.833) (-751.946) -- 0:00:37
453000 -- [-748.488] (-749.973) (-748.443) (-748.990) * (-752.090) (-756.185) [-748.828] (-749.103) -- 0:00:37
453500 -- [-748.922] (-749.496) (-749.385) (-751.846) * (-750.527) [-748.973] (-752.876) (-750.918) -- 0:00:37
454000 -- [-751.468] (-752.041) (-752.867) (-748.288) * [-748.346] (-751.117) (-748.513) (-749.469) -- 0:00:37
454500 -- (-752.342) (-751.639) (-748.386) [-749.246] * (-749.491) (-751.758) (-748.447) [-750.784] -- 0:00:37
455000 -- (-751.863) (-751.588) (-748.702) [-751.767] * (-752.398) (-748.155) (-749.910) [-749.518] -- 0:00:37
Average standard deviation of split frequencies: 0.013051
455500 -- (-748.096) (-750.784) (-748.598) [-748.648] * (-749.122) (-748.843) [-750.029] (-748.948) -- 0:00:37
456000 -- [-748.669] (-750.888) (-749.935) (-751.194) * [-749.228] (-748.462) (-749.550) (-750.168) -- 0:00:36
456500 -- (-750.077) (-751.350) [-749.262] (-751.037) * (-758.272) (-752.024) [-750.524] (-750.048) -- 0:00:36
457000 -- (-754.565) (-749.177) [-756.783] (-749.349) * [-749.794] (-749.342) (-749.261) (-749.999) -- 0:00:36
457500 -- (-752.060) (-749.715) (-755.822) [-750.504] * [-748.583] (-750.602) (-751.725) (-748.795) -- 0:00:36
458000 -- (-749.214) [-748.480] (-750.926) (-749.662) * (-750.293) (-751.073) (-748.734) [-751.429] -- 0:00:36
458500 -- (-752.035) (-749.670) (-751.348) [-752.626] * (-751.590) (-748.299) [-752.316] (-749.974) -- 0:00:36
459000 -- (-748.293) (-749.324) (-751.460) [-750.275] * (-751.336) [-749.677] (-750.825) (-748.826) -- 0:00:36
459500 -- (-753.205) (-751.977) (-755.282) [-748.702] * [-749.020] (-751.620) (-749.660) (-752.144) -- 0:00:36
460000 -- (-749.162) (-754.652) (-761.202) [-748.672] * (-750.614) (-752.994) (-753.321) [-749.912] -- 0:00:36
Average standard deviation of split frequencies: 0.013111
460500 -- (-748.847) (-748.310) [-752.635] (-749.920) * (-750.501) (-755.369) (-752.438) [-748.301] -- 0:00:36
461000 -- (-752.156) (-750.802) [-751.562] (-751.359) * (-748.828) (-749.955) (-753.440) [-750.051] -- 0:00:36
461500 -- (-750.154) (-751.165) (-753.058) [-749.933] * [-749.649] (-749.551) (-749.807) (-751.242) -- 0:00:36
462000 -- (-750.445) [-749.894] (-752.706) (-749.675) * (-755.135) (-749.644) (-749.976) [-751.302] -- 0:00:36
462500 -- [-751.979] (-751.511) (-751.662) (-748.982) * [-750.721] (-749.941) (-748.467) (-750.319) -- 0:00:36
463000 -- (-749.776) [-748.835] (-755.377) (-749.917) * (-751.968) (-750.019) (-749.413) [-750.874] -- 0:00:35
463500 -- (-753.402) (-750.357) (-751.471) [-749.303] * (-755.619) (-748.387) (-749.449) [-748.875] -- 0:00:37
464000 -- (-751.362) (-748.713) (-749.471) [-751.571] * (-753.910) [-750.456] (-751.693) (-750.603) -- 0:00:36
464500 -- [-750.023] (-748.756) (-751.820) (-749.956) * (-751.124) (-753.234) [-748.704] (-748.474) -- 0:00:36
465000 -- [-749.343] (-749.578) (-753.415) (-749.519) * (-748.487) (-752.945) [-748.057] (-751.668) -- 0:00:36
Average standard deviation of split frequencies: 0.013404
465500 -- (-750.873) [-749.324] (-750.695) (-752.123) * (-747.987) (-751.012) [-752.112] (-752.591) -- 0:00:36
466000 -- (-752.397) [-750.246] (-751.130) (-753.993) * (-748.304) [-752.325] (-750.012) (-749.893) -- 0:00:36
466500 -- (-747.854) [-748.678] (-754.462) (-751.647) * (-749.066) [-748.766] (-750.574) (-749.278) -- 0:00:36
467000 -- [-749.796] (-750.416) (-751.038) (-750.593) * (-750.230) [-748.603] (-754.639) (-750.226) -- 0:00:36
467500 -- (-749.542) (-750.655) [-750.574] (-750.721) * (-750.827) (-750.518) (-749.241) [-752.538] -- 0:00:36
468000 -- (-749.579) (-754.225) (-750.714) [-749.471] * (-750.229) (-749.802) [-750.393] (-753.265) -- 0:00:36
468500 -- [-749.573] (-752.624) (-750.869) (-748.151) * (-750.209) [-749.945] (-752.577) (-751.767) -- 0:00:36
469000 -- [-748.666] (-749.869) (-749.331) (-749.362) * (-751.324) (-749.137) [-748.591] (-751.817) -- 0:00:36
469500 -- (-749.677) (-750.476) [-749.894] (-752.584) * (-752.277) [-749.602] (-749.832) (-751.023) -- 0:00:36
470000 -- (-749.961) (-748.428) [-753.094] (-751.654) * (-750.383) (-753.388) (-751.922) [-749.897] -- 0:00:36
Average standard deviation of split frequencies: 0.013396
470500 -- (-750.812) (-748.707) [-749.475] (-749.292) * (-750.199) (-754.152) [-748.891] (-750.672) -- 0:00:36
471000 -- (-751.611) (-751.645) [-749.272] (-751.574) * (-749.745) [-749.280] (-754.135) (-749.067) -- 0:00:35
471500 -- (-752.495) (-748.908) [-749.867] (-749.698) * (-747.924) (-752.565) [-751.925] (-750.114) -- 0:00:35
472000 -- (-750.916) [-748.400] (-751.499) (-750.680) * (-752.470) [-751.564] (-753.410) (-750.794) -- 0:00:35
472500 -- (-756.011) (-751.724) (-756.189) [-751.516] * (-750.565) (-748.819) (-753.076) [-748.824] -- 0:00:35
473000 -- [-750.543] (-750.654) (-752.693) (-752.542) * (-752.550) (-749.907) (-751.913) [-750.952] -- 0:00:35
473500 -- (-751.831) [-752.155] (-754.438) (-752.319) * (-751.160) (-750.843) (-749.968) [-750.904] -- 0:00:35
474000 -- (-748.970) (-752.373) (-751.682) [-750.301] * [-750.217] (-755.877) (-749.908) (-749.667) -- 0:00:35
474500 -- (-753.942) [-748.690] (-750.712) (-748.238) * (-749.093) [-748.743] (-749.853) (-752.250) -- 0:00:35
475000 -- (-748.675) [-748.419] (-751.133) (-750.138) * [-748.990] (-750.737) (-749.614) (-748.466) -- 0:00:35
Average standard deviation of split frequencies: 0.013370
475500 -- (-749.658) (-749.524) (-748.589) [-750.173] * [-753.646] (-750.832) (-750.855) (-750.022) -- 0:00:35
476000 -- [-751.746] (-749.262) (-750.546) (-757.852) * (-751.957) (-750.983) (-751.448) [-749.381] -- 0:00:35
476500 -- (-749.251) (-750.798) (-748.767) [-749.802] * (-750.693) (-748.259) (-752.058) [-750.641] -- 0:00:35
477000 -- (-749.874) (-750.752) [-751.272] (-750.687) * [-748.859] (-750.755) (-749.810) (-749.488) -- 0:00:35
477500 -- (-749.699) (-751.262) [-749.456] (-749.487) * (-749.996) (-751.752) (-750.397) [-748.971] -- 0:00:35
478000 -- (-750.141) (-748.546) [-749.397] (-754.628) * [-750.837] (-749.116) (-749.456) (-750.589) -- 0:00:34
478500 -- (-749.817) (-748.698) [-748.895] (-753.788) * (-749.286) [-748.742] (-748.660) (-748.909) -- 0:00:34
479000 -- (-749.093) [-749.069] (-749.225) (-748.655) * [-749.257] (-750.741) (-750.443) (-750.504) -- 0:00:34
479500 -- (-751.173) (-750.312) [-749.257] (-749.808) * (-750.740) (-749.706) (-751.287) [-749.760] -- 0:00:34
480000 -- (-753.430) (-757.186) (-751.694) [-749.804] * (-751.358) [-748.185] (-752.112) (-751.594) -- 0:00:35
Average standard deviation of split frequencies: 0.013853
480500 -- (-750.728) [-753.303] (-749.922) (-750.369) * (-751.655) (-750.574) (-750.974) [-748.981] -- 0:00:35
481000 -- [-750.786] (-749.345) (-748.025) (-749.621) * (-749.372) [-749.809] (-750.181) (-748.379) -- 0:00:35
481500 -- (-748.311) (-750.957) (-748.554) [-749.824] * (-747.983) [-750.452] (-752.600) (-750.551) -- 0:00:35
482000 -- (-752.845) (-749.452) (-748.865) [-750.087] * (-748.026) (-749.586) (-749.164) [-751.278] -- 0:00:35
482500 -- (-751.273) (-749.078) (-749.259) [-749.974] * [-753.391] (-748.528) (-749.575) (-752.082) -- 0:00:35
483000 -- (-751.817) (-751.118) [-749.605] (-750.492) * (-753.573) (-753.414) [-752.321] (-753.555) -- 0:00:35
483500 -- (-751.100) (-750.214) [-749.756] (-749.983) * (-748.498) (-750.278) (-748.813) [-750.241] -- 0:00:35
484000 -- (-748.006) (-749.612) (-754.916) [-748.842] * (-748.681) (-749.973) [-749.116] (-749.530) -- 0:00:35
484500 -- (-750.016) [-749.719] (-750.615) (-750.032) * [-750.420] (-751.093) (-749.350) (-748.412) -- 0:00:35
485000 -- (-752.605) [-749.317] (-749.621) (-747.769) * (-748.608) (-749.691) (-748.892) [-749.762] -- 0:00:35
Average standard deviation of split frequencies: 0.012610
485500 -- (-749.873) (-748.938) [-749.175] (-747.769) * (-749.998) [-752.324] (-751.017) (-750.073) -- 0:00:34
486000 -- (-748.240) [-748.610] (-748.539) (-750.918) * [-748.062] (-751.566) (-754.017) (-750.229) -- 0:00:34
486500 -- (-748.780) [-749.535] (-749.852) (-749.905) * (-748.386) (-749.567) (-749.223) [-749.565] -- 0:00:34
487000 -- (-748.438) [-755.682] (-750.115) (-749.024) * (-748.248) [-750.613] (-748.282) (-749.010) -- 0:00:34
487500 -- [-749.422] (-757.255) (-751.280) (-748.328) * [-751.673] (-750.483) (-749.422) (-752.014) -- 0:00:34
488000 -- [-749.498] (-750.009) (-749.608) (-751.953) * (-751.773) (-748.682) (-751.108) [-750.995] -- 0:00:34
488500 -- (-750.006) (-750.953) [-751.818] (-751.936) * (-749.451) (-751.430) (-749.844) [-752.683] -- 0:00:34
489000 -- (-750.852) (-749.802) (-751.220) [-749.142] * (-748.021) (-749.400) [-750.916] (-754.023) -- 0:00:34
489500 -- (-749.406) (-752.386) (-751.906) [-749.094] * (-748.989) [-750.522] (-750.302) (-750.008) -- 0:00:34
490000 -- (-749.348) [-751.721] (-750.261) (-749.800) * [-748.381] (-754.304) (-748.514) (-756.281) -- 0:00:34
Average standard deviation of split frequencies: 0.012370
490500 -- (-755.264) (-751.681) [-748.146] (-750.251) * [-748.546] (-752.610) (-751.215) (-751.213) -- 0:00:34
491000 -- [-750.852] (-750.597) (-748.369) (-750.868) * (-752.342) (-753.036) (-750.155) [-750.207] -- 0:00:34
491500 -- (-748.680) (-748.814) [-750.603] (-748.605) * (-751.739) (-751.993) [-748.825] (-748.368) -- 0:00:34
492000 -- [-749.196] (-749.222) (-749.956) (-749.151) * (-750.306) [-748.289] (-748.688) (-751.301) -- 0:00:34
492500 -- (-752.025) (-749.138) (-749.403) [-748.795] * [-749.589] (-749.516) (-750.815) (-750.429) -- 0:00:34
493000 -- [-749.125] (-749.220) (-751.087) (-750.907) * (-749.490) [-750.122] (-751.958) (-752.412) -- 0:00:33
493500 -- (-752.980) [-748.637] (-750.134) (-749.116) * (-750.621) [-751.177] (-752.850) (-751.272) -- 0:00:33
494000 -- (-751.157) [-750.093] (-748.934) (-748.122) * (-754.293) (-753.083) [-750.192] (-749.552) -- 0:00:33
494500 -- (-748.781) (-748.901) [-750.530] (-752.665) * (-754.793) [-751.735] (-748.797) (-751.324) -- 0:00:33
495000 -- (-752.264) [-749.103] (-750.447) (-751.915) * (-757.236) (-750.833) [-750.370] (-751.590) -- 0:00:33
Average standard deviation of split frequencies: 0.012292
495500 -- (-748.482) [-750.529] (-748.385) (-754.222) * (-756.227) (-752.192) [-750.673] (-748.758) -- 0:00:33
496000 -- (-754.738) (-759.111) [-751.498] (-749.173) * (-750.113) (-754.116) [-749.498] (-749.224) -- 0:00:33
496500 -- [-750.886] (-757.597) (-750.260) (-751.104) * (-749.447) (-750.285) (-749.768) [-750.994] -- 0:00:33
497000 -- (-751.378) [-755.184] (-749.925) (-751.648) * (-749.452) (-753.074) [-749.773] (-751.310) -- 0:00:34
497500 -- [-748.752] (-751.293) (-750.636) (-749.285) * (-749.930) (-751.333) [-750.325] (-749.828) -- 0:00:34
498000 -- [-748.379] (-750.193) (-755.646) (-750.764) * (-751.909) [-751.173] (-750.972) (-754.701) -- 0:00:34
498500 -- (-748.470) [-748.431] (-748.623) (-752.878) * (-753.602) [-749.131] (-750.335) (-752.985) -- 0:00:34
499000 -- (-749.481) (-749.467) [-750.663] (-755.544) * [-750.397] (-748.999) (-752.253) (-750.355) -- 0:00:34
499500 -- (-749.302) [-750.521] (-748.799) (-751.273) * (-752.586) [-752.631] (-752.417) (-750.929) -- 0:00:34
500000 -- (-749.362) [-753.887] (-748.474) (-752.091) * (-751.970) [-749.127] (-753.044) (-752.355) -- 0:00:34
Average standard deviation of split frequencies: 0.011946
500500 -- [-750.885] (-750.319) (-755.732) (-754.443) * (-751.971) [-748.017] (-752.117) (-750.757) -- 0:00:33
501000 -- (-750.694) [-750.037] (-752.383) (-749.841) * (-750.919) (-750.173) [-751.015] (-750.631) -- 0:00:33
501500 -- (-749.445) [-748.722] (-750.610) (-749.430) * [-748.190] (-750.588) (-750.635) (-751.214) -- 0:00:33
502000 -- (-754.477) [-749.709] (-750.591) (-750.302) * (-750.218) (-750.181) [-751.279] (-748.963) -- 0:00:33
502500 -- (-752.632) (-749.340) [-751.723] (-749.600) * (-751.396) (-749.850) [-751.186] (-748.590) -- 0:00:33
503000 -- (-751.021) (-749.933) [-749.391] (-752.023) * (-750.182) [-755.216] (-750.382) (-749.072) -- 0:00:33
503500 -- (-751.156) (-749.477) [-749.265] (-752.842) * [-749.217] (-748.811) (-748.492) (-749.237) -- 0:00:33
504000 -- (-751.836) (-748.861) [-749.701] (-750.475) * (-749.360) (-748.807) [-753.173] (-748.888) -- 0:00:33
504500 -- (-751.544) [-749.645] (-751.161) (-748.930) * (-751.247) (-748.745) (-752.004) [-749.304] -- 0:00:33
505000 -- (-750.269) [-753.377] (-748.061) (-752.072) * (-748.482) [-749.556] (-748.421) (-749.001) -- 0:00:33
Average standard deviation of split frequencies: 0.012461
505500 -- [-749.088] (-750.775) (-748.670) (-750.964) * [-750.425] (-750.344) (-749.335) (-753.749) -- 0:00:33
506000 -- (-748.198) [-749.219] (-748.550) (-751.954) * [-752.491] (-748.855) (-748.681) (-750.592) -- 0:00:33
506500 -- [-748.291] (-751.010) (-752.675) (-748.649) * (-750.949) (-751.474) [-749.480] (-749.736) -- 0:00:33
507000 -- (-750.093) [-751.636] (-750.122) (-749.569) * [-749.784] (-750.723) (-748.362) (-750.913) -- 0:00:33
507500 -- (-750.909) [-754.583] (-754.462) (-750.012) * (-750.397) (-749.639) [-749.585] (-748.650) -- 0:00:32
508000 -- (-751.737) [-749.160] (-748.804) (-751.910) * (-749.175) (-750.834) (-751.427) [-751.160] -- 0:00:32
508500 -- (-752.500) [-748.545] (-749.629) (-749.646) * (-749.612) (-749.514) (-760.809) [-749.652] -- 0:00:32
509000 -- [-750.837] (-752.258) (-748.354) (-751.206) * (-750.566) [-750.394] (-758.702) (-757.140) -- 0:00:32
509500 -- (-751.381) (-750.112) (-749.870) [-749.884] * (-753.669) (-748.837) [-750.009] (-750.295) -- 0:00:32
510000 -- (-748.097) [-749.277] (-752.344) (-748.713) * (-750.703) (-753.280) [-752.797] (-750.221) -- 0:00:32
Average standard deviation of split frequencies: 0.013170
510500 -- (-750.935) (-752.414) [-750.635] (-749.170) * (-751.383) (-749.298) (-749.487) [-749.808] -- 0:00:32
511000 -- (-749.648) [-750.222] (-749.117) (-752.030) * (-748.694) [-750.133] (-752.830) (-748.108) -- 0:00:32
511500 -- [-751.406] (-750.601) (-749.753) (-752.120) * (-748.676) (-754.690) [-749.885] (-749.259) -- 0:00:32
512000 -- (-749.885) (-752.234) [-750.527] (-750.203) * (-751.332) (-754.956) [-750.284] (-751.727) -- 0:00:32
512500 -- (-751.226) [-751.234] (-748.299) (-750.161) * (-748.475) (-752.094) [-749.436] (-748.084) -- 0:00:32
513000 -- (-751.017) (-751.351) [-750.406] (-749.459) * (-748.835) [-749.489] (-748.511) (-750.120) -- 0:00:32
513500 -- [-750.583] (-748.339) (-748.716) (-750.390) * (-748.469) (-750.414) [-751.864] (-749.846) -- 0:00:33
514000 -- [-748.942] (-748.482) (-750.195) (-751.355) * (-748.377) (-750.305) (-748.214) [-752.549] -- 0:00:33
514500 -- (-751.310) [-750.470] (-750.926) (-749.093) * [-750.231] (-749.957) (-748.689) (-749.118) -- 0:00:33
515000 -- (-750.501) [-748.897] (-750.156) (-748.871) * (-748.820) (-751.272) [-751.684] (-750.569) -- 0:00:32
Average standard deviation of split frequencies: 0.013155
515500 -- (-752.047) [-749.442] (-749.434) (-749.839) * [-750.707] (-749.701) (-750.561) (-748.561) -- 0:00:32
516000 -- (-750.931) (-749.843) (-750.588) [-749.572] * (-748.109) (-751.306) [-749.334] (-750.250) -- 0:00:32
516500 -- (-748.980) [-751.686] (-752.346) (-748.035) * (-748.343) (-752.962) (-747.978) [-752.433] -- 0:00:32
517000 -- (-752.474) (-751.093) (-750.970) [-749.004] * [-748.498] (-752.908) (-750.096) (-756.028) -- 0:00:32
517500 -- (-748.758) (-749.455) (-751.686) [-748.865] * (-752.529) [-753.280] (-750.602) (-756.970) -- 0:00:32
518000 -- [-748.900] (-753.170) (-752.711) (-750.486) * (-750.804) (-754.095) (-749.061) [-751.156] -- 0:00:32
518500 -- (-750.059) (-755.499) (-749.215) [-753.395] * (-750.137) (-748.252) [-749.096] (-748.714) -- 0:00:32
519000 -- (-750.236) [-751.800] (-751.477) (-753.794) * (-748.577) [-750.679] (-759.932) (-748.506) -- 0:00:32
519500 -- [-749.259] (-751.865) (-751.339) (-749.490) * (-754.882) (-753.642) (-751.030) [-749.320] -- 0:00:32
520000 -- (-752.437) (-751.537) [-750.076] (-748.695) * [-750.166] (-749.012) (-750.674) (-749.354) -- 0:00:32
Average standard deviation of split frequencies: 0.013339
520500 -- [-749.125] (-750.107) (-748.689) (-752.712) * (-749.405) (-751.861) (-754.755) [-749.095] -- 0:00:32
521000 -- (-749.578) [-748.523] (-755.153) (-751.581) * [-757.329] (-748.839) (-749.257) (-748.604) -- 0:00:32
521500 -- [-747.835] (-751.687) (-753.829) (-749.829) * (-748.556) (-748.091) (-750.840) [-750.293] -- 0:00:32
522000 -- [-749.970] (-750.612) (-752.118) (-751.977) * [-750.143] (-754.576) (-750.117) (-750.006) -- 0:00:32
522500 -- [-751.954] (-749.524) (-753.340) (-748.200) * (-757.856) [-751.722] (-749.805) (-751.648) -- 0:00:31
523000 -- (-752.414) (-748.985) (-750.936) [-751.949] * (-754.130) (-753.407) (-749.428) [-747.927] -- 0:00:31
523500 -- (-750.910) [-752.843] (-752.184) (-752.065) * (-762.135) [-748.713] (-750.259) (-750.363) -- 0:00:31
524000 -- (-749.128) (-750.952) [-748.100] (-748.897) * (-748.844) [-750.232] (-748.439) (-751.639) -- 0:00:31
524500 -- (-749.318) (-751.645) [-748.556] (-752.027) * (-748.440) [-749.067] (-749.159) (-753.150) -- 0:00:31
525000 -- [-751.157] (-750.561) (-751.687) (-750.447) * (-748.767) (-751.511) (-750.545) [-756.293] -- 0:00:31
Average standard deviation of split frequencies: 0.013025
525500 -- (-752.031) (-749.717) (-749.238) [-752.490] * (-749.840) (-752.210) [-748.343] (-748.996) -- 0:00:31
526000 -- (-751.327) (-748.725) (-749.250) [-751.501] * [-748.750] (-752.016) (-748.608) (-751.066) -- 0:00:31
526500 -- [-748.911] (-751.510) (-750.456) (-751.988) * [-749.132] (-748.573) (-749.906) (-748.957) -- 0:00:31
527000 -- [-748.717] (-750.509) (-750.652) (-753.517) * (-752.091) [-751.737] (-748.107) (-753.091) -- 0:00:31
527500 -- (-752.401) [-748.497] (-750.925) (-754.326) * (-751.437) (-753.485) [-748.150] (-749.168) -- 0:00:31
528000 -- (-750.904) (-750.902) [-748.845] (-753.326) * (-753.331) (-752.546) (-749.394) [-748.641] -- 0:00:31
528500 -- (-752.268) (-750.536) [-748.702] (-753.342) * (-749.685) (-750.656) [-752.927] (-749.652) -- 0:00:31
529000 -- (-754.197) (-752.357) [-751.905] (-751.568) * [-748.851] (-751.929) (-749.960) (-756.864) -- 0:00:31
529500 -- (-748.212) (-749.351) [-750.759] (-756.214) * [-749.693] (-752.671) (-748.787) (-750.043) -- 0:00:31
530000 -- [-748.887] (-749.240) (-753.793) (-749.510) * [-750.905] (-751.122) (-750.170) (-748.656) -- 0:00:31
Average standard deviation of split frequencies: 0.012910
530500 -- (-750.796) (-748.468) [-749.455] (-750.127) * (-749.085) (-749.872) (-754.358) [-749.249] -- 0:00:31
531000 -- (-749.388) (-749.598) (-749.577) [-754.551] * (-749.535) (-752.318) (-748.380) [-749.408] -- 0:00:31
531500 -- (-749.866) (-752.638) [-751.693] (-750.244) * (-750.505) (-751.393) (-748.040) [-748.467] -- 0:00:31
532000 -- (-749.148) [-750.208] (-753.091) (-752.660) * [-751.419] (-749.886) (-755.815) (-751.510) -- 0:00:31
532500 -- [-751.005] (-754.179) (-749.108) (-751.509) * [-748.057] (-749.064) (-751.123) (-749.144) -- 0:00:31
533000 -- (-749.452) (-748.683) [-749.150] (-749.311) * [-750.993] (-751.177) (-749.893) (-749.663) -- 0:00:31
533500 -- (-755.645) (-749.721) (-748.461) [-751.081] * (-750.551) (-749.075) (-748.021) [-750.326] -- 0:00:31
534000 -- [-748.943] (-751.098) (-750.193) (-749.994) * (-752.898) (-753.585) [-749.953] (-750.820) -- 0:00:31
534500 -- (-754.007) [-751.694] (-748.492) (-749.367) * (-748.277) (-753.113) (-750.469) [-750.603] -- 0:00:31
535000 -- [-751.086] (-752.577) (-747.976) (-749.495) * (-751.813) (-751.796) (-751.530) [-749.160] -- 0:00:31
Average standard deviation of split frequencies: 0.012899
535500 -- [-750.393] (-750.876) (-760.688) (-748.117) * [-749.535] (-752.489) (-749.589) (-748.534) -- 0:00:31
536000 -- (-748.730) (-749.535) (-751.614) [-750.962] * (-749.393) [-748.599] (-750.446) (-751.137) -- 0:00:31
536500 -- (-750.964) (-752.050) [-748.487] (-748.956) * (-751.166) (-754.337) [-750.599] (-750.855) -- 0:00:31
537000 -- [-750.811] (-749.826) (-752.442) (-749.988) * (-750.252) (-749.672) (-751.076) [-750.389] -- 0:00:31
537500 -- [-750.326] (-750.448) (-748.660) (-752.942) * (-759.412) (-754.890) [-748.426] (-748.525) -- 0:00:30
538000 -- (-752.270) (-753.274) (-752.140) [-749.834] * (-761.002) [-749.093] (-748.476) (-751.433) -- 0:00:30
538500 -- (-751.621) (-748.485) (-750.178) [-752.438] * [-749.781] (-750.744) (-751.327) (-750.027) -- 0:00:30
539000 -- (-749.034) (-750.036) (-749.220) [-754.175] * (-752.373) (-748.917) [-748.602] (-749.911) -- 0:00:30
539500 -- (-748.896) [-749.592] (-749.451) (-749.768) * (-749.724) (-748.901) [-749.166] (-752.354) -- 0:00:30
540000 -- (-749.476) [-748.240] (-749.890) (-748.861) * (-752.060) (-748.312) [-749.345] (-750.170) -- 0:00:30
Average standard deviation of split frequencies: 0.012730
540500 -- (-748.941) [-751.792] (-748.425) (-749.272) * (-749.595) (-748.299) (-750.658) [-749.923] -- 0:00:30
541000 -- (-750.101) (-748.884) (-748.532) [-749.847] * (-750.098) (-748.864) (-752.184) [-749.129] -- 0:00:30
541500 -- [-747.832] (-751.016) (-753.314) (-748.321) * (-749.641) [-752.478] (-753.946) (-751.691) -- 0:00:30
542000 -- (-749.430) (-758.246) (-750.927) [-748.431] * [-750.632] (-750.044) (-749.775) (-748.517) -- 0:00:30
542500 -- (-750.542) (-750.135) [-749.830] (-749.329) * (-750.353) [-749.096] (-750.623) (-748.104) -- 0:00:30
543000 -- (-749.049) [-748.594] (-753.329) (-748.845) * (-752.097) (-750.029) (-749.656) [-756.131] -- 0:00:30
543500 -- (-748.988) [-748.891] (-751.451) (-750.812) * [-752.529] (-749.645) (-748.382) (-750.784) -- 0:00:30
544000 -- [-748.439] (-755.451) (-753.076) (-750.225) * (-750.257) (-752.815) (-749.733) [-752.114] -- 0:00:30
544500 -- [-754.181] (-753.153) (-749.880) (-749.243) * [-750.850] (-750.162) (-748.699) (-751.186) -- 0:00:30
545000 -- [-750.264] (-754.816) (-755.526) (-749.781) * [-757.283] (-753.336) (-749.221) (-752.744) -- 0:00:30
Average standard deviation of split frequencies: 0.012548
545500 -- (-749.785) [-752.999] (-750.526) (-749.633) * (-755.811) (-750.481) [-751.239] (-755.142) -- 0:00:29
546000 -- [-749.379] (-749.895) (-749.943) (-750.523) * (-748.712) [-749.581] (-752.155) (-750.560) -- 0:00:29
546500 -- (-750.596) (-749.854) [-749.714] (-749.773) * (-752.658) [-749.917] (-750.601) (-753.706) -- 0:00:30
547000 -- [-751.004] (-748.657) (-750.615) (-749.044) * [-752.719] (-749.384) (-749.428) (-749.174) -- 0:00:30
547500 -- [-749.580] (-749.288) (-749.441) (-748.890) * (-756.700) (-751.757) [-749.091] (-749.600) -- 0:00:30
548000 -- (-749.106) [-749.237] (-752.007) (-749.916) * (-750.711) (-749.794) (-750.279) [-751.456] -- 0:00:30
548500 -- (-748.728) (-748.806) (-754.676) [-749.148] * (-750.776) [-750.219] (-751.305) (-749.840) -- 0:00:30
549000 -- (-752.677) (-751.082) [-755.915] (-748.951) * (-747.959) (-753.581) (-750.314) [-749.080] -- 0:00:30
549500 -- (-749.876) (-751.393) [-753.738] (-755.914) * (-749.667) (-749.806) (-750.100) [-750.445] -- 0:00:30
550000 -- (-750.325) (-753.562) (-750.769) [-750.246] * (-749.842) (-755.633) [-749.037] (-751.893) -- 0:00:30
Average standard deviation of split frequencies: 0.012156
550500 -- (-757.010) (-748.808) [-754.146] (-750.331) * (-748.673) (-751.182) (-747.975) [-748.981] -- 0:00:30
551000 -- (-749.156) (-750.867) [-751.659] (-748.167) * (-750.243) [-751.064] (-748.322) (-748.757) -- 0:00:30
551500 -- (-751.148) (-750.371) [-751.251] (-748.491) * [-752.088] (-751.126) (-748.236) (-755.862) -- 0:00:30
552000 -- (-749.889) (-750.521) [-749.795] (-751.459) * (-750.003) (-749.929) [-748.144] (-751.794) -- 0:00:30
552500 -- (-747.950) [-748.509] (-752.773) (-752.698) * (-750.958) [-750.125] (-749.361) (-750.097) -- 0:00:29
553000 -- (-748.467) [-748.877] (-749.079) (-752.930) * (-747.853) (-750.899) (-749.348) [-748.805] -- 0:00:29
553500 -- (-751.634) (-752.653) (-752.067) [-752.433] * (-749.686) (-750.673) (-748.977) [-749.322] -- 0:00:29
554000 -- (-748.041) (-751.337) [-750.373] (-751.192) * (-750.194) (-750.906) (-752.491) [-749.275] -- 0:00:29
554500 -- (-755.491) (-753.228) (-749.299) [-749.508] * [-749.616] (-749.801) (-749.156) (-751.857) -- 0:00:29
555000 -- (-750.432) (-752.852) [-749.276] (-750.098) * (-749.729) (-750.578) (-748.778) [-750.168] -- 0:00:29
Average standard deviation of split frequencies: 0.012266
555500 -- (-748.951) [-749.978] (-750.033) (-750.458) * (-748.598) (-754.822) (-750.209) [-749.192] -- 0:00:29
556000 -- (-748.365) (-751.565) [-752.915] (-751.061) * (-750.760) (-753.599) (-751.458) [-751.680] -- 0:00:29
556500 -- (-749.776) [-751.241] (-750.140) (-750.078) * (-750.058) (-749.855) [-749.562] (-749.263) -- 0:00:29
557000 -- (-749.024) (-748.719) (-749.023) [-749.513] * [-749.071] (-749.241) (-749.051) (-752.267) -- 0:00:29
557500 -- [-750.192] (-748.618) (-748.685) (-751.248) * [-748.397] (-749.782) (-748.128) (-749.958) -- 0:00:29
558000 -- [-748.251] (-750.542) (-750.697) (-751.586) * (-750.972) (-749.301) (-750.130) [-750.534] -- 0:00:29
558500 -- [-748.285] (-751.247) (-749.728) (-748.050) * (-750.287) (-751.786) (-748.717) [-750.588] -- 0:00:29
559000 -- (-748.282) (-750.116) [-748.855] (-751.171) * (-749.049) (-749.048) (-749.379) [-749.938] -- 0:00:29
559500 -- (-750.177) [-748.187] (-748.800) (-752.813) * (-749.312) (-754.114) [-748.385] (-750.572) -- 0:00:29
560000 -- (-750.211) (-747.726) (-757.834) [-750.884] * (-751.765) [-750.151] (-750.815) (-750.343) -- 0:00:29
Average standard deviation of split frequencies: 0.011715
560500 -- (-751.256) [-748.538] (-748.427) (-750.507) * (-750.253) [-751.066] (-753.883) (-749.314) -- 0:00:29
561000 -- (-749.246) (-751.316) (-752.388) [-750.288] * (-751.081) (-750.405) (-753.717) [-750.661] -- 0:00:28
561500 -- [-749.373] (-749.646) (-751.165) (-749.333) * (-751.497) (-749.357) [-752.144] (-750.072) -- 0:00:28
562000 -- (-754.967) (-749.698) [-751.389] (-750.434) * [-753.748] (-750.136) (-748.973) (-751.005) -- 0:00:28
562500 -- (-750.851) (-751.311) [-751.171] (-749.546) * [-749.557] (-750.188) (-751.281) (-751.448) -- 0:00:28
563000 -- [-749.579] (-752.784) (-750.793) (-750.159) * (-749.758) (-750.693) [-750.320] (-752.386) -- 0:00:28
563500 -- (-749.585) (-750.434) [-749.996] (-750.153) * (-751.942) [-750.733] (-753.462) (-749.330) -- 0:00:29
564000 -- (-749.098) (-749.200) (-749.230) [-749.836] * [-752.771] (-748.408) (-754.042) (-748.385) -- 0:00:29
564500 -- (-749.321) (-749.594) [-752.159] (-752.209) * (-751.081) (-750.009) (-751.467) [-751.394] -- 0:00:29
565000 -- [-750.994] (-751.124) (-752.687) (-753.569) * (-750.576) (-757.850) [-750.187] (-750.034) -- 0:00:29
Average standard deviation of split frequencies: 0.011660
565500 -- [-751.405] (-749.554) (-753.421) (-749.915) * (-750.086) [-748.363] (-750.158) (-752.531) -- 0:00:29
566000 -- (-748.654) (-748.248) (-749.930) [-750.063] * (-749.759) (-749.124) [-749.395] (-750.617) -- 0:00:29
566500 -- [-749.304] (-748.476) (-755.685) (-750.049) * [-752.397] (-748.197) (-748.314) (-749.387) -- 0:00:29
567000 -- (-749.483) (-750.592) [-749.176] (-749.652) * [-751.914] (-752.008) (-749.059) (-748.933) -- 0:00:29
567500 -- (-751.244) (-751.202) (-748.058) [-750.821] * (-751.476) [-749.491] (-749.889) (-752.041) -- 0:00:28
568000 -- (-752.075) [-748.555] (-749.057) (-749.206) * [-748.909] (-748.929) (-748.238) (-751.464) -- 0:00:28
568500 -- (-750.405) (-748.872) (-748.800) [-748.800] * [-748.386] (-758.305) (-749.789) (-754.854) -- 0:00:28
569000 -- (-749.212) (-750.080) (-749.166) [-750.450] * (-749.333) (-749.163) [-753.239] (-752.753) -- 0:00:28
569500 -- [-749.088] (-751.525) (-750.443) (-751.273) * (-751.635) (-749.893) (-751.723) [-751.154] -- 0:00:28
570000 -- (-752.777) (-752.502) [-750.526] (-753.228) * [-749.388] (-749.896) (-749.690) (-750.704) -- 0:00:28
Average standard deviation of split frequencies: 0.010794
570500 -- (-749.944) [-749.715] (-750.786) (-752.058) * (-749.928) (-749.063) (-750.804) [-750.915] -- 0:00:28
571000 -- (-749.075) [-749.647] (-750.763) (-751.966) * (-755.395) (-752.877) [-749.764] (-750.822) -- 0:00:28
571500 -- (-750.365) (-749.353) [-749.867] (-753.018) * (-753.552) (-751.066) (-750.080) [-750.259] -- 0:00:28
572000 -- (-748.341) (-756.342) (-749.514) [-750.532] * (-753.395) [-748.904] (-754.261) (-749.110) -- 0:00:28
572500 -- (-749.454) [-751.464] (-750.632) (-750.161) * (-749.652) (-749.454) (-752.631) [-748.714] -- 0:00:28
573000 -- (-750.639) (-750.527) (-751.516) [-749.968] * [-752.233] (-752.842) (-754.439) (-748.471) -- 0:00:28
573500 -- (-758.717) (-749.582) (-750.266) [-750.695] * (-752.337) [-751.675] (-749.278) (-752.258) -- 0:00:28
574000 -- (-759.332) (-752.037) [-750.632] (-748.620) * (-751.187) [-750.228] (-755.956) (-751.026) -- 0:00:28
574500 -- (-750.509) (-749.351) (-753.794) [-750.648] * [-748.934] (-752.781) (-751.551) (-752.060) -- 0:00:28
575000 -- [-750.054] (-748.715) (-750.781) (-750.890) * (-751.820) [-748.770] (-753.397) (-749.070) -- 0:00:28
Average standard deviation of split frequencies: 0.011021
575500 -- (-748.836) (-750.556) [-752.355] (-751.824) * (-753.843) (-749.402) [-749.625] (-753.237) -- 0:00:28
576000 -- (-748.238) [-751.333] (-751.682) (-750.860) * (-755.859) (-750.156) (-749.433) [-751.485] -- 0:00:27
576500 -- [-751.118] (-748.141) (-757.623) (-751.222) * [-751.556] (-751.480) (-749.761) (-749.064) -- 0:00:27
577000 -- (-748.860) [-748.325] (-756.694) (-751.681) * (-750.986) (-747.938) [-749.499] (-749.144) -- 0:00:27
577500 -- (-750.669) [-748.666] (-752.677) (-750.473) * [-748.768] (-750.906) (-748.687) (-751.672) -- 0:00:27
578000 -- (-751.046) (-751.379) (-749.935) [-752.414] * (-750.252) (-753.031) [-748.264] (-751.449) -- 0:00:27
578500 -- (-750.858) (-752.266) (-749.961) [-751.100] * [-748.316] (-759.224) (-748.156) (-749.330) -- 0:00:27
579000 -- (-748.499) (-754.119) [-749.804] (-748.689) * (-750.396) [-750.226] (-752.285) (-749.864) -- 0:00:27
579500 -- (-748.848) (-753.569) (-748.628) [-748.919] * (-749.740) (-752.716) [-750.908] (-750.763) -- 0:00:27
580000 -- (-748.348) (-755.651) (-749.866) [-748.365] * [-750.723] (-748.758) (-749.469) (-749.772) -- 0:00:28
Average standard deviation of split frequencies: 0.011257
580500 -- [-756.019] (-751.646) (-749.038) (-751.444) * (-751.633) [-751.170] (-751.198) (-750.855) -- 0:00:28
581000 -- (-748.348) (-751.062) [-753.736] (-753.964) * (-751.826) [-749.293] (-750.554) (-750.040) -- 0:00:28
581500 -- (-749.080) (-751.363) [-750.858] (-748.740) * (-753.704) (-751.840) [-750.140] (-749.365) -- 0:00:28
582000 -- [-750.223] (-749.737) (-752.962) (-750.892) * (-751.174) (-750.276) (-748.724) [-752.221] -- 0:00:28
582500 -- (-750.678) (-750.381) (-751.722) [-751.408] * (-751.365) [-748.728] (-749.290) (-749.494) -- 0:00:27
583000 -- (-750.746) (-751.144) (-752.399) [-748.795] * [-751.462] (-750.326) (-756.934) (-751.374) -- 0:00:27
583500 -- (-753.295) [-748.107] (-750.104) (-750.393) * (-750.250) (-749.002) (-750.718) [-749.040] -- 0:00:27
584000 -- [-750.015] (-748.662) (-750.603) (-754.636) * [-754.536] (-751.675) (-751.872) (-750.321) -- 0:00:27
584500 -- (-751.313) (-749.015) [-752.171] (-749.189) * [-749.725] (-751.267) (-750.915) (-748.996) -- 0:00:27
585000 -- (-751.202) (-748.547) [-751.504] (-751.305) * (-749.981) (-751.466) [-750.041] (-748.926) -- 0:00:27
Average standard deviation of split frequencies: 0.011423
585500 -- (-754.583) (-754.078) [-749.605] (-753.357) * (-748.401) (-748.400) [-752.060] (-751.608) -- 0:00:27
586000 -- (-753.366) (-750.985) (-748.711) [-750.803] * (-749.839) [-749.794] (-752.063) (-749.840) -- 0:00:27
586500 -- (-750.049) [-750.392] (-749.973) (-748.834) * (-748.747) [-749.655] (-754.010) (-749.558) -- 0:00:27
587000 -- (-750.525) [-749.419] (-752.274) (-751.929) * (-749.885) [-752.393] (-750.081) (-749.866) -- 0:00:27
587500 -- (-748.695) (-752.190) [-752.017] (-749.268) * (-752.113) (-749.890) (-749.921) [-748.373] -- 0:00:27
588000 -- [-754.336] (-748.625) (-751.507) (-751.608) * (-755.509) [-749.906] (-749.906) (-748.948) -- 0:00:27
588500 -- (-748.855) (-748.852) (-749.827) [-751.924] * (-749.984) (-750.251) [-748.457] (-752.502) -- 0:00:27
589000 -- (-750.577) (-751.765) (-750.830) [-751.459] * (-749.756) [-750.645] (-748.883) (-751.911) -- 0:00:27
589500 -- (-749.163) (-752.696) (-749.678) [-749.420] * [-748.191] (-748.460) (-748.875) (-751.395) -- 0:00:27
590000 -- (-750.809) (-753.679) (-752.455) [-747.779] * [-748.061] (-748.716) (-747.741) (-748.738) -- 0:00:27
Average standard deviation of split frequencies: 0.011386
590500 -- (-749.440) (-749.821) (-748.586) [-747.751] * (-748.399) (-750.344) (-752.193) [-751.442] -- 0:00:27
591000 -- (-753.152) (-749.446) (-753.425) [-748.362] * [-747.949] (-755.759) (-750.503) (-750.572) -- 0:00:26
591500 -- (-751.810) (-748.912) [-751.358] (-748.187) * (-752.078) (-750.645) (-750.550) [-747.960] -- 0:00:26
592000 -- (-753.394) (-752.824) (-749.928) [-749.757] * (-748.275) (-752.328) (-749.278) [-749.539] -- 0:00:26
592500 -- [-749.206] (-750.316) (-750.428) (-749.419) * [-751.185] (-754.884) (-749.341) (-753.191) -- 0:00:26
593000 -- (-749.277) [-752.532] (-748.409) (-750.263) * (-751.583) (-750.541) [-751.164] (-752.607) -- 0:00:26
593500 -- (-753.525) (-749.618) (-750.386) [-748.304] * (-751.122) (-752.087) (-750.424) [-750.732] -- 0:00:26
594000 -- [-749.669] (-748.223) (-749.552) (-750.624) * (-752.264) (-750.579) [-751.456] (-750.137) -- 0:00:26
594500 -- [-750.599] (-750.955) (-749.777) (-755.301) * (-754.751) (-750.657) [-750.214] (-753.294) -- 0:00:26
595000 -- (-750.044) [-749.551] (-748.559) (-748.109) * (-750.089) (-750.962) [-749.478] (-751.439) -- 0:00:26
Average standard deviation of split frequencies: 0.011548
595500 -- [-751.669] (-749.594) (-752.780) (-748.699) * (-750.738) [-753.650] (-752.357) (-750.717) -- 0:00:26
596000 -- (-751.370) [-748.583] (-750.038) (-748.333) * (-752.430) (-748.651) (-753.311) [-748.852] -- 0:00:26
596500 -- (-749.935) (-751.122) (-751.454) [-748.221] * (-750.499) (-749.459) [-749.201] (-750.901) -- 0:00:26
597000 -- [-752.241] (-748.227) (-751.468) (-752.808) * [-748.407] (-748.956) (-751.572) (-749.820) -- 0:00:27
597500 -- (-750.815) [-748.074] (-750.784) (-753.331) * (-751.635) (-749.694) [-750.546] (-750.905) -- 0:00:26
598000 -- [-749.334] (-749.012) (-748.519) (-752.380) * (-751.509) (-752.302) [-753.669] (-750.680) -- 0:00:26
598500 -- [-751.183] (-748.182) (-753.991) (-753.342) * [-750.216] (-757.717) (-749.317) (-748.922) -- 0:00:26
599000 -- (-748.989) (-749.937) [-750.296] (-756.730) * (-748.756) (-751.360) (-752.218) [-752.437] -- 0:00:26
599500 -- (-749.503) (-749.341) [-751.029] (-754.452) * [-750.042] (-749.206) (-751.027) (-748.534) -- 0:00:26
600000 -- (-750.066) [-748.135] (-748.345) (-752.302) * (-749.506) (-749.207) [-749.911] (-748.331) -- 0:00:26
Average standard deviation of split frequencies: 0.011353
600500 -- (-749.572) (-751.094) (-749.085) [-750.214] * [-750.223] (-750.078) (-752.598) (-748.768) -- 0:00:26
601000 -- [-750.979] (-749.516) (-750.855) (-749.575) * (-749.520) (-749.458) (-750.982) [-750.359] -- 0:00:26
601500 -- (-749.083) [-748.058] (-750.635) (-748.426) * (-750.798) (-749.603) (-750.684) [-750.965] -- 0:00:26
602000 -- [-751.746] (-748.430) (-749.485) (-752.693) * (-749.895) [-752.093] (-749.070) (-751.147) -- 0:00:26
602500 -- [-748.895] (-749.193) (-749.584) (-749.222) * (-750.938) (-750.461) [-750.156] (-749.225) -- 0:00:26
603000 -- (-749.031) (-749.617) [-752.685] (-748.713) * (-749.050) (-749.021) (-749.785) [-756.376] -- 0:00:26
603500 -- (-752.171) (-749.053) [-750.736] (-748.930) * (-748.913) [-749.163] (-752.441) (-750.144) -- 0:00:26
604000 -- [-754.305] (-752.419) (-750.067) (-749.892) * [-753.456] (-748.355) (-751.352) (-751.038) -- 0:00:26
604500 -- [-750.802] (-749.038) (-750.194) (-748.961) * (-751.569) (-749.394) (-751.524) [-750.348] -- 0:00:26
605000 -- (-751.340) (-749.515) (-749.879) [-748.502] * (-755.798) (-748.903) [-751.414] (-752.497) -- 0:00:26
Average standard deviation of split frequencies: 0.011876
605500 -- (-749.930) (-750.423) [-752.077] (-749.527) * [-748.445] (-750.329) (-749.765) (-750.971) -- 0:00:26
606000 -- [-748.484] (-752.159) (-749.389) (-749.884) * (-748.879) [-750.321] (-750.644) (-752.901) -- 0:00:26
606500 -- (-748.301) (-751.482) [-750.229] (-751.264) * (-749.415) [-753.525] (-753.155) (-749.127) -- 0:00:25
607000 -- [-751.828] (-751.108) (-749.486) (-750.733) * (-748.646) [-750.104] (-748.690) (-748.210) -- 0:00:25
607500 -- [-752.660] (-750.022) (-749.076) (-749.689) * (-748.644) (-754.600) (-753.866) [-750.732] -- 0:00:25
608000 -- (-750.517) (-749.510) [-748.557] (-749.236) * [-750.065] (-750.509) (-752.540) (-756.134) -- 0:00:25
608500 -- (-749.486) [-751.304] (-748.685) (-751.249) * [-749.480] (-751.530) (-753.672) (-750.153) -- 0:00:25
609000 -- (-753.168) (-748.472) [-749.435] (-753.396) * (-748.370) (-749.078) (-752.498) [-749.987] -- 0:00:25
609500 -- [-752.826] (-754.106) (-749.366) (-753.644) * (-748.495) (-749.635) [-749.657] (-749.950) -- 0:00:25
610000 -- (-749.971) (-749.507) (-748.128) [-750.299] * [-748.173] (-750.995) (-749.171) (-749.944) -- 0:00:25
Average standard deviation of split frequencies: 0.011682
610500 -- (-757.011) (-749.212) [-750.906] (-754.226) * [-748.342] (-749.944) (-748.871) (-751.387) -- 0:00:25
611000 -- (-748.439) (-751.314) [-748.857] (-753.916) * (-752.340) [-751.096] (-752.994) (-754.764) -- 0:00:25
611500 -- (-749.349) [-749.118] (-749.658) (-748.994) * (-748.608) (-747.752) [-749.466] (-754.794) -- 0:00:25
612000 -- (-750.398) (-748.804) [-749.660] (-751.801) * [-748.227] (-753.402) (-749.269) (-748.852) -- 0:00:25
612500 -- (-751.112) (-748.752) (-754.141) [-750.638] * (-748.234) (-750.102) (-751.228) [-750.477] -- 0:00:25
613000 -- (-750.743) (-748.967) [-750.339] (-752.322) * (-749.798) [-750.038] (-760.476) (-750.234) -- 0:00:25
613500 -- [-751.023] (-749.910) (-751.684) (-750.532) * (-750.397) [-749.442] (-749.097) (-748.239) -- 0:00:25
614000 -- (-752.803) [-748.107] (-754.676) (-752.468) * (-749.721) [-755.330] (-748.315) (-749.704) -- 0:00:25
614500 -- (-749.660) (-749.380) (-749.778) [-749.293] * (-751.898) [-751.831] (-748.581) (-750.348) -- 0:00:25
615000 -- (-751.262) [-749.032] (-749.979) (-750.964) * [-749.897] (-748.189) (-749.077) (-750.443) -- 0:00:25
Average standard deviation of split frequencies: 0.011836
615500 -- (-751.311) (-750.108) (-749.936) [-750.096] * (-749.087) (-748.245) (-750.961) [-749.323] -- 0:00:25
616000 -- [-749.328] (-751.964) (-749.999) (-753.975) * (-753.685) (-748.344) (-751.527) [-750.618] -- 0:00:25
616500 -- (-752.452) [-749.169] (-749.629) (-751.638) * (-753.813) (-749.861) [-751.217] (-749.811) -- 0:00:25
617000 -- (-750.883) (-753.193) (-753.243) [-748.741] * (-749.336) [-750.064] (-749.191) (-752.415) -- 0:00:25
617500 -- (-752.042) (-755.737) [-748.610] (-750.618) * [-749.257] (-748.955) (-750.988) (-751.766) -- 0:00:25
618000 -- (-752.678) (-752.336) (-750.812) [-752.913] * (-751.909) (-748.906) (-751.345) [-749.774] -- 0:00:25
618500 -- [-748.105] (-748.664) (-750.726) (-750.173) * (-751.672) [-748.638] (-749.695) (-751.880) -- 0:00:25
619000 -- (-750.107) [-751.433] (-749.827) (-749.707) * [-748.257] (-750.232) (-748.982) (-749.786) -- 0:00:25
619500 -- (-749.640) (-750.220) (-749.616) [-749.217] * (-749.351) [-749.101] (-749.170) (-752.523) -- 0:00:25
620000 -- (-750.014) (-749.130) (-751.668) [-749.710] * (-748.704) [-749.027] (-749.769) (-757.422) -- 0:00:25
Average standard deviation of split frequencies: 0.012102
620500 -- (-749.854) (-749.970) [-751.551] (-751.649) * (-750.067) (-749.625) (-750.872) [-749.263] -- 0:00:25
621000 -- (-751.910) (-748.280) [-749.893] (-749.627) * (-751.589) (-753.461) (-749.930) [-749.443] -- 0:00:25
621500 -- (-753.585) (-750.457) (-752.674) [-749.445] * (-750.154) (-749.227) (-750.642) [-748.906] -- 0:00:24
622000 -- (-751.012) [-751.131] (-752.096) (-750.979) * (-750.050) [-751.187] (-749.193) (-750.536) -- 0:00:24
622500 -- [-751.699] (-753.274) (-748.832) (-749.358) * [-749.004] (-749.321) (-748.456) (-750.055) -- 0:00:24
623000 -- (-749.220) [-750.701] (-749.496) (-749.130) * (-749.068) [-749.258] (-751.141) (-750.154) -- 0:00:24
623500 -- [-750.429] (-750.960) (-749.537) (-750.341) * (-752.578) [-750.618] (-749.834) (-754.850) -- 0:00:24
624000 -- (-748.624) [-750.044] (-748.863) (-749.082) * (-749.025) [-751.389] (-751.754) (-751.316) -- 0:00:24
624500 -- (-748.461) (-748.152) (-749.511) [-750.654] * [-748.366] (-750.131) (-750.486) (-758.400) -- 0:00:24
625000 -- (-751.717) [-748.980] (-755.639) (-750.249) * (-751.281) (-749.645) [-751.275] (-750.177) -- 0:00:24
Average standard deviation of split frequencies: 0.011898
625500 -- (-752.502) [-752.184] (-749.155) (-748.757) * [-748.474] (-749.211) (-751.509) (-750.660) -- 0:00:24
626000 -- (-748.469) (-750.998) [-749.307] (-750.718) * (-748.795) [-748.673] (-748.673) (-748.885) -- 0:00:24
626500 -- [-749.050] (-749.855) (-748.457) (-753.376) * [-751.415] (-750.454) (-752.302) (-749.374) -- 0:00:24
627000 -- (-751.184) (-751.331) [-749.778] (-752.645) * [-750.581] (-749.599) (-749.396) (-751.340) -- 0:00:24
627500 -- (-748.247) (-748.928) [-749.743] (-750.201) * (-752.231) (-751.730) [-751.235] (-749.208) -- 0:00:24
628000 -- (-749.831) (-749.983) (-749.773) [-748.715] * (-749.349) [-749.356] (-749.055) (-751.518) -- 0:00:24
628500 -- (-748.728) [-749.171] (-751.014) (-749.642) * (-748.608) [-750.075] (-752.108) (-758.466) -- 0:00:24
629000 -- [-749.649] (-751.725) (-751.397) (-750.747) * [-749.500] (-750.964) (-750.215) (-753.085) -- 0:00:24
629500 -- [-747.923] (-749.431) (-748.349) (-750.797) * (-750.561) [-749.377] (-749.946) (-753.072) -- 0:00:24
630000 -- (-748.190) [-749.565] (-747.957) (-749.936) * (-753.759) (-757.085) (-749.883) [-749.331] -- 0:00:24
Average standard deviation of split frequencies: 0.012159
630500 -- (-749.269) (-752.930) [-748.729] (-751.792) * (-752.362) [-752.172] (-749.081) (-751.661) -- 0:00:24
631000 -- (-748.948) (-750.642) [-750.829] (-749.012) * (-752.627) (-748.869) (-750.155) [-748.628] -- 0:00:24
631500 -- [-748.549] (-750.094) (-753.408) (-750.001) * (-749.881) (-748.565) [-749.608] (-748.568) -- 0:00:24
632000 -- (-752.350) (-749.214) (-753.796) [-748.337] * [-749.808] (-748.610) (-752.112) (-749.738) -- 0:00:24
632500 -- (-750.045) (-751.983) (-750.910) [-752.425] * [-752.257] (-748.159) (-750.105) (-750.596) -- 0:00:24
633000 -- (-750.371) (-756.774) [-749.596] (-749.016) * (-750.038) [-747.755] (-753.689) (-749.456) -- 0:00:24
633500 -- (-751.827) (-749.569) [-747.866] (-751.414) * (-750.234) (-752.017) (-751.125) [-748.335] -- 0:00:24
634000 -- (-753.048) (-752.588) (-749.250) [-753.818] * [-749.779] (-749.550) (-752.478) (-749.475) -- 0:00:24
634500 -- (-753.719) [-751.353] (-750.571) (-755.312) * (-751.564) [-749.093] (-751.901) (-752.950) -- 0:00:24
635000 -- [-749.341] (-750.790) (-751.321) (-753.576) * (-750.049) (-750.238) (-748.673) [-753.267] -- 0:00:24
Average standard deviation of split frequencies: 0.011513
635500 -- (-748.841) (-751.246) [-749.252] (-750.488) * [-750.078] (-750.624) (-750.162) (-752.559) -- 0:00:24
636000 -- [-748.768] (-750.634) (-752.511) (-750.046) * [-751.477] (-749.683) (-749.182) (-752.026) -- 0:00:24
636500 -- (-748.495) [-749.567] (-749.267) (-751.672) * (-753.260) [-748.826] (-752.825) (-750.764) -- 0:00:23
637000 -- [-748.686] (-750.862) (-749.937) (-752.920) * (-750.317) [-750.937] (-759.048) (-748.976) -- 0:00:23
637500 -- (-751.484) (-750.570) (-749.565) [-751.132] * [-748.983] (-750.004) (-752.780) (-749.715) -- 0:00:23
638000 -- (-749.637) (-752.686) [-750.825] (-748.900) * (-749.288) (-749.341) [-751.085] (-754.168) -- 0:00:23
638500 -- [-749.617] (-750.534) (-751.409) (-752.427) * (-749.968) [-749.332] (-749.573) (-754.604) -- 0:00:23
639000 -- [-750.296] (-749.758) (-751.499) (-750.176) * [-749.190] (-748.210) (-750.360) (-749.461) -- 0:00:23
639500 -- (-748.040) [-752.645] (-751.879) (-749.523) * (-751.211) [-747.891] (-748.462) (-749.264) -- 0:00:23
640000 -- (-749.900) (-751.806) [-749.411] (-752.624) * [-749.582] (-750.141) (-749.387) (-751.020) -- 0:00:23
Average standard deviation of split frequencies: 0.011822
640500 -- (-753.572) (-749.332) (-749.434) [-754.210] * (-750.186) (-749.820) (-751.378) [-752.557] -- 0:00:23
641000 -- (-752.958) (-748.640) (-748.822) [-752.308] * (-756.292) (-750.182) [-750.712] (-752.016) -- 0:00:23
641500 -- (-752.491) (-752.779) [-755.771] (-751.891) * (-751.673) [-748.116] (-750.338) (-752.726) -- 0:00:23
642000 -- (-749.188) [-750.728] (-751.588) (-751.858) * (-752.226) [-749.414] (-751.153) (-751.853) -- 0:00:23
642500 -- (-752.478) [-748.351] (-749.109) (-748.798) * (-751.884) (-749.443) [-752.456] (-751.838) -- 0:00:23
643000 -- [-750.958] (-751.644) (-750.626) (-748.567) * [-750.040] (-750.561) (-751.187) (-751.315) -- 0:00:23
643500 -- (-749.087) (-751.120) [-757.821] (-749.595) * (-752.124) (-751.814) (-749.306) [-750.474] -- 0:00:23
644000 -- [-748.540] (-753.015) (-749.129) (-749.039) * (-751.040) (-751.321) (-749.717) [-751.532] -- 0:00:23
644500 -- [-749.798] (-751.263) (-749.866) (-750.584) * [-748.966] (-750.167) (-749.963) (-752.250) -- 0:00:23
645000 -- [-749.568] (-749.688) (-750.895) (-750.874) * (-750.168) (-754.575) (-750.843) [-749.375] -- 0:00:23
Average standard deviation of split frequencies: 0.011286
645500 -- [-750.095] (-752.871) (-749.792) (-749.731) * (-752.325) [-748.649] (-751.744) (-748.955) -- 0:00:23
646000 -- [-751.107] (-754.235) (-751.372) (-749.155) * [-750.070] (-748.875) (-749.716) (-748.468) -- 0:00:23
646500 -- (-749.534) [-754.820] (-754.107) (-751.836) * (-750.382) [-748.775] (-749.755) (-749.638) -- 0:00:22
647000 -- (-753.421) (-752.686) [-751.637] (-752.434) * (-753.404) [-749.818] (-750.518) (-751.887) -- 0:00:22
647500 -- [-757.276] (-752.923) (-754.615) (-749.993) * (-755.613) (-751.529) [-751.828] (-751.793) -- 0:00:23
648000 -- (-751.344) [-753.870] (-752.495) (-748.589) * (-751.341) (-754.230) (-748.510) [-749.029] -- 0:00:23
648500 -- (-754.751) (-751.980) [-748.375] (-749.082) * (-750.214) [-748.795] (-750.265) (-750.798) -- 0:00:23
649000 -- (-752.964) (-753.780) (-749.005) [-748.992] * [-748.380] (-748.235) (-750.318) (-750.932) -- 0:00:23
649500 -- (-754.480) [-750.796] (-750.111) (-748.546) * [-750.251] (-751.762) (-750.500) (-750.955) -- 0:00:23
650000 -- (-750.417) [-749.750] (-748.213) (-748.659) * (-749.682) [-748.885] (-751.558) (-750.187) -- 0:00:23
Average standard deviation of split frequencies: 0.011978
650500 -- (-753.243) [-750.167] (-748.976) (-749.951) * (-748.508) [-749.508] (-751.692) (-753.018) -- 0:00:23
651000 -- [-751.057] (-749.853) (-749.372) (-748.958) * (-752.107) (-748.901) (-748.056) [-749.329] -- 0:00:23
651500 -- [-750.825] (-748.913) (-749.866) (-752.528) * (-748.325) [-751.965] (-751.643) (-750.208) -- 0:00:23
652000 -- (-751.511) (-747.999) [-751.902] (-748.308) * (-749.849) (-751.358) (-750.992) [-750.772] -- 0:00:22
652500 -- (-749.736) (-748.371) (-751.288) [-749.707] * (-750.868) (-750.282) (-750.520) [-748.598] -- 0:00:22
653000 -- (-750.327) [-749.187] (-749.294) (-750.163) * (-754.633) (-748.472) (-749.208) [-754.038] -- 0:00:22
653500 -- [-748.963] (-752.959) (-749.771) (-750.546) * [-750.264] (-751.031) (-750.020) (-749.966) -- 0:00:22
654000 -- (-753.164) [-751.705] (-749.665) (-753.750) * (-754.399) (-750.018) [-750.305] (-748.460) -- 0:00:22
654500 -- (-748.477) (-751.415) [-749.601] (-754.711) * (-754.297) (-750.058) [-749.339] (-754.544) -- 0:00:22
655000 -- (-752.312) (-754.198) [-749.770] (-752.725) * (-752.145) [-751.056] (-752.751) (-753.855) -- 0:00:22
Average standard deviation of split frequencies: 0.012552
655500 -- (-749.386) [-749.541] (-749.434) (-747.984) * (-750.895) (-755.626) [-750.609] (-749.377) -- 0:00:22
656000 -- (-749.745) (-750.571) [-752.803] (-750.098) * [-750.280] (-752.701) (-751.833) (-750.148) -- 0:00:22
656500 -- (-751.850) (-750.212) (-754.369) [-748.295] * (-750.850) (-754.781) (-755.825) [-750.151] -- 0:00:22
657000 -- (-751.787) (-748.827) [-749.903] (-751.596) * (-750.855) (-750.209) (-753.102) [-749.938] -- 0:00:22
657500 -- [-748.016] (-748.354) (-749.186) (-749.585) * (-749.606) (-751.020) (-749.105) [-751.400] -- 0:00:22
658000 -- (-748.177) (-748.342) (-748.467) [-748.708] * [-748.954] (-750.625) (-749.918) (-749.816) -- 0:00:22
658500 -- (-748.345) [-749.032] (-749.430) (-749.259) * (-751.435) (-752.426) (-748.313) [-749.406] -- 0:00:22
659000 -- (-751.433) (-749.074) [-750.213] (-748.932) * [-749.806] (-755.980) (-748.028) (-748.669) -- 0:00:22
659500 -- [-750.220] (-748.994) (-749.136) (-752.206) * (-750.146) (-750.134) (-748.415) [-751.033] -- 0:00:22
660000 -- (-748.351) [-750.123] (-750.473) (-751.969) * (-751.203) (-749.625) [-748.806] (-751.047) -- 0:00:22
Average standard deviation of split frequencies: 0.012844
660500 -- [-750.519] (-750.038) (-751.536) (-750.685) * (-750.324) [-751.463] (-749.499) (-752.674) -- 0:00:22
661000 -- [-748.434] (-751.702) (-753.830) (-752.134) * [-748.912] (-757.051) (-751.287) (-754.830) -- 0:00:22
661500 -- [-750.254] (-751.640) (-749.054) (-752.802) * (-748.511) [-755.024] (-750.784) (-752.221) -- 0:00:22
662000 -- (-749.919) (-751.179) (-753.149) [-754.596] * [-751.995] (-753.570) (-750.319) (-751.220) -- 0:00:21
662500 -- (-749.965) (-750.553) [-748.354] (-749.365) * (-751.166) [-751.005] (-751.361) (-749.747) -- 0:00:21
663000 -- (-750.881) (-750.622) (-752.072) [-749.349] * (-749.852) (-751.480) [-753.413] (-750.886) -- 0:00:21
663500 -- (-749.807) (-750.546) (-748.318) [-749.414] * (-751.716) (-751.013) (-754.477) [-754.329] -- 0:00:21
664000 -- (-749.190) (-753.671) [-749.320] (-751.229) * (-749.874) (-750.333) (-752.164) [-749.764] -- 0:00:22
664500 -- (-749.883) (-753.645) (-754.305) [-749.460] * [-748.469] (-748.631) (-749.294) (-749.714) -- 0:00:22
665000 -- [-751.775] (-747.924) (-750.630) (-748.476) * (-749.267) [-751.241] (-750.634) (-751.668) -- 0:00:22
Average standard deviation of split frequencies: 0.012599
665500 -- [-749.255] (-748.213) (-748.713) (-751.633) * (-749.633) (-753.047) [-752.244] (-749.610) -- 0:00:22
666000 -- [-752.089] (-750.211) (-749.065) (-752.810) * [-749.194] (-755.949) (-750.008) (-748.320) -- 0:00:22
666500 -- (-749.105) [-749.847] (-749.697) (-751.910) * (-753.235) [-749.983] (-748.500) (-751.860) -- 0:00:22
667000 -- (-749.712) (-748.914) [-751.997] (-751.645) * [-748.556] (-750.070) (-749.304) (-749.662) -- 0:00:21
667500 -- (-750.972) [-748.736] (-750.732) (-749.051) * [-749.396] (-750.712) (-750.054) (-749.042) -- 0:00:21
668000 -- (-750.550) (-748.344) [-748.621] (-749.135) * (-751.947) (-749.073) (-750.530) [-748.246] -- 0:00:21
668500 -- (-750.795) [-748.286] (-748.210) (-751.303) * (-751.540) (-749.289) (-750.561) [-751.677] -- 0:00:21
669000 -- [-752.953] (-752.569) (-749.958) (-750.215) * [-752.761] (-750.427) (-750.753) (-749.780) -- 0:00:21
669500 -- (-753.563) (-750.787) [-748.557] (-748.146) * (-750.772) (-754.427) [-750.155] (-749.349) -- 0:00:21
670000 -- (-751.898) (-751.883) [-748.912] (-754.802) * (-749.835) (-748.844) (-750.588) [-751.038] -- 0:00:21
Average standard deviation of split frequencies: 0.012558
670500 -- (-754.548) (-749.903) [-749.801] (-751.413) * (-747.793) [-748.155] (-752.835) (-748.414) -- 0:00:21
671000 -- (-748.192) [-753.759] (-749.639) (-749.044) * (-748.683) (-749.874) (-750.122) [-748.381] -- 0:00:21
671500 -- (-748.828) [-749.588] (-749.719) (-748.544) * (-751.906) (-748.801) [-748.337] (-748.687) -- 0:00:21
672000 -- (-748.168) (-750.632) [-751.369] (-749.548) * (-751.543) [-748.327] (-752.920) (-748.247) -- 0:00:21
672500 -- (-749.883) [-748.774] (-751.105) (-753.302) * (-752.817) [-748.770] (-749.674) (-751.363) -- 0:00:21
673000 -- (-753.073) (-752.136) (-750.618) [-750.629] * (-748.869) (-752.143) [-749.914] (-750.198) -- 0:00:21
673500 -- (-750.271) (-749.297) [-749.947] (-750.576) * (-750.304) (-750.609) (-748.986) [-752.649] -- 0:00:21
674000 -- (-754.051) (-749.913) [-748.707] (-754.586) * (-752.211) (-749.839) [-751.838] (-749.673) -- 0:00:21
674500 -- (-749.202) [-749.362] (-749.388) (-751.178) * (-752.248) [-751.929] (-752.825) (-749.715) -- 0:00:21
675000 -- (-749.421) (-750.229) (-749.927) [-754.618] * (-750.648) (-748.753) (-750.688) [-748.885] -- 0:00:21
Average standard deviation of split frequencies: 0.012645
675500 -- (-750.454) [-751.168] (-750.748) (-750.604) * (-749.403) (-750.563) [-750.964] (-750.462) -- 0:00:21
676000 -- (-748.592) (-751.575) (-749.294) [-749.459] * [-751.619] (-751.059) (-749.937) (-748.733) -- 0:00:21
676500 -- [-751.002] (-753.176) (-747.958) (-748.954) * (-748.811) (-751.748) (-748.928) [-748.656] -- 0:00:21
677000 -- (-749.536) (-751.324) (-750.965) [-748.395] * (-751.579) (-749.203) (-749.442) [-748.781] -- 0:00:20
677500 -- [-749.224] (-753.714) (-752.351) (-749.473) * [-748.921] (-748.863) (-751.718) (-750.442) -- 0:00:20
678000 -- [-749.047] (-749.585) (-749.447) (-748.231) * (-749.894) [-747.866] (-748.317) (-749.497) -- 0:00:20
678500 -- [-749.468] (-752.460) (-748.493) (-750.259) * (-750.466) [-749.488] (-749.891) (-749.579) -- 0:00:20
679000 -- (-751.256) (-751.620) (-748.880) [-748.816] * (-749.056) (-749.019) [-751.663] (-748.113) -- 0:00:20
679500 -- [-751.655] (-752.046) (-751.246) (-749.318) * (-751.028) (-748.379) [-750.958] (-749.483) -- 0:00:20
680000 -- [-751.737] (-751.868) (-749.292) (-747.899) * [-749.883] (-750.737) (-749.745) (-749.605) -- 0:00:20
Average standard deviation of split frequencies: 0.011681
680500 -- (-750.018) (-752.684) [-748.966] (-748.122) * (-748.117) [-749.516] (-756.284) (-750.537) -- 0:00:21
681000 -- (-751.558) (-750.821) (-751.757) [-752.462] * (-752.769) [-748.614] (-753.002) (-753.886) -- 0:00:21
681500 -- [-750.597] (-749.624) (-751.579) (-751.948) * (-749.710) (-750.231) [-749.264] (-752.086) -- 0:00:21
682000 -- (-749.484) (-752.556) (-748.750) [-750.635] * [-749.175] (-750.387) (-750.605) (-750.943) -- 0:00:20
682500 -- [-748.217] (-754.523) (-748.642) (-749.175) * (-752.188) (-749.024) [-749.365] (-749.653) -- 0:00:20
683000 -- (-750.795) (-757.454) (-749.518) [-749.232] * (-748.830) [-749.391] (-751.981) (-750.167) -- 0:00:20
683500 -- (-753.495) (-753.746) (-750.411) [-751.117] * [-750.748] (-750.835) (-752.191) (-751.747) -- 0:00:20
684000 -- (-751.434) (-750.559) [-749.474] (-750.626) * (-749.521) [-752.150] (-751.815) (-752.075) -- 0:00:20
684500 -- [-749.261] (-749.604) (-748.740) (-750.309) * (-750.949) (-749.914) (-751.797) [-749.975] -- 0:00:20
685000 -- (-750.028) (-748.849) (-750.558) [-750.377] * (-749.882) [-748.241] (-749.795) (-750.656) -- 0:00:20
Average standard deviation of split frequencies: 0.011590
685500 -- (-749.993) [-748.005] (-752.967) (-751.258) * (-748.408) (-748.902) [-750.032] (-750.033) -- 0:00:20
686000 -- (-750.171) (-748.427) (-749.415) [-750.477] * (-750.682) (-751.007) (-752.462) [-753.346] -- 0:00:20
686500 -- (-749.266) (-749.289) (-748.867) [-755.934] * [-749.963] (-751.110) (-752.699) (-751.549) -- 0:00:20
687000 -- [-749.326] (-750.458) (-749.149) (-749.502) * (-749.364) [-749.324] (-749.090) (-750.124) -- 0:00:20
687500 -- [-750.218] (-751.042) (-749.594) (-750.064) * [-751.891] (-750.920) (-748.849) (-752.216) -- 0:00:20
688000 -- (-749.289) (-748.143) [-748.450] (-750.132) * (-748.449) [-750.485] (-749.519) (-751.276) -- 0:00:20
688500 -- (-750.087) (-748.143) [-749.705] (-749.798) * (-750.105) [-751.273] (-748.231) (-749.425) -- 0:00:20
689000 -- [-749.383] (-750.343) (-753.061) (-749.981) * (-749.065) (-749.741) [-749.095] (-748.779) -- 0:00:20
689500 -- [-749.582] (-750.815) (-748.662) (-749.696) * [-755.680] (-750.810) (-749.919) (-749.285) -- 0:00:20
690000 -- (-750.495) (-751.739) (-750.824) [-755.918] * (-754.116) [-748.439] (-749.262) (-749.920) -- 0:00:20
Average standard deviation of split frequencies: 0.011831
690500 -- (-750.123) (-756.824) (-749.953) [-752.170] * (-754.623) (-749.597) [-750.750] (-750.411) -- 0:00:20
691000 -- (-751.837) (-749.576) (-748.303) [-756.000] * (-753.631) [-748.327] (-752.848) (-749.290) -- 0:00:20
691500 -- (-749.341) (-748.853) (-748.563) [-756.021] * (-752.050) (-750.885) (-754.396) [-751.568] -- 0:00:20
692000 -- [-749.580] (-753.392) (-748.271) (-749.466) * (-753.093) (-753.053) (-752.243) [-749.749] -- 0:00:20
692500 -- [-750.562] (-750.226) (-750.386) (-749.684) * (-749.669) (-749.380) [-752.685] (-749.861) -- 0:00:19
693000 -- (-749.229) [-750.860] (-750.081) (-750.112) * (-750.276) (-751.175) [-751.304] (-748.517) -- 0:00:19
693500 -- (-747.942) (-750.954) [-748.971] (-751.017) * (-751.283) (-748.950) (-752.736) [-749.875] -- 0:00:19
694000 -- (-753.678) (-748.325) (-749.679) [-749.317] * (-752.507) (-749.843) (-751.708) [-747.885] -- 0:00:19
694500 -- [-753.021] (-752.400) (-748.380) (-749.087) * (-752.079) (-751.052) (-750.744) [-748.531] -- 0:00:19
695000 -- (-754.125) (-750.511) [-748.863] (-748.956) * (-750.149) [-750.004] (-749.333) (-755.078) -- 0:00:19
Average standard deviation of split frequencies: 0.011559
695500 -- [-748.095] (-751.585) (-748.312) (-750.467) * (-755.508) [-755.510] (-748.212) (-750.275) -- 0:00:19
696000 -- (-751.785) (-749.891) (-750.654) [-755.709] * (-749.161) [-749.590] (-753.926) (-753.098) -- 0:00:19
696500 -- (-750.393) (-750.417) (-752.042) [-752.632] * [-748.892] (-751.307) (-752.973) (-748.391) -- 0:00:19
697000 -- [-751.203] (-750.806) (-751.467) (-750.622) * (-750.970) (-752.028) [-749.600] (-753.321) -- 0:00:19
697500 -- [-749.108] (-749.947) (-748.233) (-751.110) * (-749.378) (-748.300) [-749.134] (-748.762) -- 0:00:19
698000 -- [-751.211] (-750.087) (-752.487) (-748.992) * (-749.516) (-747.916) (-749.249) [-749.329] -- 0:00:19
698500 -- (-750.043) (-748.490) (-751.766) [-748.915] * (-748.280) (-751.920) (-750.492) [-751.866] -- 0:00:19
699000 -- [-749.336] (-749.455) (-751.368) (-748.030) * [-749.295] (-749.219) (-758.869) (-749.408) -- 0:00:19
699500 -- [-748.412] (-748.220) (-749.702) (-750.425) * (-750.197) [-751.056] (-755.958) (-752.284) -- 0:00:19
700000 -- (-748.250) [-748.411] (-749.643) (-748.546) * [-752.266] (-749.569) (-749.618) (-749.246) -- 0:00:19
Average standard deviation of split frequencies: 0.011303
700500 -- [-749.041] (-748.232) (-751.378) (-750.075) * (-751.842) (-750.762) (-749.872) [-748.737] -- 0:00:19
701000 -- (-752.644) (-751.835) [-751.552] (-750.282) * (-752.646) [-754.703] (-751.896) (-750.137) -- 0:00:19
701500 -- (-752.419) [-751.655] (-754.634) (-749.120) * (-749.342) [-747.764] (-752.051) (-752.496) -- 0:00:19
702000 -- (-750.282) (-750.129) (-751.618) [-748.694] * (-749.963) [-748.167] (-751.005) (-749.020) -- 0:00:19
702500 -- (-749.096) (-748.477) [-749.049] (-749.067) * (-749.747) (-748.991) [-751.446] (-750.427) -- 0:00:19
703000 -- (-749.235) [-750.336] (-750.113) (-749.581) * (-748.879) (-752.406) [-750.907] (-749.597) -- 0:00:19
703500 -- (-750.348) [-749.413] (-751.027) (-749.278) * (-751.298) [-748.488] (-748.287) (-754.272) -- 0:00:19
704000 -- [-749.090] (-749.251) (-749.306) (-749.326) * [-750.013] (-750.428) (-748.227) (-750.714) -- 0:00:19
704500 -- (-749.103) [-748.916] (-748.090) (-751.493) * (-749.556) (-749.482) (-749.484) [-752.311] -- 0:00:19
705000 -- [-748.838] (-749.224) (-750.198) (-749.505) * (-749.444) (-750.904) (-749.130) [-751.443] -- 0:00:19
Average standard deviation of split frequencies: 0.011440
705500 -- (-749.165) (-749.278) (-749.917) [-748.949] * (-751.536) (-753.676) [-749.539] (-751.056) -- 0:00:19
706000 -- (-747.894) [-749.125] (-753.659) (-750.375) * [-752.354] (-752.482) (-749.161) (-752.006) -- 0:00:19
706500 -- (-749.018) (-749.074) [-753.103] (-753.194) * (-756.651) (-753.088) (-751.808) [-758.056] -- 0:00:19
707000 -- (-748.137) (-748.216) (-749.953) [-751.607] * (-749.996) [-750.789] (-749.893) (-752.390) -- 0:00:19
707500 -- (-753.881) (-753.831) (-751.817) [-753.137] * (-756.715) (-755.519) (-749.356) [-750.455] -- 0:00:19
708000 -- (-759.195) (-752.246) [-749.673] (-749.996) * (-750.161) (-749.160) [-749.139] (-751.177) -- 0:00:18
708500 -- [-753.023] (-750.934) (-751.633) (-749.122) * (-750.365) [-748.490] (-753.153) (-752.573) -- 0:00:18
709000 -- (-750.215) (-750.299) [-750.174] (-751.042) * [-751.208] (-752.074) (-750.662) (-749.864) -- 0:00:18
709500 -- (-749.235) [-749.562] (-752.731) (-750.060) * (-750.875) [-749.491] (-751.176) (-753.669) -- 0:00:18
710000 -- [-750.053] (-749.370) (-750.001) (-753.657) * (-750.215) [-749.060] (-750.725) (-751.702) -- 0:00:18
Average standard deviation of split frequencies: 0.011851
710500 -- (-753.683) (-750.395) [-753.690] (-752.566) * [-752.770] (-749.250) (-748.335) (-751.210) -- 0:00:18
711000 -- (-750.773) (-750.527) (-750.934) [-750.316] * (-749.689) [-752.518] (-750.835) (-749.022) -- 0:00:18
711500 -- (-749.964) (-750.378) (-753.081) [-750.420] * (-752.384) (-751.741) (-749.608) [-752.635] -- 0:00:18
712000 -- (-750.469) [-750.669] (-749.442) (-748.963) * [-750.216] (-748.567) (-752.375) (-751.099) -- 0:00:18
712500 -- (-748.573) (-751.486) (-751.231) [-750.150] * [-748.080] (-751.897) (-749.468) (-750.421) -- 0:00:18
713000 -- (-749.418) (-750.412) (-748.486) [-748.650] * [-750.596] (-749.828) (-754.342) (-750.401) -- 0:00:18
713500 -- (-748.960) (-753.809) (-748.668) [-748.582] * [-753.312] (-750.390) (-752.929) (-750.251) -- 0:00:18
714000 -- (-748.065) (-749.225) [-749.061] (-750.216) * (-752.478) [-751.131] (-751.469) (-753.610) -- 0:00:18
714500 -- (-749.586) (-751.090) [-749.484] (-751.513) * [-750.012] (-749.167) (-750.115) (-754.040) -- 0:00:18
715000 -- (-748.655) (-752.464) [-749.034] (-751.455) * (-752.087) [-753.178] (-748.332) (-754.121) -- 0:00:18
Average standard deviation of split frequencies: 0.011280
715500 -- (-755.282) (-750.505) [-756.854] (-750.315) * (-755.799) (-750.628) [-753.727] (-751.405) -- 0:00:18
716000 -- (-750.051) (-749.328) [-754.364] (-748.924) * [-751.197] (-749.309) (-749.814) (-751.888) -- 0:00:18
716500 -- (-749.022) [-748.975] (-753.369) (-749.976) * (-749.049) (-751.241) (-750.040) [-752.208] -- 0:00:18
717000 -- [-749.486] (-749.067) (-749.202) (-749.557) * (-749.065) [-750.659] (-749.628) (-748.544) -- 0:00:18
717500 -- (-750.258) (-750.063) (-753.174) [-750.158] * [-750.820] (-748.426) (-750.057) (-748.500) -- 0:00:18
718000 -- (-751.358) (-751.106) [-749.202] (-752.324) * [-752.307] (-748.759) (-750.230) (-750.067) -- 0:00:18
718500 -- (-751.478) (-751.267) (-750.589) [-751.764] * (-757.170) (-752.912) [-750.290] (-747.784) -- 0:00:18
719000 -- [-753.214] (-749.700) (-751.954) (-751.305) * (-751.791) (-752.715) (-747.739) [-748.164] -- 0:00:18
719500 -- (-748.888) (-752.158) (-748.177) [-751.855] * (-752.419) [-748.973] (-750.220) (-751.787) -- 0:00:18
720000 -- (-749.775) [-748.953] (-750.337) (-749.362) * (-750.782) (-750.064) (-749.935) [-749.074] -- 0:00:18
Average standard deviation of split frequencies: 0.010815
720500 -- (-748.654) (-749.922) [-751.418] (-750.520) * (-752.339) (-749.800) (-753.580) [-749.526] -- 0:00:18
721000 -- (-751.634) [-748.707] (-748.172) (-750.648) * (-753.455) (-753.055) [-755.066] (-750.403) -- 0:00:18
721500 -- (-750.907) (-749.246) [-748.305] (-752.216) * (-751.239) [-751.628] (-750.669) (-749.730) -- 0:00:18
722000 -- (-750.798) (-749.461) [-749.570] (-750.572) * (-749.927) [-749.286] (-750.877) (-749.198) -- 0:00:18
722500 -- (-752.993) (-748.671) (-750.255) [-750.673] * [-751.305] (-749.141) (-753.337) (-750.576) -- 0:00:18
723000 -- (-757.310) (-749.068) [-749.573] (-751.928) * (-750.583) (-748.459) [-751.148] (-751.763) -- 0:00:18
723500 -- (-753.441) [-750.907] (-750.601) (-752.679) * (-750.449) [-748.518] (-752.801) (-750.236) -- 0:00:17
724000 -- (-753.227) (-755.838) (-748.938) [-749.255] * [-750.967] (-748.536) (-751.117) (-749.366) -- 0:00:17
724500 -- [-753.783] (-757.083) (-751.354) (-749.771) * (-752.559) (-748.262) [-751.517] (-750.023) -- 0:00:17
725000 -- (-750.914) (-753.716) (-751.120) [-750.617] * (-753.475) (-749.656) (-749.341) [-751.132] -- 0:00:17
Average standard deviation of split frequencies: 0.011038
725500 -- [-749.693] (-749.434) (-749.759) (-750.229) * (-753.051) (-750.574) [-750.830] (-750.662) -- 0:00:17
726000 -- (-748.701) (-749.000) [-748.951] (-754.348) * (-751.972) (-750.436) [-750.639] (-750.920) -- 0:00:17
726500 -- (-749.190) (-748.570) [-749.620] (-748.229) * (-751.414) [-748.127] (-751.428) (-748.470) -- 0:00:17
727000 -- (-753.162) [-752.170] (-747.952) (-748.781) * (-748.826) (-748.189) [-748.719] (-750.776) -- 0:00:17
727500 -- (-751.205) (-747.916) (-752.498) [-752.081] * (-748.827) (-751.269) [-751.249] (-748.258) -- 0:00:17
728000 -- (-751.982) (-749.597) (-753.420) [-749.623] * (-748.174) (-749.782) (-754.733) [-748.695] -- 0:00:17
728500 -- [-750.585] (-753.337) (-753.768) (-748.450) * [-749.013] (-750.769) (-749.763) (-749.320) -- 0:00:17
729000 -- [-750.811] (-751.244) (-753.767) (-751.834) * (-750.691) (-750.708) (-753.438) [-748.338] -- 0:00:17
729500 -- (-750.931) (-748.816) [-751.484] (-754.272) * [-751.158] (-750.047) (-748.924) (-749.801) -- 0:00:17
730000 -- (-753.354) (-748.996) [-749.277] (-749.923) * (-749.609) [-749.101] (-749.231) (-751.757) -- 0:00:17
Average standard deviation of split frequencies: 0.011527
730500 -- (-748.278) (-750.887) [-752.394] (-749.778) * [-751.478] (-748.665) (-751.869) (-750.954) -- 0:00:17
731000 -- (-749.121) [-749.863] (-752.502) (-750.236) * [-749.714] (-749.572) (-755.553) (-754.734) -- 0:00:17
731500 -- (-748.276) (-749.123) (-749.433) [-752.459] * [-749.506] (-750.817) (-749.920) (-755.017) -- 0:00:17
732000 -- (-748.917) (-748.551) [-748.932] (-751.916) * (-751.893) [-750.548] (-752.303) (-750.334) -- 0:00:17
732500 -- (-753.569) [-750.514] (-749.148) (-753.485) * (-749.739) (-750.141) (-752.082) [-750.260] -- 0:00:17
733000 -- [-750.805] (-750.074) (-748.452) (-749.562) * (-754.239) [-748.921] (-752.280) (-749.130) -- 0:00:17
733500 -- (-751.197) (-752.235) [-755.255] (-751.478) * (-753.247) [-750.239] (-756.152) (-750.147) -- 0:00:17
734000 -- (-752.238) (-752.613) [-752.714] (-748.701) * (-750.484) (-752.596) (-751.306) [-751.241] -- 0:00:17
734500 -- (-753.718) (-748.895) (-752.416) [-748.469] * (-752.224) (-752.609) [-750.670] (-750.502) -- 0:00:17
735000 -- (-750.832) (-751.998) [-753.592] (-750.211) * (-748.669) (-750.730) [-748.565] (-750.274) -- 0:00:17
Average standard deviation of split frequencies: 0.011785
735500 -- (-749.858) [-751.374] (-751.288) (-749.362) * (-750.425) (-753.266) [-748.525] (-751.284) -- 0:00:17
736000 -- [-748.584] (-749.217) (-748.699) (-750.634) * [-753.095] (-748.629) (-749.098) (-750.797) -- 0:00:17
736500 -- (-749.135) [-748.961] (-748.707) (-750.070) * (-751.075) (-750.938) [-752.347] (-752.611) -- 0:00:17
737000 -- (-754.014) (-749.683) [-750.002] (-750.253) * [-751.989] (-751.178) (-750.424) (-751.564) -- 0:00:17
737500 -- (-751.866) (-753.013) (-748.509) [-748.825] * [-753.039] (-753.558) (-752.217) (-753.725) -- 0:00:17
738000 -- (-748.953) (-749.732) [-750.692] (-748.583) * [-750.847] (-752.484) (-751.411) (-750.206) -- 0:00:17
738500 -- [-750.622] (-749.986) (-748.031) (-750.742) * (-750.261) (-749.759) (-749.459) [-749.554] -- 0:00:16
739000 -- (-748.961) [-749.370] (-749.518) (-752.945) * (-750.104) (-748.238) [-748.234] (-748.935) -- 0:00:16
739500 -- [-749.523] (-749.039) (-748.699) (-751.943) * (-749.405) (-748.812) [-749.663] (-749.035) -- 0:00:16
740000 -- (-749.892) (-748.830) [-748.057] (-748.832) * (-750.732) [-748.329] (-752.591) (-751.010) -- 0:00:16
Average standard deviation of split frequencies: 0.011838
740500 -- (-753.614) (-749.947) (-749.458) [-748.646] * [-756.524] (-753.612) (-751.477) (-748.571) -- 0:00:16
741000 -- [-750.630] (-752.605) (-753.835) (-748.540) * (-753.762) (-756.195) [-749.640] (-749.270) -- 0:00:16
741500 -- (-748.902) (-750.761) [-749.116] (-750.109) * (-753.846) (-753.304) (-750.552) [-751.067] -- 0:00:16
742000 -- (-754.034) (-750.372) (-755.784) [-753.089] * (-752.534) [-749.535] (-752.483) (-752.847) -- 0:00:16
742500 -- (-749.943) (-749.328) (-749.792) [-748.976] * (-748.598) (-749.072) (-755.984) [-751.028] -- 0:00:16
743000 -- [-750.443] (-748.697) (-751.351) (-748.903) * [-749.584] (-749.441) (-750.967) (-749.382) -- 0:00:16
743500 -- [-751.526] (-748.593) (-750.256) (-748.904) * (-750.444) (-749.561) (-750.254) [-748.798] -- 0:00:16
744000 -- (-751.052) (-750.650) (-749.750) [-748.688] * (-751.828) (-750.279) [-753.744] (-749.143) -- 0:00:16
744500 -- [-750.884] (-753.764) (-750.427) (-749.224) * (-751.148) (-750.500) [-752.587] (-749.702) -- 0:00:16
745000 -- [-749.053] (-755.962) (-752.072) (-749.337) * (-749.615) [-749.917] (-750.653) (-748.906) -- 0:00:16
Average standard deviation of split frequencies: 0.011796
745500 -- (-748.616) (-754.457) (-752.567) [-751.657] * (-749.404) (-750.286) [-749.273] (-749.832) -- 0:00:16
746000 -- (-748.047) [-754.561] (-748.943) (-748.565) * (-750.701) [-753.762] (-750.465) (-749.502) -- 0:00:16
746500 -- (-749.105) [-751.197] (-750.973) (-748.424) * (-750.490) [-750.336] (-750.242) (-748.057) -- 0:00:16
747000 -- (-749.405) (-751.108) (-751.683) [-748.606] * (-748.910) (-754.976) (-757.800) [-749.946] -- 0:00:16
747500 -- [-751.473] (-748.488) (-750.708) (-751.021) * (-749.059) (-750.372) [-750.144] (-750.891) -- 0:00:16
748000 -- [-750.139] (-749.536) (-748.376) (-752.581) * (-749.988) (-749.009) (-749.644) [-749.204] -- 0:00:16
748500 -- [-749.416] (-749.100) (-752.284) (-752.580) * (-747.869) [-749.290] (-751.614) (-749.254) -- 0:00:16
749000 -- (-749.044) (-750.371) (-750.157) [-749.306] * (-748.759) [-749.921] (-751.048) (-750.327) -- 0:00:16
749500 -- (-749.703) (-749.763) (-749.170) [-748.528] * (-749.082) (-751.541) (-752.344) [-750.431] -- 0:00:16
750000 -- (-752.148) (-748.876) (-749.948) [-751.251] * [-750.089] (-752.458) (-750.019) (-751.652) -- 0:00:16
Average standard deviation of split frequencies: 0.011555
750500 -- (-750.429) [-750.634] (-750.641) (-750.416) * [-751.313] (-751.599) (-748.820) (-753.807) -- 0:00:16
751000 -- (-754.274) (-750.784) [-752.094] (-749.118) * [-749.188] (-752.606) (-749.447) (-752.291) -- 0:00:16
751500 -- (-748.834) [-754.849] (-750.367) (-749.131) * [-749.857] (-748.940) (-749.801) (-749.106) -- 0:00:16
752000 -- (-749.114) [-748.941] (-750.185) (-749.653) * (-754.254) (-749.204) [-748.609] (-750.300) -- 0:00:16
752500 -- [-752.818] (-749.194) (-749.602) (-753.818) * [-750.164] (-749.231) (-750.119) (-749.365) -- 0:00:16
753000 -- [-751.767] (-750.284) (-754.281) (-750.432) * (-750.736) (-749.694) (-751.447) [-750.008] -- 0:00:16
753500 -- (-751.139) [-749.627] (-748.195) (-752.502) * (-749.032) (-753.936) [-752.292] (-748.400) -- 0:00:16
754000 -- (-752.997) (-751.285) (-749.384) [-748.454] * (-750.546) (-755.760) [-752.053] (-750.195) -- 0:00:15
754500 -- (-751.759) [-753.567] (-749.407) (-747.983) * [-750.037] (-752.897) (-750.672) (-748.444) -- 0:00:15
755000 -- (-752.126) (-750.691) [-749.291] (-749.701) * (-750.684) (-751.390) (-748.651) [-748.444] -- 0:00:15
Average standard deviation of split frequencies: 0.011224
755500 -- (-752.287) (-748.793) (-748.573) [-749.535] * (-750.672) (-749.217) [-750.249] (-749.586) -- 0:00:15
756000 -- (-751.602) (-750.536) [-750.122] (-749.223) * [-752.555] (-750.016) (-749.273) (-750.930) -- 0:00:15
756500 -- (-753.031) [-753.200] (-750.877) (-750.137) * [-748.080] (-748.988) (-752.401) (-751.100) -- 0:00:15
757000 -- (-749.136) (-751.598) (-751.185) [-757.562] * [-749.665] (-749.609) (-750.132) (-752.610) -- 0:00:15
757500 -- (-751.480) (-750.576) [-748.411] (-749.840) * (-751.289) [-749.641] (-751.514) (-750.084) -- 0:00:15
758000 -- [-751.741] (-751.047) (-748.409) (-749.496) * (-749.545) (-750.486) (-749.911) [-748.473] -- 0:00:15
758500 -- (-748.726) (-752.329) (-748.110) [-750.583] * (-753.928) [-749.677] (-750.152) (-752.316) -- 0:00:15
759000 -- [-749.136] (-749.549) (-749.568) (-750.045) * [-752.012] (-753.886) (-749.794) (-751.405) -- 0:00:15
759500 -- (-753.146) (-749.898) [-748.379] (-751.550) * [-749.585] (-755.358) (-751.036) (-750.475) -- 0:00:15
760000 -- [-748.749] (-749.153) (-749.416) (-749.643) * (-748.753) [-748.971] (-749.758) (-749.292) -- 0:00:15
Average standard deviation of split frequencies: 0.010907
760500 -- [-750.392] (-751.267) (-748.961) (-751.621) * [-750.244] (-749.382) (-749.158) (-751.698) -- 0:00:15
761000 -- (-748.143) (-749.695) [-749.070] (-749.461) * (-750.851) (-755.737) [-748.380] (-751.153) -- 0:00:15
761500 -- (-748.813) (-755.097) (-754.012) [-751.446] * (-749.207) [-749.393] (-749.001) (-752.195) -- 0:00:15
762000 -- (-750.423) (-750.309) [-751.168] (-754.662) * (-759.385) (-750.177) (-750.494) [-748.612] -- 0:00:15
762500 -- (-751.205) [-750.171] (-748.241) (-749.182) * (-751.078) (-749.521) (-748.216) [-748.988] -- 0:00:15
763000 -- (-751.949) (-750.304) [-749.180] (-748.563) * (-748.281) (-750.190) (-752.923) [-749.213] -- 0:00:15
763500 -- (-749.747) [-750.295] (-749.262) (-755.339) * (-751.282) [-751.032] (-749.099) (-751.544) -- 0:00:15
764000 -- (-749.470) (-748.537) (-753.279) [-749.905] * (-749.946) [-749.488] (-752.677) (-750.090) -- 0:00:15
764500 -- (-752.909) [-748.511] (-759.024) (-750.916) * (-750.176) (-749.190) (-749.440) [-749.710] -- 0:00:15
765000 -- (-751.623) [-749.318] (-754.348) (-750.641) * (-747.889) (-748.905) [-748.603] (-750.095) -- 0:00:15
Average standard deviation of split frequencies: 0.011036
765500 -- (-750.071) (-748.436) [-752.220] (-750.791) * (-752.194) (-752.795) [-751.414] (-751.568) -- 0:00:15
766000 -- [-748.555] (-750.194) (-751.204) (-754.965) * (-748.193) (-750.247) (-749.280) [-749.280] -- 0:00:15
766500 -- [-749.378] (-749.147) (-751.232) (-750.088) * (-749.140) (-749.878) [-751.421] (-748.493) -- 0:00:15
767000 -- (-751.000) [-748.084] (-749.454) (-750.886) * (-748.696) (-749.870) (-753.834) [-748.514] -- 0:00:15
767500 -- (-750.525) (-752.311) (-751.350) [-748.438] * (-751.407) (-753.223) (-749.698) [-748.771] -- 0:00:15
768000 -- (-753.648) (-756.740) [-750.309] (-748.634) * [-753.877] (-758.660) (-749.689) (-751.461) -- 0:00:15
768500 -- [-748.830] (-752.410) (-754.568) (-750.185) * (-751.538) [-749.809] (-749.563) (-750.103) -- 0:00:15
769000 -- (-752.087) [-749.287] (-754.026) (-751.036) * (-752.148) (-749.161) [-749.286] (-751.749) -- 0:00:15
769500 -- (-750.197) (-749.698) (-752.794) [-750.393] * [-750.951] (-750.493) (-752.015) (-752.843) -- 0:00:14
770000 -- [-752.230] (-751.247) (-750.049) (-751.598) * (-750.355) [-749.721] (-751.560) (-750.961) -- 0:00:14
Average standard deviation of split frequencies: 0.010970
770500 -- (-749.060) (-749.146) (-748.422) [-750.816] * (-751.791) (-749.571) [-749.944] (-749.994) -- 0:00:14
771000 -- (-751.696) (-749.013) [-748.637] (-748.070) * [-753.672] (-750.127) (-751.371) (-751.829) -- 0:00:14
771500 -- (-751.527) (-749.221) (-747.900) [-749.732] * [-749.355] (-751.831) (-749.478) (-749.900) -- 0:00:14
772000 -- [-748.552] (-748.888) (-751.546) (-748.424) * (-748.884) (-749.121) (-750.483) [-751.444] -- 0:00:14
772500 -- [-750.925] (-749.435) (-755.179) (-753.044) * (-752.500) (-748.938) (-750.311) [-748.590] -- 0:00:14
773000 -- [-749.844] (-750.487) (-751.927) (-748.254) * [-748.167] (-748.935) (-750.656) (-751.908) -- 0:00:14
773500 -- (-749.559) (-749.191) [-748.173] (-751.964) * (-748.128) [-748.528] (-749.436) (-754.104) -- 0:00:14
774000 -- (-748.687) (-748.748) [-748.196] (-750.117) * [-748.029] (-748.010) (-751.496) (-748.849) -- 0:00:14
774500 -- (-749.373) [-750.494] (-747.775) (-750.576) * (-748.516) [-749.621] (-750.972) (-749.361) -- 0:00:14
775000 -- (-752.985) [-750.182] (-747.775) (-750.005) * [-749.258] (-748.222) (-748.416) (-750.295) -- 0:00:14
Average standard deviation of split frequencies: 0.010611
775500 -- (-748.669) (-749.474) (-747.771) [-750.176] * (-754.954) [-748.505] (-755.891) (-751.155) -- 0:00:14
776000 -- [-752.292] (-757.303) (-751.425) (-750.148) * (-749.967) (-749.623) (-750.329) [-752.840] -- 0:00:14
776500 -- (-754.410) (-751.326) (-750.242) [-750.068] * [-748.711] (-749.985) (-754.816) (-749.091) -- 0:00:14
777000 -- [-750.960] (-756.789) (-749.975) (-749.335) * (-748.167) [-750.885] (-755.647) (-750.246) -- 0:00:14
777500 -- (-749.918) (-749.573) [-749.854] (-752.347) * [-748.134] (-750.237) (-758.901) (-751.437) -- 0:00:14
778000 -- (-750.853) (-749.463) (-750.102) [-749.383] * (-748.024) (-752.883) (-751.313) [-752.461] -- 0:00:14
778500 -- (-749.824) (-751.752) (-749.672) [-751.046] * (-749.632) (-753.344) [-751.468] (-749.967) -- 0:00:14
779000 -- (-751.957) [-751.209] (-751.995) (-750.361) * (-750.147) [-753.249] (-748.559) (-748.632) -- 0:00:14
779500 -- (-755.447) (-748.677) [-749.731] (-749.019) * (-748.814) (-750.610) (-753.787) [-748.500] -- 0:00:14
780000 -- (-751.620) (-749.555) (-751.910) [-753.610] * (-751.940) (-749.454) (-750.605) [-748.711] -- 0:00:14
Average standard deviation of split frequencies: 0.011191
780500 -- [-754.156] (-749.078) (-751.923) (-754.266) * (-754.031) [-749.594] (-749.333) (-750.649) -- 0:00:14
781000 -- (-754.880) (-749.428) [-749.248] (-752.308) * (-751.694) (-748.252) (-751.184) [-753.005] -- 0:00:14
781500 -- [-753.749] (-749.416) (-751.127) (-751.730) * (-751.634) [-748.161] (-748.989) (-750.686) -- 0:00:14
782000 -- (-749.666) (-748.996) (-749.843) [-749.638] * (-750.059) [-748.638] (-751.166) (-752.915) -- 0:00:14
782500 -- (-750.650) [-755.880] (-750.002) (-748.433) * [-750.195] (-748.692) (-749.655) (-751.023) -- 0:00:14
783000 -- (-751.022) [-748.799] (-749.831) (-748.571) * (-749.227) (-749.737) (-749.663) [-751.303] -- 0:00:14
783500 -- (-748.634) (-751.217) [-750.721] (-750.583) * [-749.434] (-750.480) (-750.208) (-749.538) -- 0:00:14
784000 -- (-750.358) [-750.088] (-748.612) (-750.949) * (-749.938) (-749.621) [-754.211] (-749.548) -- 0:00:14
784500 -- (-749.512) (-751.001) (-749.576) [-751.055] * [-748.642] (-750.165) (-750.395) (-748.681) -- 0:00:14
785000 -- (-750.581) [-752.282] (-750.698) (-749.762) * (-750.375) (-749.584) [-752.113] (-749.093) -- 0:00:13
Average standard deviation of split frequencies: 0.011075
785500 -- [-749.406] (-752.346) (-753.580) (-749.044) * (-750.117) (-752.508) (-749.528) [-750.282] -- 0:00:13
786000 -- (-749.823) [-750.995] (-748.719) (-750.720) * (-751.409) [-749.208] (-752.982) (-753.617) -- 0:00:13
786500 -- (-749.461) (-751.805) (-749.777) [-748.384] * (-749.714) (-749.329) (-749.997) [-752.108] -- 0:00:13
787000 -- (-749.439) (-751.525) (-750.742) [-749.368] * (-750.981) (-751.905) [-752.600] (-750.132) -- 0:00:13
787500 -- (-750.085) (-751.226) [-750.912] (-749.677) * (-750.611) [-750.970] (-754.074) (-749.319) -- 0:00:13
788000 -- (-749.536) (-750.652) [-749.084] (-750.042) * (-748.929) [-751.151] (-755.423) (-751.398) -- 0:00:13
788500 -- (-749.563) (-751.245) [-750.371] (-749.967) * (-749.317) (-751.708) [-749.265] (-750.327) -- 0:00:13
789000 -- (-751.212) (-751.060) (-754.173) [-752.650] * (-753.827) (-753.840) (-748.791) [-748.942] -- 0:00:13
789500 -- (-750.935) (-748.662) [-749.078] (-751.029) * (-749.510) (-749.500) (-749.417) [-748.653] -- 0:00:13
790000 -- (-748.106) (-748.344) (-748.668) [-751.083] * (-749.194) (-750.640) [-748.035] (-752.634) -- 0:00:13
Average standard deviation of split frequencies: 0.010692
790500 -- [-749.435] (-752.446) (-750.752) (-749.358) * (-750.464) (-750.687) [-749.143] (-752.215) -- 0:00:13
791000 -- (-757.023) (-750.378) (-750.330) [-749.325] * [-752.517] (-750.395) (-751.866) (-750.371) -- 0:00:13
791500 -- (-751.098) (-749.058) [-749.408] (-749.303) * (-750.498) (-749.281) [-749.586] (-756.703) -- 0:00:13
792000 -- (-749.964) (-752.817) [-749.030] (-750.793) * [-749.664] (-749.626) (-750.079) (-754.455) -- 0:00:13
792500 -- (-752.118) (-750.491) (-751.609) [-750.091] * (-749.099) (-749.075) (-751.510) [-748.453] -- 0:00:13
793000 -- (-749.052) (-757.846) (-749.369) [-748.851] * (-748.763) [-749.645] (-751.616) (-748.393) -- 0:00:13
793500 -- [-751.453] (-749.782) (-749.502) (-748.424) * [-748.734] (-747.955) (-749.774) (-750.105) -- 0:00:13
794000 -- (-749.038) (-749.604) (-751.787) [-748.483] * (-750.740) [-748.238] (-750.519) (-749.283) -- 0:00:13
794500 -- (-750.170) (-748.493) [-754.236] (-750.309) * (-751.031) [-748.327] (-754.824) (-751.747) -- 0:00:13
795000 -- (-748.235) (-749.905) [-751.901] (-753.558) * (-750.812) [-750.237] (-751.077) (-750.202) -- 0:00:13
Average standard deviation of split frequencies: 0.010147
795500 -- (-748.834) (-751.509) (-749.168) [-748.548] * (-750.919) (-747.936) [-749.269] (-748.310) -- 0:00:13
796000 -- (-757.042) (-752.961) (-749.968) [-749.604] * (-750.250) (-749.911) (-748.538) [-748.607] -- 0:00:13
796500 -- (-750.367) [-749.175] (-754.802) (-749.823) * (-748.829) (-750.031) [-749.671] (-748.642) -- 0:00:13
797000 -- (-750.222) (-751.268) [-752.078] (-754.578) * (-749.340) (-749.049) [-749.055] (-750.939) -- 0:00:13
797500 -- (-749.253) (-750.295) [-749.460] (-749.021) * (-749.206) (-749.804) [-749.669] (-751.127) -- 0:00:13
798000 -- [-749.752] (-752.227) (-748.820) (-750.195) * (-749.335) (-750.630) (-751.093) [-749.634] -- 0:00:13
798500 -- (-749.904) (-752.941) [-748.852] (-749.834) * (-749.637) (-750.983) [-749.838] (-751.344) -- 0:00:13
799000 -- (-750.953) [-748.375] (-749.577) (-755.099) * [-750.842] (-750.937) (-751.923) (-753.364) -- 0:00:13
799500 -- (-750.640) (-754.679) (-748.577) [-750.269] * (-753.206) [-748.418] (-752.513) (-749.452) -- 0:00:13
800000 -- [-751.952] (-749.113) (-747.853) (-750.930) * (-749.833) [-748.252] (-750.728) (-750.037) -- 0:00:12
Average standard deviation of split frequencies: 0.010598
800500 -- (-750.021) (-757.569) (-751.161) [-749.579] * (-748.390) (-749.730) (-749.371) [-749.042] -- 0:00:12
801000 -- (-749.766) (-752.020) (-754.964) [-749.243] * (-753.208) [-748.071] (-748.730) (-749.251) -- 0:00:12
801500 -- [-750.629] (-752.036) (-750.371) (-754.476) * (-749.097) (-752.990) (-751.488) [-749.869] -- 0:00:12
802000 -- (-749.852) (-751.793) (-750.914) [-750.876] * (-750.055) (-752.849) (-748.640) [-750.763] -- 0:00:12
802500 -- (-754.038) (-750.942) (-751.271) [-751.263] * [-749.321] (-750.087) (-749.246) (-748.416) -- 0:00:12
803000 -- (-750.457) (-748.326) [-749.533] (-754.667) * (-748.288) (-753.101) [-749.075] (-749.857) -- 0:00:12
803500 -- [-748.746] (-749.796) (-750.150) (-750.457) * [-749.030] (-747.771) (-748.554) (-751.050) -- 0:00:12
804000 -- (-750.249) (-749.440) [-750.141] (-753.659) * (-748.291) (-748.065) [-754.416] (-749.247) -- 0:00:12
804500 -- (-752.188) [-749.434] (-752.343) (-750.191) * (-750.802) (-747.825) [-750.714] (-750.653) -- 0:00:12
805000 -- (-751.413) (-752.017) [-752.004] (-751.619) * [-750.735] (-748.444) (-751.934) (-750.922) -- 0:00:12
Average standard deviation of split frequencies: 0.010801
805500 -- (-748.881) (-749.058) (-749.583) [-751.635] * (-749.248) (-748.680) [-749.893] (-749.630) -- 0:00:12
806000 -- (-748.844) (-751.841) (-749.571) [-749.274] * [-750.471] (-752.544) (-752.075) (-749.093) -- 0:00:12
806500 -- (-749.035) (-749.954) (-751.068) [-749.389] * (-752.280) (-747.988) [-748.313] (-753.373) -- 0:00:12
807000 -- (-748.109) [-750.449] (-751.443) (-748.563) * (-750.306) [-748.407] (-750.985) (-750.507) -- 0:00:12
807500 -- (-753.111) [-750.799] (-751.192) (-750.549) * (-750.090) [-751.247] (-749.202) (-748.991) -- 0:00:12
808000 -- [-751.199] (-753.287) (-752.028) (-752.766) * (-752.928) (-749.038) [-748.931] (-748.851) -- 0:00:12
808500 -- (-748.854) [-749.387] (-749.176) (-749.244) * (-750.434) [-748.100] (-752.629) (-748.640) -- 0:00:12
809000 -- (-749.674) (-748.863) [-753.056] (-753.380) * [-751.519] (-751.644) (-753.799) (-748.505) -- 0:00:12
809500 -- (-749.821) (-750.590) (-754.768) [-750.582] * [-751.849] (-754.141) (-750.968) (-747.818) -- 0:00:12
810000 -- (-749.709) [-747.907] (-749.812) (-750.021) * (-750.887) [-749.405] (-750.136) (-750.387) -- 0:00:12
Average standard deviation of split frequencies: 0.010612
810500 -- (-748.953) [-747.907] (-752.076) (-749.542) * (-748.842) [-749.557] (-751.806) (-749.738) -- 0:00:12
811000 -- [-749.177] (-748.768) (-748.280) (-752.489) * [-749.669] (-749.034) (-752.773) (-750.696) -- 0:00:12
811500 -- (-749.102) (-749.104) (-751.897) [-748.848] * (-753.227) [-748.718] (-750.575) (-750.771) -- 0:00:12
812000 -- (-748.531) [-749.176] (-750.380) (-748.631) * [-749.917] (-751.396) (-750.908) (-750.076) -- 0:00:12
812500 -- [-749.186] (-750.790) (-748.496) (-755.363) * [-751.383] (-749.629) (-751.163) (-749.502) -- 0:00:12
813000 -- (-748.918) [-750.318] (-752.048) (-751.821) * (-752.647) [-750.793] (-751.669) (-748.678) -- 0:00:12
813500 -- (-749.882) (-750.098) [-749.324] (-753.498) * (-750.264) [-751.672] (-748.846) (-750.292) -- 0:00:12
814000 -- [-750.578] (-749.606) (-749.865) (-750.922) * [-751.107] (-752.250) (-749.847) (-751.336) -- 0:00:12
814500 -- (-748.735) (-749.370) (-753.836) [-749.171] * (-749.844) [-749.736] (-750.637) (-749.614) -- 0:00:12
815000 -- (-748.659) (-748.072) (-749.417) [-751.701] * (-750.241) [-748.851] (-750.649) (-754.129) -- 0:00:12
Average standard deviation of split frequencies: 0.010760
815500 -- [-748.262] (-749.070) (-754.109) (-752.280) * [-752.878] (-748.249) (-749.164) (-749.562) -- 0:00:11
816000 -- [-750.562] (-750.155) (-750.946) (-750.768) * (-749.332) (-748.330) (-750.183) [-748.962] -- 0:00:11
816500 -- (-753.449) [-748.307] (-750.017) (-749.961) * (-750.124) (-750.758) (-749.458) [-748.715] -- 0:00:11
817000 -- (-752.371) (-748.805) [-751.003] (-748.775) * (-750.803) [-751.071] (-750.303) (-748.449) -- 0:00:11
817500 -- (-748.469) [-749.781] (-750.946) (-748.834) * (-750.316) [-749.035] (-749.474) (-753.126) -- 0:00:11
818000 -- (-749.549) (-749.038) (-751.669) [-751.503] * (-749.782) [-751.729] (-749.920) (-753.627) -- 0:00:11
818500 -- (-751.127) (-750.656) [-752.531] (-751.097) * (-749.919) [-749.412] (-749.134) (-753.059) -- 0:00:11
819000 -- (-748.151) (-749.470) [-749.492] (-748.549) * (-748.320) [-748.820] (-749.233) (-752.626) -- 0:00:11
819500 -- (-748.776) [-748.688] (-756.299) (-750.639) * (-748.329) (-748.923) [-749.745] (-752.905) -- 0:00:11
820000 -- (-749.275) (-748.832) (-751.870) [-749.092] * [-748.878] (-748.223) (-750.469) (-748.578) -- 0:00:11
Average standard deviation of split frequencies: 0.010986
820500 -- [-749.255] (-748.672) (-751.418) (-748.821) * (-749.178) (-751.044) [-748.867] (-748.812) -- 0:00:11
821000 -- [-749.519] (-751.727) (-749.978) (-752.779) * [-750.826] (-749.104) (-748.056) (-749.628) -- 0:00:11
821500 -- [-749.897] (-751.885) (-749.895) (-751.567) * [-750.916] (-748.557) (-748.408) (-749.229) -- 0:00:11
822000 -- (-751.930) (-748.523) (-748.706) [-750.553] * (-751.702) [-748.670] (-749.361) (-750.394) -- 0:00:11
822500 -- (-748.255) (-748.519) (-749.087) [-750.955] * (-751.656) (-750.931) [-749.831] (-748.947) -- 0:00:11
823000 -- (-750.361) [-756.169] (-750.424) (-753.828) * [-751.047] (-752.418) (-750.565) (-750.637) -- 0:00:11
823500 -- [-755.086] (-751.011) (-748.846) (-751.449) * (-750.927) [-752.453] (-751.379) (-751.254) -- 0:00:11
824000 -- (-750.848) [-751.855] (-750.704) (-749.780) * [-750.249] (-753.451) (-750.930) (-750.566) -- 0:00:11
824500 -- [-750.691] (-750.411) (-751.272) (-749.684) * (-749.039) [-750.903] (-753.535) (-751.337) -- 0:00:11
825000 -- [-748.769] (-748.654) (-749.656) (-749.924) * (-749.234) (-749.880) (-749.059) [-752.857] -- 0:00:11
Average standard deviation of split frequencies: 0.011129
825500 -- (-748.161) (-748.309) [-749.477] (-749.632) * (-749.057) (-750.115) [-749.073] (-752.169) -- 0:00:11
826000 -- (-749.258) (-751.183) [-751.642] (-748.766) * (-749.425) (-751.517) [-749.194] (-755.503) -- 0:00:11
826500 -- (-749.378) (-749.956) (-751.154) [-749.054] * (-749.156) [-748.747] (-748.220) (-751.739) -- 0:00:11
827000 -- (-749.522) (-753.833) (-749.342) [-749.517] * [-753.594] (-750.781) (-748.568) (-749.208) -- 0:00:11
827500 -- (-750.119) (-752.429) (-748.776) [-749.241] * (-753.607) (-753.317) [-751.142] (-751.745) -- 0:00:11
828000 -- (-750.604) [-750.080] (-748.179) (-748.565) * (-754.880) (-751.182) [-749.156] (-755.137) -- 0:00:11
828500 -- (-750.819) (-750.390) [-748.471] (-749.951) * (-752.437) (-749.253) [-748.127] (-749.285) -- 0:00:11
829000 -- (-752.796) (-751.307) [-748.548] (-748.120) * (-750.118) (-750.191) [-751.705] (-749.326) -- 0:00:11
829500 -- (-751.643) [-750.954] (-750.424) (-752.029) * (-753.953) (-751.087) [-750.714] (-753.058) -- 0:00:11
830000 -- [-748.050] (-749.356) (-749.192) (-751.106) * (-755.315) (-750.615) (-750.582) [-751.268] -- 0:00:11
Average standard deviation of split frequencies: 0.011464
830500 -- [-748.826] (-749.014) (-752.321) (-749.463) * (-755.381) [-750.851] (-751.198) (-748.774) -- 0:00:11
831000 -- (-750.578) (-752.553) [-751.836] (-749.485) * (-748.600) (-750.794) [-749.251] (-748.656) -- 0:00:10
831500 -- [-749.318] (-751.387) (-748.153) (-750.011) * (-750.043) [-749.861] (-749.310) (-754.027) -- 0:00:10
832000 -- (-748.945) (-752.799) [-748.372] (-750.979) * (-749.798) [-749.247] (-748.845) (-748.232) -- 0:00:10
832500 -- (-748.026) (-752.573) [-749.264] (-749.719) * (-751.393) (-751.041) (-749.948) [-751.762] -- 0:00:10
833000 -- (-750.652) [-754.082] (-749.541) (-752.464) * (-751.460) [-748.545] (-748.209) (-749.704) -- 0:00:10
833500 -- (-750.667) (-748.912) (-748.125) [-748.877] * [-753.920] (-748.845) (-749.840) (-749.385) -- 0:00:10
834000 -- [-749.889] (-750.732) (-748.870) (-749.360) * [-750.317] (-749.099) (-750.404) (-750.873) -- 0:00:10
834500 -- [-749.389] (-752.612) (-749.299) (-748.490) * (-748.563) [-748.180] (-749.089) (-752.037) -- 0:00:10
835000 -- (-750.746) (-749.375) [-749.284] (-748.209) * (-749.700) (-751.959) (-748.655) [-752.922] -- 0:00:10
Average standard deviation of split frequencies: 0.011917
835500 -- (-751.977) (-748.552) (-749.700) [-752.603] * (-752.409) (-752.211) [-748.939] (-750.976) -- 0:00:10
836000 -- (-749.333) [-748.556] (-750.954) (-756.171) * (-753.266) (-748.226) [-751.472] (-750.040) -- 0:00:10
836500 -- (-750.084) (-749.712) (-752.904) [-749.997] * [-748.255] (-749.803) (-751.147) (-750.783) -- 0:00:10
837000 -- (-749.065) [-751.973] (-753.293) (-749.279) * [-752.142] (-752.351) (-748.575) (-750.899) -- 0:00:10
837500 -- (-751.858) [-750.773] (-750.951) (-749.623) * (-753.488) [-751.566] (-752.664) (-748.657) -- 0:00:10
838000 -- (-750.230) (-749.491) (-751.933) [-748.105] * (-749.114) (-748.780) (-750.253) [-750.838] -- 0:00:10
838500 -- (-751.658) (-748.420) (-751.256) [-750.803] * (-749.113) [-751.018] (-750.698) (-751.335) -- 0:00:10
839000 -- (-750.818) (-751.580) (-749.454) [-750.483] * [-748.151] (-749.698) (-754.152) (-752.232) -- 0:00:10
839500 -- [-748.932] (-749.573) (-750.211) (-752.112) * (-750.788) (-750.551) (-752.234) [-752.221] -- 0:00:10
840000 -- [-748.563] (-747.947) (-750.162) (-751.053) * (-750.830) (-748.019) (-748.591) [-751.906] -- 0:00:10
Average standard deviation of split frequencies: 0.011589
840500 -- (-749.965) (-750.644) (-749.959) [-749.080] * (-754.490) (-750.672) [-751.109] (-753.929) -- 0:00:10
841000 -- (-750.512) (-750.878) (-753.754) [-749.257] * (-749.887) [-750.244] (-753.500) (-749.991) -- 0:00:10
841500 -- (-748.627) (-749.094) (-754.047) [-749.461] * [-751.924] (-751.546) (-750.525) (-750.918) -- 0:00:10
842000 -- [-748.260] (-749.044) (-753.711) (-749.334) * [-751.604] (-753.317) (-755.984) (-750.316) -- 0:00:10
842500 -- [-749.871] (-751.534) (-748.148) (-755.255) * [-751.832] (-755.751) (-748.063) (-748.748) -- 0:00:10
843000 -- (-749.929) (-750.413) [-750.022] (-750.809) * [-750.685] (-758.666) (-749.679) (-749.002) -- 0:00:10
843500 -- (-748.314) (-750.124) (-750.446) [-749.818] * [-749.131] (-749.976) (-749.201) (-749.405) -- 0:00:10
844000 -- (-749.457) (-750.590) [-749.260] (-749.338) * (-751.046) (-748.936) (-749.869) [-751.322] -- 0:00:09
844500 -- (-748.304) (-748.209) [-748.674] (-750.974) * (-751.910) [-749.430] (-749.169) (-748.930) -- 0:00:10
845000 -- (-748.901) (-749.155) [-748.120] (-750.070) * (-751.473) (-755.381) (-751.642) [-749.203] -- 0:00:10
Average standard deviation of split frequencies: 0.011441
845500 -- [-748.214] (-750.539) (-749.223) (-749.038) * (-748.810) [-756.755] (-749.601) (-750.631) -- 0:00:10
846000 -- (-748.342) [-752.221] (-750.730) (-750.029) * [-749.775] (-752.523) (-749.546) (-748.575) -- 0:00:10
846500 -- (-751.032) (-749.849) (-749.694) [-749.111] * (-750.081) (-751.916) [-748.994] (-749.111) -- 0:00:09
847000 -- (-754.201) (-751.201) [-748.737] (-752.457) * (-752.352) (-752.757) [-748.639] (-747.885) -- 0:00:09
847500 -- (-754.977) (-749.009) (-749.822) [-750.974] * (-749.342) [-752.804] (-748.185) (-748.459) -- 0:00:09
848000 -- (-749.226) (-751.099) (-751.317) [-752.506] * [-752.741] (-749.753) (-749.230) (-749.610) -- 0:00:09
848500 -- (-751.071) (-749.034) [-750.798] (-749.300) * (-749.867) (-751.170) (-750.986) [-751.625] -- 0:00:09
849000 -- (-750.022) (-752.969) (-752.245) [-752.089] * (-752.243) (-748.817) [-751.614] (-749.321) -- 0:00:09
849500 -- (-753.236) (-754.990) [-749.735] (-753.013) * (-752.276) (-748.524) (-751.836) [-749.753] -- 0:00:09
850000 -- (-751.919) (-753.198) (-749.156) [-753.429] * (-750.968) [-748.067] (-755.841) (-751.477) -- 0:00:09
Average standard deviation of split frequencies: 0.010862
850500 -- (-753.484) (-750.750) (-750.011) [-751.779] * (-749.995) (-748.907) (-751.710) [-750.555] -- 0:00:09
851000 -- (-753.370) (-749.390) [-749.876] (-751.461) * (-749.934) [-750.492] (-751.631) (-750.780) -- 0:00:09
851500 -- (-750.487) (-750.044) (-750.416) [-749.329] * (-749.512) [-751.712] (-752.585) (-748.638) -- 0:00:09
852000 -- (-754.248) (-749.793) [-748.849] (-749.155) * (-749.885) (-750.713) (-750.921) [-748.089] -- 0:00:09
852500 -- (-750.032) (-756.033) (-748.091) [-748.195] * [-750.002] (-750.790) (-749.796) (-750.859) -- 0:00:09
853000 -- (-749.796) (-753.501) [-749.128] (-750.259) * (-751.399) (-751.523) (-750.318) [-751.830] -- 0:00:09
853500 -- (-749.043) (-758.753) (-752.694) [-748.676] * [-748.958] (-752.511) (-755.583) (-749.518) -- 0:00:09
854000 -- (-748.750) (-757.166) (-749.559) [-748.207] * (-754.534) [-752.115] (-754.467) (-752.584) -- 0:00:09
854500 -- (-750.803) (-754.992) [-749.742] (-750.049) * [-750.447] (-751.014) (-749.388) (-752.410) -- 0:00:09
855000 -- (-751.371) (-749.245) (-750.667) [-750.592] * (-750.738) (-752.826) [-753.684] (-753.462) -- 0:00:09
Average standard deviation of split frequencies: 0.010977
855500 -- [-748.676] (-756.412) (-748.772) (-748.954) * (-749.606) (-749.770) (-752.428) [-750.771] -- 0:00:09
856000 -- (-748.824) (-752.889) (-749.078) [-755.274] * (-749.227) (-751.442) (-750.145) [-751.287] -- 0:00:09
856500 -- [-749.057] (-748.801) (-752.557) (-753.002) * (-749.792) (-749.552) (-750.752) [-748.392] -- 0:00:09
857000 -- (-750.750) (-752.801) [-751.325] (-749.707) * (-750.122) [-749.621] (-749.341) (-751.205) -- 0:00:09
857500 -- (-751.946) (-749.727) [-751.243] (-750.097) * (-749.273) (-749.797) (-748.441) [-749.557] -- 0:00:09
858000 -- (-752.951) (-750.869) (-750.373) [-750.613] * (-750.641) [-749.841] (-750.052) (-753.053) -- 0:00:09
858500 -- (-748.432) [-756.667] (-750.650) (-749.924) * (-749.659) (-750.353) [-751.108] (-748.018) -- 0:00:09
859000 -- (-748.849) (-756.572) [-748.640] (-750.969) * (-750.093) (-751.679) [-749.005] (-750.935) -- 0:00:09
859500 -- [-748.030] (-754.202) (-748.130) (-750.725) * [-749.093] (-751.315) (-751.659) (-752.649) -- 0:00:08
860000 -- (-748.785) (-752.147) [-749.436] (-750.070) * (-752.872) [-752.164] (-749.322) (-749.262) -- 0:00:08
Average standard deviation of split frequencies: 0.011283
860500 -- (-748.883) (-751.099) (-749.479) [-750.629] * (-753.680) (-752.422) (-753.415) [-749.399] -- 0:00:08
861000 -- (-750.601) (-750.139) [-749.908] (-749.321) * (-752.419) [-750.800] (-750.401) (-748.849) -- 0:00:09
861500 -- [-750.689] (-748.410) (-750.411) (-750.923) * (-749.028) (-747.888) [-748.807] (-750.395) -- 0:00:09
862000 -- (-748.240) [-749.647] (-749.886) (-751.815) * (-750.635) [-748.796] (-751.412) (-754.956) -- 0:00:08
862500 -- (-749.010) [-752.157] (-749.671) (-750.139) * [-749.169] (-751.685) (-753.819) (-757.773) -- 0:00:08
863000 -- (-756.277) (-750.137) [-749.346] (-750.286) * (-748.962) (-750.831) (-756.074) [-749.424] -- 0:00:08
863500 -- [-751.506] (-749.239) (-750.049) (-749.988) * (-751.104) (-748.677) [-750.772] (-749.703) -- 0:00:08
864000 -- [-751.355] (-749.259) (-750.232) (-753.816) * [-750.619] (-750.053) (-750.127) (-754.187) -- 0:00:08
864500 -- [-753.140] (-750.060) (-749.323) (-747.787) * (-751.494) (-753.677) [-752.446] (-749.098) -- 0:00:08
865000 -- [-750.505] (-750.493) (-749.632) (-748.887) * (-751.186) (-750.540) (-749.869) [-749.827] -- 0:00:08
Average standard deviation of split frequencies: 0.011329
865500 -- (-749.217) [-748.512] (-750.225) (-749.063) * (-750.271) (-748.345) [-749.927] (-751.384) -- 0:00:08
866000 -- (-749.579) [-748.778] (-751.463) (-748.284) * (-749.659) (-749.992) (-747.903) [-751.440] -- 0:00:08
866500 -- (-750.300) [-749.246] (-749.112) (-749.418) * (-750.275) (-749.639) (-754.678) [-750.137] -- 0:00:08
867000 -- (-749.992) (-752.395) [-753.650] (-750.493) * (-749.923) [-749.084] (-750.723) (-749.492) -- 0:00:08
867500 -- (-755.605) (-750.193) [-748.890] (-748.616) * (-751.582) (-753.324) (-755.128) [-749.539] -- 0:00:08
868000 -- (-753.117) (-749.073) [-749.658] (-750.777) * (-751.420) (-752.449) [-753.821] (-754.622) -- 0:00:08
868500 -- (-753.996) [-749.167] (-748.498) (-750.245) * (-749.729) [-750.346] (-749.628) (-749.751) -- 0:00:08
869000 -- (-750.651) [-749.086] (-748.818) (-750.027) * (-750.348) (-750.205) [-748.952] (-751.743) -- 0:00:08
869500 -- (-755.407) (-752.308) [-752.171] (-755.116) * (-754.791) (-748.286) (-749.962) [-751.195] -- 0:00:08
870000 -- (-748.851) (-754.944) [-749.906] (-749.058) * [-750.053] (-753.079) (-752.704) (-749.864) -- 0:00:08
Average standard deviation of split frequencies: 0.011767
870500 -- [-748.747] (-748.202) (-751.568) (-756.690) * [-750.013] (-752.750) (-749.031) (-754.485) -- 0:00:08
871000 -- (-749.524) (-748.198) [-748.860] (-750.158) * (-748.554) (-750.104) (-749.295) [-751.380] -- 0:00:08
871500 -- (-752.179) [-751.427] (-750.377) (-751.735) * (-749.195) (-750.735) (-748.961) [-751.550] -- 0:00:08
872000 -- (-749.368) (-753.889) (-750.030) [-751.317] * [-751.889] (-749.454) (-748.591) (-751.345) -- 0:00:08
872500 -- (-749.187) (-752.152) (-750.321) [-748.450] * (-749.640) [-748.948] (-748.807) (-750.394) -- 0:00:08
873000 -- (-748.500) (-752.413) [-748.408] (-748.380) * [-750.168] (-749.334) (-750.133) (-748.998) -- 0:00:08
873500 -- (-748.740) (-751.612) [-748.983] (-751.911) * [-748.632] (-749.677) (-749.742) (-750.755) -- 0:00:08
874000 -- (-749.065) [-750.173] (-751.391) (-752.227) * [-748.324] (-749.442) (-749.824) (-751.140) -- 0:00:08
874500 -- [-748.269] (-751.730) (-751.003) (-750.550) * (-751.069) (-751.665) [-750.331] (-752.619) -- 0:00:08
875000 -- (-749.085) [-751.203] (-757.066) (-753.768) * (-750.151) (-749.504) (-750.031) [-749.196] -- 0:00:08
Average standard deviation of split frequencies: 0.011671
875500 -- (-751.159) [-748.429] (-753.703) (-752.404) * (-750.827) (-753.266) (-749.217) [-748.137] -- 0:00:07
876000 -- (-750.947) (-751.442) [-751.299] (-748.634) * (-752.894) (-750.674) [-748.621] (-750.164) -- 0:00:07
876500 -- (-748.859) [-750.508] (-751.141) (-750.483) * [-751.436] (-750.688) (-748.663) (-749.630) -- 0:00:07
877000 -- (-749.892) (-751.825) (-750.903) [-750.416] * (-752.691) (-749.781) (-751.234) [-749.824] -- 0:00:07
877500 -- (-749.069) [-750.163] (-751.874) (-750.292) * (-753.718) [-749.112] (-752.583) (-749.227) -- 0:00:07
878000 -- (-749.171) [-749.197] (-752.303) (-750.031) * (-752.011) [-749.671] (-752.585) (-749.325) -- 0:00:07
878500 -- (-749.181) [-753.329] (-749.402) (-749.031) * [-751.218] (-749.286) (-750.169) (-750.550) -- 0:00:07
879000 -- [-748.406] (-751.966) (-748.633) (-748.540) * (-752.574) (-752.830) [-749.437] (-748.700) -- 0:00:07
879500 -- [-748.855] (-750.043) (-751.301) (-750.113) * (-749.374) (-752.942) (-749.901) [-749.682] -- 0:00:07
880000 -- (-748.711) (-752.493) (-751.975) [-749.412] * (-751.021) [-750.470] (-749.014) (-752.035) -- 0:00:07
Average standard deviation of split frequencies: 0.011526
880500 -- (-749.113) [-748.544] (-755.696) (-749.640) * [-749.049] (-750.680) (-748.451) (-755.462) -- 0:00:07
881000 -- [-750.209] (-749.451) (-750.322) (-752.129) * [-749.229] (-751.757) (-751.526) (-748.287) -- 0:00:07
881500 -- (-753.367) (-749.025) (-750.678) [-751.685] * (-749.949) [-748.778] (-749.761) (-749.392) -- 0:00:07
882000 -- [-748.686] (-748.874) (-750.893) (-749.651) * (-748.946) (-749.193) (-750.544) [-751.236] -- 0:00:07
882500 -- (-750.127) (-752.607) (-754.406) [-749.948] * [-748.475] (-750.412) (-749.107) (-750.924) -- 0:00:07
883000 -- [-748.819] (-749.597) (-749.372) (-750.983) * (-748.501) (-754.712) (-749.268) [-752.861] -- 0:00:07
883500 -- (-752.365) [-750.092] (-749.550) (-749.674) * (-748.565) [-751.693] (-749.120) (-750.017) -- 0:00:07
884000 -- [-750.925] (-748.857) (-749.256) (-748.961) * (-752.386) (-751.193) [-751.721] (-749.351) -- 0:00:07
884500 -- (-751.736) [-748.268] (-748.628) (-750.997) * (-750.878) [-751.706] (-750.007) (-755.884) -- 0:00:07
885000 -- (-752.616) (-752.019) (-750.528) [-749.259] * (-750.998) [-750.701] (-749.162) (-749.210) -- 0:00:07
Average standard deviation of split frequencies: 0.011073
885500 -- (-750.501) (-753.014) (-749.541) [-749.237] * (-750.459) [-749.373] (-750.577) (-750.685) -- 0:00:07
886000 -- [-752.007] (-749.452) (-749.234) (-751.757) * (-749.357) (-750.148) (-749.871) [-751.986] -- 0:00:07
886500 -- (-750.918) (-749.868) (-750.100) [-752.231] * (-751.134) (-751.227) [-748.960] (-749.734) -- 0:00:07
887000 -- (-753.744) (-751.285) (-750.032) [-752.166] * (-748.613) (-753.665) [-748.675] (-748.765) -- 0:00:07
887500 -- (-750.729) (-752.059) [-748.813] (-750.881) * [-749.030] (-750.003) (-749.165) (-748.999) -- 0:00:07
888000 -- (-751.108) (-749.519) (-750.756) [-749.246] * [-751.162] (-749.233) (-749.205) (-749.234) -- 0:00:07
888500 -- (-750.881) (-750.770) (-750.121) [-748.539] * (-750.206) (-750.130) (-749.953) [-750.192] -- 0:00:07
889000 -- (-749.034) (-753.189) [-751.281] (-753.087) * (-749.728) (-753.993) [-752.872] (-748.173) -- 0:00:07
889500 -- (-749.421) [-749.949] (-749.228) (-752.156) * (-756.715) [-753.444] (-752.294) (-752.074) -- 0:00:07
890000 -- (-751.256) (-751.124) (-750.064) [-749.330] * (-756.714) (-750.005) (-752.065) [-752.211] -- 0:00:07
Average standard deviation of split frequencies: 0.011397
890500 -- (-748.724) (-749.563) (-754.191) [-750.496] * [-749.868] (-749.168) (-752.498) (-749.320) -- 0:00:07
891000 -- (-749.983) (-751.611) (-748.813) [-748.544] * (-751.327) (-748.931) (-747.967) [-748.334] -- 0:00:06
891500 -- (-748.628) [-749.055] (-748.795) (-749.314) * (-749.548) (-749.839) [-749.847] (-748.332) -- 0:00:06
892000 -- (-748.108) (-750.594) (-748.535) [-752.600] * (-748.301) (-754.216) (-751.610) [-748.272] -- 0:00:06
892500 -- [-749.611] (-751.253) (-754.625) (-750.111) * (-750.225) [-749.980] (-748.398) (-750.491) -- 0:00:06
893000 -- (-751.323) [-751.873] (-751.210) (-750.409) * [-753.651] (-748.754) (-750.532) (-751.529) -- 0:00:06
893500 -- (-748.801) [-748.671] (-751.022) (-747.884) * (-749.352) [-748.359] (-750.018) (-752.016) -- 0:00:06
894000 -- (-750.146) (-748.363) (-749.889) [-748.068] * (-749.522) [-748.450] (-749.568) (-750.678) -- 0:00:06
894500 -- (-752.099) (-748.919) (-752.246) [-748.576] * (-750.515) [-757.021] (-748.638) (-752.096) -- 0:00:06
895000 -- [-749.206] (-748.522) (-748.354) (-748.103) * [-750.346] (-754.024) (-749.923) (-752.574) -- 0:00:06
Average standard deviation of split frequencies: 0.010803
895500 -- (-750.719) [-748.487] (-749.285) (-749.666) * [-749.047] (-754.419) (-751.359) (-750.516) -- 0:00:06
896000 -- [-750.769] (-748.957) (-749.274) (-750.904) * [-752.049] (-749.982) (-749.042) (-750.245) -- 0:00:06
896500 -- (-752.250) (-752.042) [-748.361] (-749.014) * (-749.265) (-752.827) (-748.412) [-750.524] -- 0:00:06
897000 -- (-754.866) (-751.845) [-750.010] (-752.869) * (-749.222) (-749.473) [-749.618] (-750.387) -- 0:00:06
897500 -- (-752.208) (-753.654) [-751.546] (-754.880) * [-750.115] (-750.150) (-748.321) (-753.692) -- 0:00:06
898000 -- (-750.897) (-749.406) [-749.472] (-756.284) * (-754.559) [-751.716] (-750.977) (-755.449) -- 0:00:06
898500 -- (-748.170) (-748.763) [-750.332] (-752.060) * (-751.027) [-748.662] (-751.690) (-753.783) -- 0:00:06
899000 -- (-749.652) (-748.781) (-752.547) [-748.696] * (-749.849) [-749.455] (-754.389) (-751.222) -- 0:00:06
899500 -- [-749.765] (-749.354) (-751.707) (-749.917) * (-751.663) (-748.219) (-754.576) [-749.644] -- 0:00:06
900000 -- (-749.584) (-748.339) (-749.080) [-751.408] * (-755.647) [-750.096] (-752.033) (-750.189) -- 0:00:06
Average standard deviation of split frequencies: 0.010398
900500 -- (-748.545) (-748.308) [-750.955] (-748.727) * (-749.437) [-748.334] (-750.436) (-750.604) -- 0:00:06
901000 -- (-749.394) (-748.425) (-749.059) [-748.894] * (-749.871) (-748.334) [-750.334] (-750.148) -- 0:00:06
901500 -- (-748.811) (-748.358) (-748.365) [-748.153] * (-751.158) (-755.196) [-751.188] (-754.157) -- 0:00:06
902000 -- (-751.867) [-748.785] (-749.407) (-749.021) * (-751.689) (-752.082) [-748.571] (-749.105) -- 0:00:06
902500 -- (-748.792) (-749.610) [-751.541] (-751.917) * (-752.274) (-749.934) [-748.217] (-750.803) -- 0:00:06
903000 -- (-750.218) [-749.299] (-749.539) (-749.382) * (-749.623) (-749.179) [-749.905] (-750.001) -- 0:00:06
903500 -- [-750.321] (-750.773) (-749.900) (-752.879) * (-749.947) (-749.316) (-754.304) [-749.046] -- 0:00:06
904000 -- (-749.459) (-749.864) [-749.972] (-749.206) * (-752.257) (-749.350) (-750.266) [-749.583] -- 0:00:06
904500 -- (-748.743) [-748.733] (-751.838) (-753.829) * (-748.250) (-749.348) (-749.801) [-753.303] -- 0:00:06
905000 -- (-750.111) (-750.481) (-749.853) [-754.295] * (-748.656) [-748.393] (-750.790) (-754.222) -- 0:00:06
Average standard deviation of split frequencies: 0.010198
905500 -- (-749.670) (-749.625) [-749.297] (-749.462) * (-748.681) [-748.934] (-751.960) (-754.199) -- 0:00:06
906000 -- (-750.075) (-749.747) [-750.794] (-749.493) * (-751.109) [-749.297] (-752.842) (-754.113) -- 0:00:06
906500 -- [-749.164] (-748.515) (-752.351) (-750.711) * (-750.119) (-751.449) [-749.018] (-750.936) -- 0:00:05
907000 -- (-748.506) (-749.694) (-750.104) [-750.552] * (-749.706) (-753.545) [-750.303] (-749.736) -- 0:00:05
907500 -- (-748.376) [-748.572] (-750.265) (-749.818) * [-749.141] (-748.716) (-748.305) (-749.627) -- 0:00:05
908000 -- [-748.990] (-750.031) (-751.422) (-755.878) * (-750.263) [-749.160] (-751.832) (-748.004) -- 0:00:05
908500 -- (-749.125) [-752.112] (-751.922) (-752.819) * (-749.134) (-749.962) (-749.421) [-748.888] -- 0:00:05
909000 -- (-749.091) [-748.743] (-751.853) (-749.221) * (-748.340) (-750.618) (-750.560) [-751.859] -- 0:00:05
909500 -- (-750.566) (-749.418) (-752.551) [-749.790] * (-748.355) (-752.505) [-748.122] (-751.299) -- 0:00:05
910000 -- (-750.227) [-749.305] (-760.131) (-752.865) * (-749.906) [-749.645] (-748.581) (-749.088) -- 0:00:05
Average standard deviation of split frequencies: 0.009801
910500 -- [-749.154] (-748.482) (-756.929) (-752.135) * (-749.632) (-751.305) (-748.793) [-754.845] -- 0:00:05
911000 -- (-749.648) [-748.683] (-751.124) (-751.081) * [-750.320] (-750.274) (-751.764) (-752.122) -- 0:00:05
911500 -- (-748.894) (-749.178) (-753.076) [-748.566] * (-748.759) (-753.979) (-750.661) [-751.882] -- 0:00:05
912000 -- (-748.085) [-749.531] (-749.662) (-751.632) * [-750.579] (-750.303) (-751.436) (-752.695) -- 0:00:05
912500 -- (-755.061) [-750.117] (-748.527) (-751.929) * (-750.448) [-749.261] (-748.414) (-750.358) -- 0:00:05
913000 -- [-748.245] (-749.678) (-750.051) (-751.294) * (-751.829) [-750.702] (-748.686) (-750.278) -- 0:00:05
913500 -- (-750.245) [-750.009] (-749.845) (-749.524) * [-749.432] (-749.527) (-748.679) (-755.248) -- 0:00:05
914000 -- [-749.404] (-751.394) (-749.273) (-752.913) * (-750.019) (-749.234) (-751.960) [-751.207] -- 0:00:05
914500 -- (-749.038) (-754.768) (-749.307) [-748.222] * (-749.102) [-751.140] (-754.176) (-750.078) -- 0:00:05
915000 -- (-753.124) (-752.040) (-750.604) [-749.173] * (-749.669) [-754.768] (-749.542) (-748.347) -- 0:00:05
Average standard deviation of split frequencies: 0.009572
915500 -- (-759.077) [-750.949] (-749.333) (-750.106) * (-749.726) (-749.192) (-748.925) [-748.779] -- 0:00:05
916000 -- (-748.841) [-750.487] (-749.921) (-748.991) * (-749.830) (-748.906) [-749.661] (-749.284) -- 0:00:05
916500 -- [-753.872] (-749.564) (-747.927) (-749.730) * [-751.686] (-749.781) (-748.378) (-752.350) -- 0:00:05
917000 -- (-752.511) [-748.693] (-748.446) (-749.498) * (-750.653) (-753.661) [-751.102] (-751.020) -- 0:00:05
917500 -- [-752.604] (-752.752) (-749.254) (-749.262) * (-749.931) (-750.648) (-750.306) [-747.977] -- 0:00:05
918000 -- (-751.215) (-749.981) (-749.057) [-749.692] * (-752.234) [-749.951] (-750.151) (-748.035) -- 0:00:05
918500 -- [-751.277] (-750.067) (-752.552) (-748.923) * [-751.143] (-749.412) (-749.378) (-751.141) -- 0:00:05
919000 -- (-749.268) [-749.489] (-759.416) (-748.731) * (-748.732) (-749.431) (-749.149) [-751.311] -- 0:00:05
919500 -- [-749.103] (-755.845) (-755.321) (-750.322) * (-749.897) (-750.537) [-750.370] (-752.106) -- 0:00:05
920000 -- (-752.724) [-754.884] (-751.002) (-749.963) * (-751.305) (-751.841) [-750.419] (-749.982) -- 0:00:05
Average standard deviation of split frequencies: 0.009353
920500 -- (-749.819) [-749.479] (-752.643) (-757.671) * (-750.710) (-750.274) [-749.622] (-748.500) -- 0:00:05
921000 -- (-753.356) [-750.084] (-752.580) (-751.867) * [-749.813] (-749.330) (-748.596) (-749.400) -- 0:00:05
921500 -- [-752.348] (-748.476) (-750.272) (-751.656) * (-750.623) [-749.559] (-749.813) (-748.566) -- 0:00:05
922000 -- (-750.884) (-747.819) (-749.653) [-750.276] * (-750.320) (-748.818) [-749.497] (-748.317) -- 0:00:04
922500 -- (-750.835) [-750.717] (-751.424) (-750.406) * (-748.897) [-748.171] (-750.259) (-750.369) -- 0:00:04
923000 -- (-751.015) (-752.251) [-748.492] (-748.808) * [-750.049] (-751.315) (-750.688) (-750.050) -- 0:00:04
923500 -- (-749.527) [-750.415] (-748.706) (-750.991) * (-749.137) (-750.513) [-749.697] (-749.993) -- 0:00:04
924000 -- (-749.469) (-752.157) [-748.307] (-750.316) * (-750.844) (-749.639) [-749.882] (-749.067) -- 0:00:04
924500 -- [-752.603] (-752.311) (-748.202) (-749.251) * (-751.280) (-750.827) [-748.969] (-748.759) -- 0:00:04
925000 -- [-749.163] (-749.629) (-749.095) (-748.835) * (-750.753) [-749.268] (-749.651) (-749.591) -- 0:00:04
Average standard deviation of split frequencies: 0.009197
925500 -- (-751.240) [-748.372] (-752.336) (-750.471) * [-748.861] (-749.555) (-750.246) (-748.561) -- 0:00:04
926000 -- (-752.684) (-749.494) (-749.776) [-751.270] * [-749.292] (-748.918) (-750.391) (-750.117) -- 0:00:04
926500 -- (-748.945) [-749.456] (-750.045) (-752.770) * [-751.275] (-751.501) (-751.585) (-750.529) -- 0:00:04
927000 -- [-749.185] (-749.082) (-749.736) (-752.379) * (-750.355) (-750.605) (-749.937) [-750.036] -- 0:00:04
927500 -- (-750.093) (-749.766) [-748.565] (-749.128) * (-748.776) (-750.095) [-750.406] (-748.948) -- 0:00:04
928000 -- (-751.761) (-751.030) [-749.590] (-749.834) * (-751.934) (-748.575) (-753.135) [-749.137] -- 0:00:04
928500 -- (-749.753) (-752.283) (-749.504) [-749.048] * (-751.230) (-749.172) [-751.097] (-750.281) -- 0:00:04
929000 -- [-750.662] (-749.697) (-748.766) (-750.059) * (-748.567) (-753.179) (-751.111) [-748.588] -- 0:00:04
929500 -- [-749.363] (-750.729) (-749.315) (-749.523) * (-750.594) (-753.195) (-750.454) [-750.108] -- 0:00:04
930000 -- [-748.569] (-748.819) (-749.791) (-750.366) * (-749.148) (-751.288) [-749.516] (-752.552) -- 0:00:04
Average standard deviation of split frequencies: 0.008881
930500 -- (-751.065) [-750.103] (-749.156) (-751.115) * (-749.145) (-750.778) (-756.329) [-754.988] -- 0:00:04
931000 -- (-752.612) (-750.194) [-751.720] (-751.870) * (-749.237) [-752.405] (-751.633) (-750.881) -- 0:00:04
931500 -- (-754.252) (-749.021) (-749.601) [-748.097] * [-749.404] (-751.399) (-750.497) (-749.576) -- 0:00:04
932000 -- (-750.494) (-748.037) (-751.305) [-749.079] * (-751.654) (-749.515) (-748.912) [-748.741] -- 0:00:04
932500 -- [-752.541] (-750.227) (-750.480) (-749.811) * [-750.083] (-748.743) (-749.037) (-750.385) -- 0:00:04
933000 -- (-749.596) (-751.337) [-748.778] (-749.994) * [-748.764] (-753.343) (-749.335) (-749.560) -- 0:00:04
933500 -- (-749.538) (-749.201) [-748.669] (-749.315) * [-751.258] (-749.582) (-749.612) (-749.194) -- 0:00:04
934000 -- (-750.931) (-752.365) (-748.712) [-753.776] * (-748.378) [-752.050] (-749.702) (-751.823) -- 0:00:04
934500 -- [-750.241] (-750.685) (-749.823) (-749.686) * (-750.878) [-752.481] (-749.966) (-753.196) -- 0:00:04
935000 -- (-751.397) (-752.487) [-750.309] (-749.821) * (-751.045) (-749.362) [-750.305] (-749.834) -- 0:00:04
Average standard deviation of split frequencies: 0.008763
935500 -- (-752.163) (-749.444) (-750.622) [-750.065] * (-751.812) (-750.601) [-748.851] (-751.663) -- 0:00:04
936000 -- [-750.845] (-751.225) (-751.390) (-748.821) * (-751.013) (-750.012) (-750.563) [-749.938] -- 0:00:04
936500 -- (-751.734) (-751.208) (-748.516) [-750.530] * (-751.157) [-749.903] (-750.821) (-748.305) -- 0:00:04
937000 -- (-753.562) [-752.386] (-751.483) (-749.743) * (-748.279) (-752.280) [-749.888] (-751.404) -- 0:00:04
937500 -- (-753.107) (-752.024) [-750.598] (-748.951) * (-751.320) (-748.500) [-751.108] (-747.789) -- 0:00:04
938000 -- (-749.358) (-751.533) (-749.704) [-750.741] * [-750.367] (-748.622) (-749.104) (-750.852) -- 0:00:03
938500 -- [-751.268] (-751.681) (-752.350) (-751.514) * (-751.603) (-748.564) [-748.574] (-750.201) -- 0:00:03
939000 -- [-752.003] (-751.493) (-749.484) (-749.935) * (-753.825) [-749.695] (-750.094) (-750.530) -- 0:00:03
939500 -- (-749.352) (-750.515) [-750.832] (-749.964) * (-752.486) (-749.739) [-748.205] (-753.654) -- 0:00:03
940000 -- (-748.598) [-751.387] (-750.963) (-751.777) * (-751.651) (-749.921) (-750.734) [-748.908] -- 0:00:03
Average standard deviation of split frequencies: 0.008887
940500 -- [-749.526] (-751.248) (-751.702) (-751.021) * [-751.603] (-749.018) (-752.229) (-752.254) -- 0:00:03
941000 -- (-748.844) (-750.694) [-749.114] (-749.207) * [-750.833] (-748.859) (-751.608) (-748.806) -- 0:00:03
941500 -- [-749.361] (-750.967) (-748.325) (-749.380) * (-749.726) [-750.042] (-749.878) (-748.667) -- 0:00:03
942000 -- [-748.911] (-747.945) (-751.130) (-748.437) * (-749.136) (-751.503) (-752.043) [-751.481] -- 0:00:03
942500 -- (-753.962) (-748.410) [-749.897] (-752.811) * (-750.337) (-751.373) [-752.126] (-750.576) -- 0:00:03
943000 -- (-756.717) [-750.096] (-752.086) (-750.936) * (-749.965) (-750.348) [-750.616] (-749.127) -- 0:00:03
943500 -- (-752.809) [-749.082] (-749.019) (-749.754) * [-751.818] (-748.804) (-749.950) (-750.938) -- 0:00:03
944000 -- (-751.518) [-748.822] (-748.716) (-748.518) * [-749.429] (-750.706) (-752.070) (-755.535) -- 0:00:03
944500 -- (-750.384) (-749.880) [-749.737] (-749.003) * (-757.864) (-749.489) [-750.479] (-751.962) -- 0:00:03
945000 -- (-749.530) [-750.615] (-750.754) (-751.900) * [-750.673] (-752.768) (-751.361) (-750.413) -- 0:00:03
Average standard deviation of split frequencies: 0.009302
945500 -- (-749.930) (-752.298) [-748.784] (-753.483) * (-750.797) [-750.360] (-750.191) (-752.487) -- 0:00:03
946000 -- (-751.185) (-752.613) [-751.490] (-752.315) * [-752.287] (-749.316) (-750.633) (-749.095) -- 0:00:03
946500 -- (-749.558) (-750.099) (-748.064) [-749.805] * (-749.952) (-750.759) (-753.322) [-750.070] -- 0:00:03
947000 -- (-749.374) (-748.097) (-749.256) [-749.375] * (-751.435) (-749.328) [-750.172] (-749.580) -- 0:00:03
947500 -- [-750.349] (-750.453) (-751.285) (-749.654) * (-751.545) (-748.548) [-750.502] (-749.877) -- 0:00:03
948000 -- [-752.466] (-749.687) (-751.234) (-751.473) * (-748.851) (-748.302) [-751.308] (-748.791) -- 0:00:03
948500 -- (-751.097) (-749.172) (-753.307) [-751.095] * (-749.385) [-749.091] (-748.601) (-749.451) -- 0:00:03
949000 -- (-750.993) (-750.941) (-756.658) [-749.183] * [-748.405] (-749.474) (-753.407) (-749.020) -- 0:00:03
949500 -- [-750.270] (-749.159) (-752.681) (-748.931) * (-749.105) [-750.824] (-751.157) (-751.064) -- 0:00:03
950000 -- (-750.444) (-754.552) (-751.727) [-752.667] * (-750.794) (-749.041) [-749.414] (-749.904) -- 0:00:03
Average standard deviation of split frequencies: 0.009355
950500 -- (-748.787) (-753.970) (-751.481) [-751.410] * (-749.841) (-751.776) [-748.144] (-752.457) -- 0:00:03
951000 -- [-748.995] (-750.681) (-751.410) (-749.424) * (-749.417) [-749.479] (-750.134) (-749.649) -- 0:00:03
951500 -- (-748.996) [-751.773] (-753.975) (-751.663) * (-749.315) [-751.656] (-750.461) (-750.959) -- 0:00:03
952000 -- (-749.541) (-751.061) (-751.066) [-749.752] * (-749.520) [-750.370] (-748.739) (-752.968) -- 0:00:03
952500 -- (-749.326) (-748.795) (-750.754) [-750.571] * (-750.493) (-751.896) (-749.516) [-752.188] -- 0:00:03
953000 -- [-749.233] (-753.179) (-749.369) (-755.294) * (-753.051) (-751.911) [-749.961] (-748.251) -- 0:00:03
953500 -- (-749.152) (-758.450) (-753.057) [-755.899] * [-748.985] (-750.368) (-753.945) (-751.829) -- 0:00:02
954000 -- (-748.696) (-757.614) [-750.769] (-755.059) * (-751.004) (-749.270) (-751.573) [-751.742] -- 0:00:02
954500 -- (-749.729) [-751.616] (-749.040) (-752.404) * (-749.771) (-748.684) [-750.365] (-750.725) -- 0:00:02
955000 -- (-750.103) [-748.176] (-749.907) (-748.162) * [-750.502] (-749.913) (-749.205) (-749.587) -- 0:00:02
Average standard deviation of split frequencies: 0.009270
955500 -- (-748.747) (-750.343) [-749.475] (-749.729) * (-751.122) [-751.648] (-751.639) (-749.590) -- 0:00:02
956000 -- (-748.822) (-748.357) [-750.218] (-751.155) * (-750.807) (-754.812) (-750.858) [-748.191] -- 0:00:02
956500 -- (-750.143) (-749.401) [-750.615] (-752.392) * (-750.430) (-750.873) [-749.682] (-750.075) -- 0:00:02
957000 -- (-750.098) (-750.143) [-749.903] (-751.772) * (-752.957) (-750.436) [-750.561] (-749.518) -- 0:00:02
957500 -- [-749.547] (-747.812) (-748.915) (-749.714) * (-749.595) [-750.219] (-748.700) (-750.695) -- 0:00:02
958000 -- (-751.718) (-749.373) [-751.128] (-749.576) * [-749.332] (-748.489) (-748.967) (-754.867) -- 0:00:02
958500 -- (-750.701) (-750.112) [-748.793] (-749.166) * (-748.486) [-748.204] (-751.161) (-756.763) -- 0:00:02
959000 -- (-749.359) (-749.429) [-748.408] (-754.029) * (-750.406) [-749.630] (-748.459) (-749.945) -- 0:00:02
959500 -- (-747.808) [-749.225] (-748.479) (-748.718) * [-749.273] (-748.469) (-750.089) (-750.287) -- 0:00:02
960000 -- (-749.462) (-751.256) (-749.775) [-748.206] * (-751.243) [-748.362] (-748.752) (-751.655) -- 0:00:02
Average standard deviation of split frequencies: 0.009094
960500 -- (-749.879) [-750.676] (-750.312) (-749.662) * (-751.590) [-750.952] (-748.867) (-751.274) -- 0:00:02
961000 -- (-751.033) [-751.081] (-751.355) (-749.469) * (-754.312) [-749.616] (-750.475) (-750.341) -- 0:00:02
961500 -- (-750.195) (-754.365) [-750.471] (-750.116) * (-750.161) (-748.338) [-748.356] (-748.138) -- 0:00:02
962000 -- (-750.517) (-752.500) (-749.392) [-751.981] * [-752.925] (-749.766) (-748.265) (-750.051) -- 0:00:02
962500 -- (-750.575) (-751.333) (-750.248) [-748.402] * (-750.855) (-749.010) [-748.374] (-750.776) -- 0:00:02
963000 -- (-748.999) (-749.836) (-754.692) [-750.425] * (-750.557) [-750.535] (-750.229) (-756.665) -- 0:00:02
963500 -- (-754.289) (-748.263) [-749.634] (-751.171) * (-753.521) [-748.499] (-748.386) (-750.559) -- 0:00:02
964000 -- [-752.608] (-748.754) (-750.533) (-751.848) * (-754.665) (-752.738) [-749.293] (-751.940) -- 0:00:02
964500 -- (-750.767) (-749.459) [-755.195] (-750.947) * (-750.254) (-748.680) (-748.820) [-756.871] -- 0:00:02
965000 -- (-753.397) (-753.035) (-750.141) [-750.705] * (-752.343) (-750.197) (-749.598) [-751.912] -- 0:00:02
Average standard deviation of split frequencies: 0.009272
965500 -- (-754.810) (-754.744) [-748.781] (-750.176) * (-752.718) [-750.146] (-751.584) (-755.984) -- 0:00:02
966000 -- (-750.129) (-749.811) [-752.411] (-749.133) * [-749.242] (-749.987) (-752.316) (-750.651) -- 0:00:02
966500 -- (-750.818) (-752.378) [-750.250] (-748.134) * (-749.373) (-753.959) (-748.234) [-749.879] -- 0:00:02
967000 -- [-749.681] (-750.898) (-748.497) (-750.872) * (-752.058) [-750.069] (-751.686) (-750.194) -- 0:00:02
967500 -- (-748.727) [-748.383] (-750.116) (-749.680) * [-750.727] (-748.385) (-751.463) (-750.705) -- 0:00:02
968000 -- (-751.421) (-748.778) [-748.895] (-751.485) * [-751.391] (-749.233) (-752.080) (-753.975) -- 0:00:02
968500 -- (-748.804) (-750.182) (-749.827) [-751.133] * (-749.782) [-749.596] (-752.527) (-750.049) -- 0:00:02
969000 -- (-752.012) [-752.416] (-750.116) (-749.844) * (-749.233) (-750.597) (-751.465) [-750.966] -- 0:00:01
969500 -- [-750.287] (-750.919) (-750.355) (-749.447) * [-753.891] (-749.305) (-750.554) (-752.374) -- 0:00:01
970000 -- (-750.259) (-753.896) [-750.578] (-749.798) * (-752.603) (-748.161) [-752.920] (-751.021) -- 0:00:01
Average standard deviation of split frequencies: 0.009324
970500 -- [-748.855] (-751.666) (-752.322) (-749.984) * [-748.202] (-749.259) (-749.575) (-750.870) -- 0:00:01
971000 -- (-750.478) [-751.110] (-750.504) (-752.158) * (-748.417) (-750.665) (-755.623) [-750.326] -- 0:00:01
971500 -- (-751.090) (-748.221) (-755.143) [-753.215] * (-748.681) (-749.187) [-749.256] (-748.536) -- 0:00:01
972000 -- (-748.737) (-749.797) [-752.645] (-748.212) * [-749.463] (-750.568) (-749.914) (-749.442) -- 0:00:01
972500 -- [-750.732] (-752.477) (-752.624) (-748.121) * (-748.550) (-749.684) (-749.404) [-749.634] -- 0:00:01
973000 -- (-752.222) (-750.190) [-749.541] (-748.069) * (-748.995) (-749.169) [-748.984] (-753.728) -- 0:00:01
973500 -- (-748.610) [-750.865] (-748.987) (-754.546) * (-748.214) (-749.161) [-748.801] (-748.060) -- 0:00:01
974000 -- (-750.014) [-748.630] (-749.110) (-749.620) * (-748.722) [-749.382] (-749.429) (-751.638) -- 0:00:01
974500 -- (-751.771) [-749.161] (-753.521) (-749.880) * [-747.992] (-750.950) (-753.118) (-749.347) -- 0:00:01
975000 -- (-749.172) (-750.780) [-749.857] (-750.216) * (-749.778) (-749.573) (-748.854) [-748.392] -- 0:00:01
Average standard deviation of split frequencies: 0.009370
975500 -- (-752.302) [-749.633] (-752.551) (-748.914) * [-752.082] (-751.137) (-749.604) (-749.277) -- 0:00:01
976000 -- (-750.184) (-750.479) [-752.670] (-747.716) * [-750.296] (-750.320) (-754.138) (-748.700) -- 0:00:01
976500 -- (-752.585) (-752.634) [-748.393] (-748.236) * (-749.541) (-750.782) (-752.955) [-748.579] -- 0:00:01
977000 -- (-750.104) (-748.408) (-748.735) [-747.839] * (-753.153) [-750.733] (-751.357) (-749.346) -- 0:00:01
977500 -- [-752.338] (-748.718) (-751.771) (-751.422) * [-749.174] (-750.526) (-749.390) (-748.783) -- 0:00:01
978000 -- (-748.031) [-749.880] (-750.731) (-752.979) * (-748.989) (-751.343) (-751.974) [-749.287] -- 0:00:01
978500 -- (-750.178) [-749.351] (-753.256) (-749.302) * (-750.992) (-750.075) [-748.163] (-750.605) -- 0:00:01
979000 -- (-751.761) [-752.444] (-751.256) (-750.397) * (-751.387) (-751.512) [-749.553] (-753.530) -- 0:00:01
979500 -- (-750.412) (-750.786) (-750.090) [-751.012] * (-756.387) (-753.150) [-749.562] (-750.618) -- 0:00:01
980000 -- (-749.454) (-752.517) [-749.170] (-749.795) * (-752.274) [-752.103] (-749.895) (-752.098) -- 0:00:01
Average standard deviation of split frequencies: 0.009261
980500 -- (-750.049) (-749.955) (-750.504) [-749.218] * (-748.837) [-749.792] (-754.410) (-751.856) -- 0:00:01
981000 -- (-752.671) (-749.359) [-749.628] (-749.292) * (-750.924) [-750.835] (-750.038) (-750.101) -- 0:00:01
981500 -- (-750.886) [-749.077] (-749.920) (-749.022) * (-750.148) [-748.969] (-750.284) (-750.026) -- 0:00:01
982000 -- [-752.274] (-751.589) (-755.192) (-748.828) * (-749.805) (-749.569) [-749.203] (-749.554) -- 0:00:01
982500 -- (-752.511) (-749.305) (-756.149) [-751.037] * (-749.842) (-748.420) (-751.020) [-750.405] -- 0:00:01
983000 -- (-749.442) [-748.587] (-754.958) (-751.931) * (-752.782) [-749.006] (-752.351) (-749.776) -- 0:00:01
983500 -- (-750.479) (-752.432) [-749.099] (-748.802) * (-749.070) [-749.032] (-748.291) (-747.989) -- 0:00:01
984000 -- [-750.931] (-752.128) (-750.949) (-752.371) * (-748.965) [-748.738] (-748.400) (-749.222) -- 0:00:01
984500 -- (-752.031) (-749.798) [-750.312] (-749.569) * (-748.989) (-748.714) [-749.142] (-755.830) -- 0:00:00
985000 -- (-748.465) (-750.363) (-750.571) [-749.232] * (-748.044) (-754.643) [-748.887] (-750.343) -- 0:00:00
Average standard deviation of split frequencies: 0.009339
985500 -- (-748.392) [-749.390] (-751.946) (-749.354) * (-749.800) (-750.157) [-750.412] (-749.001) -- 0:00:00
986000 -- (-748.404) (-748.826) (-750.466) [-750.743] * (-750.912) (-751.780) [-749.743] (-752.283) -- 0:00:00
986500 -- (-749.896) (-750.307) [-751.224] (-749.241) * (-750.233) (-754.666) (-752.681) [-749.587] -- 0:00:00
987000 -- [-750.583] (-752.648) (-751.118) (-748.874) * (-749.357) (-754.592) (-748.851) [-750.201] -- 0:00:00
987500 -- (-752.151) (-748.905) [-750.365] (-753.319) * [-749.524] (-752.543) (-750.974) (-748.931) -- 0:00:00
988000 -- (-751.913) (-755.095) (-750.892) [-752.607] * (-749.247) (-749.144) [-748.783] (-753.558) -- 0:00:00
988500 -- (-748.973) (-754.402) [-753.235] (-752.033) * (-750.253) (-751.632) (-752.283) [-752.419] -- 0:00:00
989000 -- (-749.240) (-759.406) [-755.147] (-750.024) * [-748.877] (-751.437) (-750.080) (-750.506) -- 0:00:00
989500 -- (-754.379) [-751.169] (-750.972) (-749.502) * (-751.736) [-749.542] (-749.839) (-748.792) -- 0:00:00
990000 -- (-749.121) (-752.179) (-751.864) [-750.517] * [-748.889] (-748.278) (-748.523) (-750.968) -- 0:00:00
Average standard deviation of split frequencies: 0.009136
990500 -- [-748.684] (-752.828) (-748.649) (-748.817) * (-750.367) [-748.161] (-751.606) (-749.499) -- 0:00:00
991000 -- (-748.621) [-748.984] (-748.125) (-750.686) * (-748.477) (-748.895) (-750.045) [-750.594] -- 0:00:00
991500 -- (-754.452) (-751.617) [-751.614] (-749.272) * [-750.349] (-749.282) (-751.721) (-751.752) -- 0:00:00
992000 -- (-749.891) (-751.279) (-749.856) [-749.871] * [-750.015] (-749.374) (-750.376) (-749.641) -- 0:00:00
992500 -- (-750.871) (-751.171) (-749.521) [-748.725] * (-750.389) [-749.285] (-749.813) (-751.904) -- 0:00:00
993000 -- [-748.750] (-755.265) (-750.723) (-749.031) * (-749.784) [-749.049] (-750.784) (-751.331) -- 0:00:00
993500 -- [-748.068] (-751.961) (-748.074) (-750.688) * [-751.567] (-751.265) (-748.522) (-752.501) -- 0:00:00
994000 -- (-748.664) (-750.421) [-747.861] (-752.285) * (-748.514) (-752.824) (-748.383) [-748.240] -- 0:00:00
994500 -- (-748.965) (-752.791) (-748.523) [-750.463] * [-749.223] (-749.794) (-749.043) (-748.769) -- 0:00:00
995000 -- (-750.426) (-751.831) [-749.886] (-749.248) * (-748.682) (-748.499) [-748.572] (-748.761) -- 0:00:00
Average standard deviation of split frequencies: 0.008961
995500 -- (-752.913) [-751.703] (-750.382) (-750.507) * [-749.212] (-748.467) (-749.819) (-748.967) -- 0:00:00
996000 -- (-751.626) (-750.157) (-751.985) [-753.079] * (-749.526) (-748.655) (-751.163) [-748.629] -- 0:00:00
996500 -- (-750.736) [-749.063] (-754.095) (-756.887) * (-749.416) (-749.690) (-750.897) [-748.400] -- 0:00:00
997000 -- (-751.695) (-750.045) [-750.706] (-748.191) * (-749.595) (-752.567) [-752.958] (-748.020) -- 0:00:00
997500 -- (-752.495) (-749.831) (-749.808) [-748.190] * (-748.483) (-750.504) (-753.320) [-749.303] -- 0:00:00
998000 -- (-751.190) (-749.915) [-755.981] (-748.834) * [-750.835] (-749.916) (-748.898) (-747.762) -- 0:00:00
998500 -- (-749.626) (-748.979) [-748.534] (-748.439) * (-752.268) (-748.274) [-749.690] (-755.885) -- 0:00:00
999000 -- (-749.188) [-749.336] (-748.449) (-750.093) * (-751.902) [-750.223] (-749.692) (-753.276) -- 0:00:00
999500 -- (-748.602) [-750.849] (-750.620) (-751.193) * (-752.467) (-751.171) [-749.369] (-750.612) -- 0:00:00
1000000 -- [-748.037] (-755.007) (-749.810) (-752.514) * [-752.048] (-750.227) (-749.270) (-751.250) -- 0:00:00
Average standard deviation of split frequencies: 0.009579
Analysis completed in 1 mins 4 seconds
Analysis used 62.45 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -747.70
Likelihood of best state for "cold" chain of run 2 was -747.70
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
29.8 % ( 23 %) Dirichlet(Pi{all})
31.5 % ( 30 %) Slider(Pi{all})
78.1 % ( 59 %) Multiplier(Alpha{1,2})
77.9 % ( 48 %) Multiplier(Alpha{3})
23.7 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 63 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
30.1 % ( 33 %) Dirichlet(Pi{all})
32.2 % ( 31 %) Slider(Pi{all})
79.0 % ( 54 %) Multiplier(Alpha{1,2})
78.2 % ( 52 %) Multiplier(Alpha{3})
22.7 % ( 22 %) Slider(Pinvar{all})
98.5 % ( 98 %) ExtSPR(Tau{all},V{all})
69.9 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166376 0.82 0.67
3 | 167231 166500 0.84
4 | 166793 166513 166587
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 166782 0.83 0.67
3 | 166431 167545 0.84
4 | 166188 166651 166403
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -749.46
| 21 2 |
| 1 1 1 2 |
| 22 21 2 2 2 11 1 2|
|* 1 1 1 2 2 1 22 2 1 2 |
| 1 22 1 1**1 1 * 2 12 1 1 11 1* 1 |
| *12 1 21 2 1 1 2 2 2 221 2 |
| 2 2 21 1 22 21 1 12 1 21 1|
| 21 1 2 2 22 1 * 2 2 1 2 2 12 2 |
| 2 1 1 |
| 1 2 1 |
| 1 122 1 1 2 |
| |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -751.56
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -749.43 -752.95
2 -749.44 -752.83
--------------------------------------
TOTAL -749.43 -752.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898465 0.087113 0.380262 1.474698 0.865149 1481.87 1491.43 1.000
r(A<->C){all} 0.163160 0.019344 0.000011 0.437850 0.125165 232.91 236.47 1.006
r(A<->G){all} 0.171746 0.020952 0.000033 0.446796 0.130924 211.82 258.22 1.000
r(A<->T){all} 0.174831 0.021608 0.000008 0.477342 0.134048 114.57 172.05 1.004
r(C<->G){all} 0.160289 0.018310 0.000030 0.427387 0.128548 355.07 368.61 1.003
r(C<->T){all} 0.170025 0.020477 0.000001 0.467853 0.133263 106.51 187.84 1.005
r(G<->T){all} 0.159950 0.017585 0.000022 0.420643 0.128694 298.47 354.88 1.000
pi(A){all} 0.233613 0.000324 0.200038 0.268363 0.233836 1261.45 1343.21 1.000
pi(C){all} 0.336367 0.000402 0.294890 0.372343 0.336655 1175.94 1338.47 1.000
pi(G){all} 0.247722 0.000327 0.214047 0.284398 0.247265 1337.26 1341.14 1.000
pi(T){all} 0.182298 0.000271 0.148977 0.213472 0.181850 1218.68 1352.40 1.000
alpha{1,2} 0.413912 0.218203 0.000130 1.420727 0.243545 1138.35 1152.98 1.000
alpha{3} 0.465027 0.255495 0.000116 1.496414 0.290208 1016.07 1045.23 1.000
pinvar{all} 0.997076 0.000013 0.990551 0.999999 0.998204 1450.98 1475.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*..*.
9 -- ...*.*
10 -- .****.
11 -- .*...*
12 -- ..*.*.
13 -- .**...
14 -- .***.*
15 -- .**.**
16 -- ..****
17 -- .*.*..
18 -- ....**
19 -- ...**.
20 -- .*.***
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.002827 0.148568 0.152565 2
8 452 0.150566 0.019786 0.136576 0.164557 2
9 449 0.149567 0.020257 0.135243 0.163891 2
10 446 0.148568 0.012248 0.139907 0.157229 2
11 444 0.147901 0.005653 0.143904 0.151899 2
12 442 0.147235 0.017901 0.134577 0.159893 2
13 441 0.146902 0.008009 0.141239 0.152565 2
14 437 0.145570 0.002355 0.143904 0.147235 2
15 419 0.139574 0.000471 0.139241 0.139907 2
16 417 0.138907 0.004240 0.135909 0.141905 2
17 417 0.138907 0.012719 0.129913 0.147901 2
18 417 0.138907 0.018373 0.125916 0.151899 2
19 413 0.137575 0.010835 0.129913 0.145237 2
20 410 0.136576 0.002827 0.134577 0.138574 2
21 405 0.134910 0.005182 0.131246 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099383 0.010078 0.000025 0.295669 0.070397 1.000 2
length{all}[2] 0.099129 0.010367 0.000012 0.294577 0.066536 1.000 2
length{all}[3] 0.101541 0.010145 0.000009 0.305428 0.070499 1.000 2
length{all}[4] 0.099651 0.009657 0.000011 0.302388 0.068246 1.000 2
length{all}[5] 0.100702 0.009813 0.000038 0.305602 0.069492 1.001 2
length{all}[6] 0.098383 0.009808 0.000005 0.287580 0.068175 1.000 2
length{all}[7] 0.098122 0.009691 0.000684 0.290106 0.068364 0.998 2
length{all}[8] 0.106740 0.011045 0.000001 0.313144 0.075656 0.998 2
length{all}[9] 0.100663 0.010294 0.000176 0.335672 0.063227 1.002 2
length{all}[10] 0.102060 0.012548 0.000559 0.333684 0.069013 0.998 2
length{all}[11] 0.094716 0.009321 0.000074 0.291496 0.062870 0.999 2
length{all}[12] 0.093361 0.008510 0.000257 0.281573 0.063074 1.006 2
length{all}[13] 0.099912 0.009334 0.001021 0.308438 0.066410 0.998 2
length{all}[14] 0.100090 0.011421 0.000028 0.308508 0.065067 1.000 2
length{all}[15] 0.099123 0.008415 0.000480 0.264916 0.072566 0.999 2
length{all}[16] 0.096829 0.009033 0.000114 0.287289 0.072764 1.000 2
length{all}[17] 0.112815 0.012717 0.000075 0.333411 0.084241 1.007 2
length{all}[18] 0.100626 0.010463 0.000084 0.289185 0.069387 1.001 2
length{all}[19] 0.094967 0.009652 0.000011 0.270493 0.065739 0.998 2
length{all}[20] 0.105509 0.010614 0.000513 0.312033 0.066125 0.999 2
length{all}[21] 0.100530 0.010497 0.000044 0.326694 0.068334 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009579
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 549
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 50 patterns at 183 / 183 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 50 patterns at 183 / 183 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
48800 bytes for conP
4400 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046517 0.027346 0.073174 0.073032 0.059610 0.090243 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -783.314700
Iterating by ming2
Initial: fx= 783.314700
x= 0.04652 0.02735 0.07317 0.07303 0.05961 0.09024 0.30000 1.30000
1 h-m-p 0.0000 0.0002 439.3153 ++ 754.007194 m 0.0002 13 | 1/8
2 h-m-p 0.0020 0.0111 29.7177 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 402.5856 ++ 736.700706 m 0.0001 45 | 2/8
4 h-m-p 0.0021 0.0204 18.4771 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 361.0116 ++ 727.178772 m 0.0001 77 | 3/8
6 h-m-p 0.0019 0.0397 12.3088 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 313.1339 ++ 719.815199 m 0.0001 109 | 4/8
8 h-m-p 0.0023 0.0961 8.4925 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 256.1814 ++ 719.763091 m 0.0000 141 | 5/8
10 h-m-p 0.0004 0.2193 5.6880 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 180.8597 ++ 716.627811 m 0.0001 172 | 6/8
12 h-m-p 0.1036 8.0000 0.0000 ++++ 716.627811 m 8.0000 185 | 6/8
13 h-m-p 0.0868 8.0000 0.0003 ++++ 716.627811 m 8.0000 200 | 6/8
14 h-m-p 0.0014 0.2471 1.5954 ------C 716.627811 0 0.0000 219 | 6/8
15 h-m-p 0.0336 8.0000 0.0000 Y 716.627811 0 0.0084 230 | 6/8
16 h-m-p 0.0321 8.0000 0.0000 ------C 716.627811 0 0.0000 249
Out..
lnL = -716.627811
250 lfun, 250 eigenQcodon, 1500 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107173 0.059176 0.044757 0.023953 0.060408 0.068741 0.301641 0.708058 0.532368
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.831983
np = 9
lnL0 = -781.604832
Iterating by ming2
Initial: fx= 781.604832
x= 0.10717 0.05918 0.04476 0.02395 0.06041 0.06874 0.30164 0.70806 0.53237
1 h-m-p 0.0000 0.0001 430.5101 ++ 756.376609 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0005 233.0069 ++ 737.644770 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0000 24584.6109 ++ 727.359316 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 436.0216 ++ 726.594609 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 79987.8428 ++ 723.204032 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 17055.0010 ++ 716.627816 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 716.627816 m 8.0000 86 | 6/9
8 h-m-p 0.0310 8.0000 0.0044 +++++ 716.627816 m 8.0000 104 | 6/9
9 h-m-p 0.1415 2.4578 0.2459 +++ 716.627812 m 2.4578 120 | 7/9
10 h-m-p 0.8356 4.1780 0.0749 ++ 716.627812 m 4.1780 135 | 8/9
11 h-m-p 1.6000 8.0000 0.0004 Y 716.627812 0 1.6000 149 | 8/9
12 h-m-p 0.9994 8.0000 0.0007 Y 716.627812 0 0.4375 162 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 N 716.627812 0 1.6000 175
Out..
lnL = -716.627812
176 lfun, 528 eigenQcodon, 2112 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.061864 0.081037 0.053635 0.053470 0.023303 0.012381 0.000100 1.463627 0.109619 0.425744 1.330631
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.376489
np = 11
lnL0 = -766.888355
Iterating by ming2
Initial: fx= 766.888355
x= 0.06186 0.08104 0.05364 0.05347 0.02330 0.01238 0.00011 1.46363 0.10962 0.42574 1.33063
1 h-m-p 0.0000 0.0000 419.3989 ++ 765.089763 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 191.7355 +++ 753.432536 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0002 124.8746 ++ 745.520925 m 0.0002 45 | 3/11
4 h-m-p 0.0004 0.0047 54.7896 ++ 720.852562 m 0.0047 59 | 4/11
5 h-m-p 0.0000 0.0000 3294.5486 ++ 720.784958 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0002 461.2469 +++ 719.188402 m 0.0002 88 | 6/11
7 h-m-p 0.0001 0.0003 18.2193 ---------.. | 6/11
8 h-m-p 0.0000 0.0000 252.8029 ++ 718.347678 m 0.0000 123 | 7/11
9 h-m-p 0.0160 8.0000 1.3482 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 179.2599 ++ 716.627816 m 0.0001 162 | 8/11
11 h-m-p 0.1013 8.0000 0.0000 ++++ 716.627816 m 8.0000 178 | 8/11
12 h-m-p 0.0335 8.0000 0.0008 ----Y 716.627816 0 0.0000 199 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 ---Y 716.627816 0 0.0001 219
Out..
lnL = -716.627816
220 lfun, 880 eigenQcodon, 3960 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -716.642846 S = -716.625690 -0.006575
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:03
did 20 / 50 patterns 0:03
did 30 / 50 patterns 0:03
did 40 / 50 patterns 0:03
did 50 / 50 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093393 0.060714 0.096475 0.047508 0.068191 0.016566 0.000100 0.367581 1.623618
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.661145
np = 9
lnL0 = -781.756094
Iterating by ming2
Initial: fx= 781.756094
x= 0.09339 0.06071 0.09647 0.04751 0.06819 0.01657 0.00011 0.36758 1.62362
1 h-m-p 0.0000 0.0000 393.2997 ++ 781.301314 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0221 24.6284 ++++YYCCC 780.788301 4 0.0112 36 | 1/9
3 h-m-p 0.0017 0.0087 9.4186 ------------.. | 1/9
4 h-m-p 0.0000 0.0001 392.3093 ++ 768.614905 m 0.0001 70 | 2/9
5 h-m-p 0.0004 0.0056 72.4845 ++ 743.071532 m 0.0056 82 | 3/9
6 h-m-p 0.0000 0.0000 61260893.6863 ++ 732.905390 m 0.0000 94 | 4/9
7 h-m-p 0.0002 0.0011 108.4542 ++ 731.434846 m 0.0011 106 | 5/9
8 h-m-p 0.0000 0.0000 3131512.8250 +
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
+ 726.750490 m 0.0000 118
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.94507, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
9 h-m-p 0.0003 0.0013 69.7434
QuantileBeta(0.85, 3.93004, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.88494, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
+ 724.612695 m 0.0013 130
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
10 h-m-p 0.0069 0.3558 11.6687
QuantileBeta(0.85, 3.79474, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.85112, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86521, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86873, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86961, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86983, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86989, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86990, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
-..
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
11 h-m-p 0.0000 0.0002 179.6244
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
+ 716.627812 m 0.0002 166
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
| 8/9
12 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
Y 716.627812 0 1.6000 178
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.87007, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
13 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
N 716.627812 0 0.0005 192
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -716.627812
193 lfun, 2123 eigenQcodon, 11580 P(t)
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.86991, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077354 0.058811 0.034142 0.058783 0.034696 0.041392 0.000100 0.900000 0.598384 1.995379 1.301437
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.620721
np = 11
lnL0 = -768.021524
Iterating by ming2
Initial: fx= 768.021524
x= 0.07735 0.05881 0.03414 0.05878 0.03470 0.04139 0.00011 0.90000 0.59838 1.99538 1.30144
1 h-m-p 0.0000 0.0000 385.1885 ++ 767.162371 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0013 175.2502 ++++ 733.849723 m 0.0013 32 | 2/11
3 h-m-p 0.0000 0.0000 36346.0141 ++ 733.382165 m 0.0000 46 | 3/11
4 h-m-p 0.0002 0.0044 23.0634 +++ 732.042006 m 0.0044 61 | 4/11
5 h-m-p 0.0000 0.0000 240121.4288 ++ 730.139761 m 0.0000 75 | 5/11
6 h-m-p 0.0001 0.0004 200.4139 ++ 728.732745 m 0.0004 89 | 6/11
7 h-m-p 0.0000 0.0000 471.7260 ++ 728.722576 m 0.0000 103 | 7/11
8 h-m-p 0.0001 0.0301 44.3539 ++
QuantileBeta(0.15, 0.00500, 2.14508) = 1.232839e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.27075) = 1.147640e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
+ 721.369540 m 0.0301 120
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.091668e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
| 7/11
9 h-m-p 0.0000 0.0000 7379.5231
h-m-p: 0.00000000e+00 0.00000000e+00 7.37952314e+03 721.369540
..
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.091668e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
| 7/11
10 h-m-p 0.0000 0.0001 177.1410
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
+ 716.627824 m 0.0001 145
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.091668e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054843e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
| 8/11
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
+ 716.627824 m 8.0000 159
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.091668e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43058) = 1.054776e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43032) = 1.054913e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43045) = 1.054844e-160 2000 rounds
| 7/11
12 h-m-p 0.0160 8.0000 0.0020 +++++ 716.627822 m 8.0000 179 | 7/11
13 h-m-p 0.3843 8.0000 0.0414 +++ 716.627812 m 8.0000 198 | 7/11
14 h-m-p 1.6000 8.0000 0.0196 ++ 716.627811 m 8.0000 216 | 7/11
15 h-m-p 0.5880 2.9401 0.1820 ++ 716.627810 m 2.9401 234 | 8/11
16 h-m-p 1.6000 8.0000 0.0033 ++ 716.627810 m 8.0000 252 | 8/11
17 h-m-p 0.0091 0.1089 2.8676 ---Y 716.627810 0 0.0000 272 | 8/11
18 h-m-p 1.6000 8.0000 0.0000 -----Y 716.627810 0 0.0004 291 | 8/11
19 h-m-p 1.3298 8.0000 0.0000 C 716.627810 0 1.3298 308
Out..
lnL = -716.627810
309 lfun, 3708 eigenQcodon, 20394 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -716.628078 S = -716.623874 -0.001841
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 50 patterns 0:12
did 20 / 50 patterns 0:12
did 30 / 50 patterns 0:12
did 40 / 50 patterns 0:12
did 50 / 50 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=183
NC_011896_1_WP_010907670_1_331_MLBR_RS01610 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
NC_002677_1_NP_301346_1_218_lpqE VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
**************************************************
NC_011896_1_WP_010907670_1_331_MLBR_RS01610 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
NC_002677_1_NP_301346_1_218_lpqE VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790 VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
**************************************************
NC_011896_1_WP_010907670_1_331_MLBR_RS01610 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
NC_002677_1_NP_301346_1_218_lpqE DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790 DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
**************************************************
NC_011896_1_WP_010907670_1_331_MLBR_RS01610 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
NC_002677_1_NP_301346_1_218_lpqE TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790 TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
*********************************
>NC_011896_1_WP_010907670_1_331_MLBR_RS01610 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC >NC_002677_1_NP_301346_1_218_lpqE GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC >NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC >NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC >NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC >NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790 GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>NC_011896_1_WP_010907670_1_331_MLBR_RS01610 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT >NC_002677_1_NP_301346_1_218_lpqE VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT >NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT >NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT >NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT >NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790 VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
#NEXUS
[ID: 0994188740]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907670_1_331_MLBR_RS01610
NC_002677_1_NP_301346_1_218_lpqE
NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805
NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825
NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710
NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907670_1_331_MLBR_RS01610,
2 NC_002677_1_NP_301346_1_218_lpqE,
3 NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805,
4 NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825,
5 NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710,
6 NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07039679,2:0.06653584,3:0.0704985,4:0.06824558,5:0.06949235,6:0.06817513);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07039679,2:0.06653584,3:0.0704985,4:0.06824558,5:0.06949235,6:0.06817513);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -749.43 -752.95
2 -749.44 -752.83
--------------------------------------
TOTAL -749.43 -752.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898465 0.087113 0.380262 1.474698 0.865149 1481.87 1491.43 1.000
r(A<->C){all} 0.163160 0.019344 0.000011 0.437850 0.125165 232.91 236.47 1.006
r(A<->G){all} 0.171746 0.020952 0.000033 0.446796 0.130924 211.82 258.22 1.000
r(A<->T){all} 0.174831 0.021608 0.000008 0.477342 0.134048 114.57 172.05 1.004
r(C<->G){all} 0.160289 0.018310 0.000030 0.427387 0.128548 355.07 368.61 1.003
r(C<->T){all} 0.170025 0.020477 0.000001 0.467853 0.133263 106.51 187.84 1.005
r(G<->T){all} 0.159950 0.017585 0.000022 0.420643 0.128694 298.47 354.88 1.000
pi(A){all} 0.233613 0.000324 0.200038 0.268363 0.233836 1261.45 1343.21 1.000
pi(C){all} 0.336367 0.000402 0.294890 0.372343 0.336655 1175.94 1338.47 1.000
pi(G){all} 0.247722 0.000327 0.214047 0.284398 0.247265 1337.26 1341.14 1.000
pi(T){all} 0.182298 0.000271 0.148977 0.213472 0.181850 1218.68 1352.40 1.000
alpha{1,2} 0.413912 0.218203 0.000130 1.420727 0.243545 1138.35 1152.98 1.000
alpha{3} 0.465027 0.255495 0.000116 1.496414 0.290208 1016.07 1045.23 1.000
pinvar{all} 0.997076 0.000013 0.990551 0.999999 0.998204 1450.98 1475.99 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/lpqE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 183
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 5 5 5 5 5 5 | CCC 5 5 5 5 5 5 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 5 5 5 5 5 5 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 4 4 4 4 4 4 | CAG 6 6 6 6 6 6 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 10 10 10 10 10 10 | ACC 12 12 12 12 12 12 | AAC 11 11 11 11 11 11 | AGC 2 2 2 2 2 2
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 4 4 4 4 4 4 | Asp GAT 0 0 0 0 0 0 | Gly GGT 2 2 2 2 2 2
GTC 6 6 6 6 6 6 | GCC 8 8 8 8 8 8 | GAC 5 5 5 5 5 5 | GGC 9 9 9 9 9 9
GTA 3 3 3 3 3 3 | GCA 5 5 5 5 5 5 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 6 6 6 6 6 6 | GCG 3 3 3 3 3 3 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907670_1_331_MLBR_RS01610
position 1: T:0.13115 C:0.24044 A:0.30601 G:0.32240
position 2: T:0.31148 C:0.30601 A:0.22404 G:0.15847
position 3: T:0.10383 C:0.46448 A:0.16940 G:0.26230
Average T:0.18215 C:0.33698 A:0.23315 G:0.24772
#2: NC_002677_1_NP_301346_1_218_lpqE
position 1: T:0.13115 C:0.24044 A:0.30601 G:0.32240
position 2: T:0.31148 C:0.30601 A:0.22404 G:0.15847
position 3: T:0.10383 C:0.46448 A:0.16940 G:0.26230
Average T:0.18215 C:0.33698 A:0.23315 G:0.24772
#3: NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805
position 1: T:0.13115 C:0.24044 A:0.30601 G:0.32240
position 2: T:0.31148 C:0.30601 A:0.22404 G:0.15847
position 3: T:0.10383 C:0.46448 A:0.16940 G:0.26230
Average T:0.18215 C:0.33698 A:0.23315 G:0.24772
#4: NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825
position 1: T:0.13115 C:0.24044 A:0.30601 G:0.32240
position 2: T:0.31148 C:0.30601 A:0.22404 G:0.15847
position 3: T:0.10383 C:0.46448 A:0.16940 G:0.26230
Average T:0.18215 C:0.33698 A:0.23315 G:0.24772
#5: NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710
position 1: T:0.13115 C:0.24044 A:0.30601 G:0.32240
position 2: T:0.31148 C:0.30601 A:0.22404 G:0.15847
position 3: T:0.10383 C:0.46448 A:0.16940 G:0.26230
Average T:0.18215 C:0.33698 A:0.23315 G:0.24772
#6: NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790
position 1: T:0.13115 C:0.24044 A:0.30601 G:0.32240
position 2: T:0.31148 C:0.30601 A:0.22404 G:0.15847
position 3: T:0.10383 C:0.46448 A:0.16940 G:0.26230
Average T:0.18215 C:0.33698 A:0.23315 G:0.24772
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 12 | Cys C TGT 0
TTC 30 | TCC 12 | TAC 6 | TGC 6
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 0
CTC 30 | CCC 30 | CAC 0 | CGC 18
CTA 12 | CCA 6 | Gln Q CAA 30 | CGA 6
CTG 36 | CCG 24 | CAG 36 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 6
ATC 60 | ACC 72 | AAC 66 | AGC 12
ATA 12 | ACA 18 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 12 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 24 | Asp D GAT 0 | Gly G GGT 12
GTC 36 | GCC 48 | GAC 30 | GGC 54
GTA 18 | GCA 30 | Glu E GAA 12 | GGA 18
GTG 36 | GCG 18 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13115 C:0.24044 A:0.30601 G:0.32240
position 2: T:0.31148 C:0.30601 A:0.22404 G:0.15847
position 3: T:0.10383 C:0.46448 A:0.16940 G:0.26230
Average T:0.18215 C:0.33698 A:0.23315 G:0.24772
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -716.627811 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.301641 1.301437
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907670_1_331_MLBR_RS01610: 0.000004, NC_002677_1_NP_301346_1_218_lpqE: 0.000004, NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805: 0.000004, NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825: 0.000004, NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710: 0.000004, NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30164
omega (dN/dS) = 1.30144
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 432.4 116.6 1.3014 0.0000 0.0000 0.0 0.0
7..2 0.000 432.4 116.6 1.3014 0.0000 0.0000 0.0 0.0
7..3 0.000 432.4 116.6 1.3014 0.0000 0.0000 0.0 0.0
7..4 0.000 432.4 116.6 1.3014 0.0000 0.0000 0.0 0.0
7..5 0.000 432.4 116.6 1.3014 0.0000 0.0000 0.0 0.0
7..6 0.000 432.4 116.6 1.3014 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -716.627812 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.737608
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907670_1_331_MLBR_RS01610: 0.000004, NC_002677_1_NP_301346_1_218_lpqE: 0.000004, NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805: 0.000004, NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825: 0.000004, NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710: 0.000004, NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.73761 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -716.627816 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.690863 0.159811 0.000001 1.288726
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907670_1_331_MLBR_RS01610: 0.000004, NC_002677_1_NP_301346_1_218_lpqE: 0.000004, NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805: 0.000004, NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825: 0.000004, NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710: 0.000004, NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.69086 0.15981 0.14933
w: 0.00000 1.00000 1.28873
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.4 115.6 0.3523 0.0000 0.0000 0.0 0.0
7..2 0.000 433.4 115.6 0.3523 0.0000 0.0000 0.0 0.0
7..3 0.000 433.4 115.6 0.3523 0.0000 0.0000 0.0 0.0
7..4 0.000 433.4 115.6 0.3523 0.0000 0.0000 0.0 0.0
7..5 0.000 433.4 115.6 0.3523 0.0000 0.0000 0.0 0.0
7..6 0.000 433.4 115.6 0.3523 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907670_1_331_MLBR_RS01610)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907670_1_331_MLBR_RS01610)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -716.627812 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 3.869908 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907670_1_331_MLBR_RS01610: 0.000004, NC_002677_1_NP_301346_1_218_lpqE: 0.000004, NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805: 0.000004, NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825: 0.000004, NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710: 0.000004, NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 3.86991 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 433.4 115.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -716.627810 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.317085 2.430482 3.042726
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907670_1_331_MLBR_RS01610: 0.000004, NC_002677_1_NP_301346_1_218_lpqE: 0.000004, NZ_LVXE01000066_1_WP_010907670_1_2464_A3216_RS12805: 0.000004, NZ_LYPH01000071_1_WP_010907670_1_2455_A8144_RS11825: 0.000004, NZ_CP029543_1_WP_010907670_1_332_DIJ64_RS01710: 0.000004, NZ_AP014567_1_WP_010907670_1_348_JK2ML_RS01790: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.31708 q = 2.43048
(p1 = 0.99999) w = 3.04273
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00003 0.00084 0.00424 0.01237 0.02780 0.05385 0.09545 0.16110 0.26952 0.48855 3.04273
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 433.4 115.6 3.0427 0.0000 0.0000 0.0 0.0
7..2 0.000 433.4 115.6 3.0427 0.0000 0.0000 0.0 0.0
7..3 0.000 433.4 115.6 3.0427 0.0000 0.0000 0.0 0.0
7..4 0.000 433.4 115.6 3.0427 0.0000 0.0000 0.0 0.0
7..5 0.000 433.4 115.6 3.0427 0.0000 0.0000 0.0 0.0
7..6 0.000 433.4 115.6 3.0427 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907670_1_331_MLBR_RS01610)
Pr(w>1) post mean +- SE for w
1 V 1.000** 3.043
2 S 1.000** 3.043
3 R 1.000** 3.043
4 F 1.000** 3.043
5 K 1.000** 3.043
6 I 1.000** 3.043
7 S 1.000** 3.043
8 L 1.000** 3.043
9 P 1.000** 3.043
10 A 1.000** 3.043
11 L 1.000** 3.043
12 A 1.000** 3.043
13 T 1.000** 3.043
14 R 1.000** 3.043
15 V 1.000** 3.043
16 A 1.000** 3.043
17 V 1.000** 3.043
18 L 1.000** 3.043
19 G 1.000** 3.043
20 F 1.000** 3.043
21 L 1.000** 3.043
22 T 1.000** 3.043
23 L 1.000** 3.043
24 M 1.000** 3.043
25 A 1.000** 3.043
26 S 1.000** 3.043
27 V 1.000** 3.043
28 L 1.000** 3.043
29 G 1.000** 3.043
30 G 1.000** 3.043
31 C 1.000** 3.043
32 G 1.000** 3.043
33 A 1.000** 3.043
34 G 1.000** 3.043
35 Q 1.000** 3.043
36 I 1.000** 3.043
37 S 1.000** 3.043
38 Q 1.000** 3.043
39 T 1.000** 3.043
40 A 1.000** 3.043
41 T 1.000** 3.043
42 Q 1.000** 3.043
43 E 1.000** 3.043
44 P 1.000** 3.043
45 A 1.000** 3.043
46 V 1.000** 3.043
47 N 1.000** 3.043
48 G 1.000** 3.043
49 N 1.000** 3.043
50 R 1.000** 3.043
51 V 1.000** 3.043
52 T 1.000** 3.043
53 L 1.000** 3.043
54 N 1.000** 3.043
55 N 1.000** 3.043
56 L 1.000** 3.043
57 A 1.000** 3.043
58 L 1.000** 3.043
59 R 1.000** 3.043
60 D 1.000** 3.043
61 I 1.000** 3.043
62 R 1.000** 3.043
63 I 1.000** 3.043
64 Q 1.000** 3.043
65 A 1.000** 3.043
66 A 1.000** 3.043
67 Q 1.000** 3.043
68 T 1.000** 3.043
69 G 1.000** 3.043
70 D 1.000** 3.043
71 F 1.000** 3.043
72 L 1.000** 3.043
73 Q 1.000** 3.043
74 S 1.000** 3.043
75 G 1.000** 3.043
76 R 1.000** 3.043
77 T 1.000** 3.043
78 V 1.000** 3.043
79 D 1.000** 3.043
80 L 1.000** 3.043
81 M 1.000** 3.043
82 L 1.000** 3.043
83 V 1.000** 3.043
84 A 1.000** 3.043
85 I 1.000** 3.043
86 N 1.000** 3.043
87 N 1.000** 3.043
88 S 1.000** 3.043
89 P 1.000** 3.043
90 Y 1.000** 3.043
91 V 1.000** 3.043
92 T 1.000** 3.043
93 D 1.000** 3.043
94 R 1.000** 3.043
95 L 1.000** 3.043
96 V 1.000** 3.043
97 S 1.000** 3.043
98 I 1.000** 3.043
99 T 1.000** 3.043
100 S 1.000** 3.043
101 D 1.000** 3.043
102 I 1.000** 3.043
103 G 1.000** 3.043
104 T 1.000** 3.043
105 V 1.000** 3.043
106 A 1.000** 3.043
107 L 1.000** 3.043
108 N 1.000** 3.043
109 G 1.000** 3.043
110 Y 1.000** 3.043
111 T 1.000** 3.043
112 Q 1.000** 3.043
113 L 1.000** 3.043
114 P 1.000** 3.043
115 T 1.000** 3.043
116 N 1.000** 3.043
117 G 1.000** 3.043
118 M 1.000** 3.043
119 L 1.000** 3.043
120 F 1.000** 3.043
121 I 1.000** 3.043
122 G 1.000** 3.043
123 T 1.000** 3.043
124 S 1.000** 3.043
125 E 1.000** 3.043
126 G 1.000** 3.043
127 Q 1.000** 3.043
128 R 1.000** 3.043
129 I 1.000** 3.043
130 K 1.000** 3.043
131 P 1.000** 3.043
132 P 1.000** 3.043
133 P 1.000** 3.043
134 L 1.000** 3.043
135 Q 1.000** 3.043
136 S 1.000** 3.043
137 N 1.000** 3.043
138 N 1.000** 3.043
139 I 1.000** 3.043
140 A 1.000** 3.043
141 K 1.000** 3.043
142 A 1.000** 3.043
143 I 1.000** 3.043
144 V 1.000** 3.043
145 T 1.000** 3.043
146 L 1.000** 3.043
147 A 1.000** 3.043
148 K 1.000** 3.043
149 P 1.000** 3.043
150 I 1.000** 3.043
151 T 1.000** 3.043
152 N 1.000** 3.043
153 G 1.000** 3.043
154 L 1.000** 3.043
155 T 1.000** 3.043
156 Y 1.000** 3.043
157 N 1.000** 3.043
158 F 1.000** 3.043
159 T 1.000** 3.043
160 F 1.000** 3.043
161 N 1.000** 3.043
162 F 1.000** 3.043
163 E 1.000** 3.043
164 K 1.000** 3.043
165 A 1.000** 3.043
166 G 1.000** 3.043
167 Q 1.000** 3.043
168 A 1.000** 3.043
169 N 1.000** 3.043
170 V 1.000** 3.043
171 A 1.000** 3.043
172 V 1.000** 3.043
173 P 1.000** 3.043
174 V 1.000** 3.043
175 S 1.000** 3.043
176 A 1.000** 3.043
177 G 1.000** 3.043
178 L 1.000** 3.043
179 A 1.000** 3.043
180 P 1.000** 3.043
181 R 1.000** 3.043
182 Q 1.000** 3.043
183 T 1.000** 3.043
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907670_1_331_MLBR_RS01610)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -716.627812 Model 2: PositiveSelection -716.627816 Model 0: one-ratio -716.627811 Model 7: beta -716.627812 Model 8: beta&w>1 -716.62781 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 8.000000207175617E-6 Model 8 vs 7 3.999999989900971E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
