--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:04:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lpqE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -749.43          -752.95
2       -749.44          -752.83
--------------------------------------
TOTAL     -749.43          -752.89
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.898465    0.087113    0.380262    1.474698    0.865149   1481.87   1491.43    1.000
r(A<->C){all}   0.163160    0.019344    0.000011    0.437850    0.125165    232.91    236.47    1.006
r(A<->G){all}   0.171746    0.020952    0.000033    0.446796    0.130924    211.82    258.22    1.000
r(A<->T){all}   0.174831    0.021608    0.000008    0.477342    0.134048    114.57    172.05    1.004
r(C<->G){all}   0.160289    0.018310    0.000030    0.427387    0.128548    355.07    368.61    1.003
r(C<->T){all}   0.170025    0.020477    0.000001    0.467853    0.133263    106.51    187.84    1.005
r(G<->T){all}   0.159950    0.017585    0.000022    0.420643    0.128694    298.47    354.88    1.000
pi(A){all}      0.233613    0.000324    0.200038    0.268363    0.233836   1261.45   1343.21    1.000
pi(C){all}      0.336367    0.000402    0.294890    0.372343    0.336655   1175.94   1338.47    1.000
pi(G){all}      0.247722    0.000327    0.214047    0.284398    0.247265   1337.26   1341.14    1.000
pi(T){all}      0.182298    0.000271    0.148977    0.213472    0.181850   1218.68   1352.40    1.000
alpha{1,2}      0.413912    0.218203    0.000130    1.420727    0.243545   1138.35   1152.98    1.000
alpha{3}        0.465027    0.255495    0.000116    1.496414    0.290208   1016.07   1045.23    1.000
pinvar{all}     0.997076    0.000013    0.990551    0.999999    0.998204   1450.98   1475.99    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-716.627812
Model 2: PositiveSelection	-716.627816
Model 0: one-ratio	-716.627811
Model 7: beta	-716.627812
Model 8: beta&w>1	-716.62781


Model 0 vs 1	1.9999999949504854E-6

Model 2 vs 1	8.000000207175617E-6

Model 8 vs 7	3.999999989900971E-6
>C1
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C2
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C3
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C4
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C5
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C6
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=183 

C1              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C2              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C3              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C4              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C5              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C6              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
                **************************************************

C1              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C2              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C3              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C4              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C5              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C6              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
                **************************************************

C1              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C2              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C3              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C4              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C5              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C6              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
                **************************************************

C1              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C2              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C3              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C4              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C5              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C6              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
                *********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  183 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  183 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5490]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5490]--->[5490]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.476 Mb, Max= 30.723 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C2              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C3              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C4              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C5              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
C6              VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
                **************************************************

C1              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C2              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C3              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C4              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C5              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
C6              VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
                **************************************************

C1              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C2              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C3              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C4              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C5              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
C6              DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
                **************************************************

C1              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C2              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C3              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C4              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C5              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
C6              TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
                *********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C2              GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C3              GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C4              GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C5              GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
C6              GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
                **************************************************

C1              CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C2              CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C3              CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C4              CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C5              CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
C6              CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
                **************************************************

C1              GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C2              GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C3              GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C4              GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C5              GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
C6              GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
                **************************************************

C1              GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C2              GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C3              GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C4              GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C5              GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
C6              GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
                **************************************************

C1              GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C2              GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C3              GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C4              GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C5              GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
C6              GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
                **************************************************

C1              CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C2              CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C3              CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C4              CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C5              CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
C6              CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
                **************************************************

C1              GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C2              GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C3              GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C4              GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C5              GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
C6              GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
                **************************************************

C1              GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C2              GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C3              GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C4              GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C5              GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
C6              GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
                **************************************************

C1              TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C2              TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C3              TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C4              TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C5              TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
C6              TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
                **************************************************

C1              ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C2              ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C3              ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C4              ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C5              ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
C6              ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
                **************************************************

C1              AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C2              AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C3              AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C4              AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C5              AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
C6              AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
                *************************************************



>C1
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C2
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C3
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C4
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C5
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C6
GTGAGCCGCTTCAAGATCAGCCTTCCCGCGCTGGCTACCCGGGTCGCCGT
CCTAGGCTTTTTGACTTTGATGGCCTCGGTGCTTGGCGGTTGCGGAGCAG
GCCAGATCTCGCAAACCGCGACCCAGGAACCGGCCGTCAACGGCAACCGG
GTCACACTCAACAATCTGGCATTACGCGACATACGCATCCAAGCCGCGCA
GACCGGTGACTTCCTCCAATCGGGCCGAACGGTGGACTTGATGCTGGTGG
CCATCAATAATTCTCCGTATGTCACAGACCGGCTAGTGTCCATCACCAGT
GACATCGGCACGGTAGCACTGAACGGCTATACCCAACTGCCCACCAACGG
GATGCTGTTCATCGGCACATCCGAAGGGCAGAGAATAAAACCGCCCCCCC
TCCAGTCTAACAACATCGCTAAAGCAATCGTAACCTTGGCCAAGCCCATC
ACCAACGGCCTCACCTACAACTTTACCTTCAACTTCGAGAAGGCTGGACA
AGCCAACGTGGCTGTACCGGTCTCGGCCGGACTCGCACCACGGCAGACC
>C1
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C2
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C3
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C4
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C5
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT
>C6
VSRFKISLPALATRVAVLGFLTLMASVLGGCGAGQISQTATQEPAVNGNR
VTLNNLALRDIRIQAAQTGDFLQSGRTVDLMLVAINNSPYVTDRLVSITS
DIGTVALNGYTQLPTNGMLFIGTSEGQRIKPPPLQSNNIAKAIVTLAKPI
TNGLTYNFTFNFEKAGQANVAVPVSAGLAPRQT


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 549 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579791776
      Setting output file names to "/data/3res/lpqE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 990593298
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0994188740
      Seed = 664850199
      Swapseed = 1579791776
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1228.688325 -- -24.965149
         Chain 2 -- -1228.688325 -- -24.965149
         Chain 3 -- -1228.688325 -- -24.965149
         Chain 4 -- -1228.688325 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1228.688256 -- -24.965149
         Chain 2 -- -1228.688256 -- -24.965149
         Chain 3 -- -1228.688137 -- -24.965149
         Chain 4 -- -1228.688137 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1228.688] (-1228.688) (-1228.688) (-1228.688) * [-1228.688] (-1228.688) (-1228.688) (-1228.688) 
        500 -- [-755.450] (-767.140) (-763.380) (-767.673) * (-764.042) (-767.488) [-761.143] (-763.153) -- 0:00:00
       1000 -- (-763.886) (-757.011) [-762.739] (-775.608) * (-767.639) (-767.709) [-757.119] (-763.066) -- 0:00:00
       1500 -- (-753.187) (-765.398) [-763.901] (-770.615) * (-763.974) [-760.444] (-756.260) (-755.468) -- 0:00:00
       2000 -- [-756.125] (-754.793) (-756.427) (-764.219) * (-753.136) (-761.194) (-759.088) [-766.041] -- 0:08:19
       2500 -- [-756.578] (-767.531) (-755.064) (-759.979) * (-755.295) (-759.819) [-759.942] (-763.292) -- 0:06:39
       3000 -- (-760.524) (-762.287) [-763.186] (-754.362) * [-756.234] (-760.951) (-756.955) (-762.958) -- 0:05:32
       3500 -- [-757.947] (-754.506) (-762.547) (-760.542) * (-759.199) (-768.833) (-755.427) [-758.374] -- 0:04:44
       4000 -- (-761.142) (-760.600) [-758.987] (-760.153) * (-758.110) [-760.487] (-760.230) (-759.228) -- 0:04:09
       4500 -- (-762.235) (-759.173) [-756.975] (-763.366) * (-760.419) [-760.497] (-759.099) (-760.026) -- 0:03:41
       5000 -- (-759.996) [-756.845] (-757.115) (-758.162) * [-756.798] (-770.260) (-760.975) (-755.518) -- 0:03:19

      Average standard deviation of split frequencies: 0.115784

       5500 -- (-758.325) [-759.265] (-762.190) (-757.554) * [-754.586] (-755.881) (-763.559) (-754.550) -- 0:03:00
       6000 -- [-758.825] (-756.815) (-758.866) (-761.467) * [-755.061] (-762.609) (-757.978) (-764.449) -- 0:02:45
       6500 -- [-754.104] (-757.003) (-764.267) (-757.500) * [-759.876] (-765.273) (-758.093) (-764.539) -- 0:02:32
       7000 -- (-759.305) (-757.145) [-761.494] (-759.524) * [-755.118] (-759.559) (-757.815) (-755.920) -- 0:02:21
       7500 -- [-769.149] (-756.047) (-763.701) (-761.789) * [-756.267] (-757.395) (-773.221) (-759.628) -- 0:02:12
       8000 -- (-759.939) (-757.222) [-754.204] (-759.580) * (-764.204) [-765.826] (-750.716) (-755.795) -- 0:02:04
       8500 -- [-758.343] (-758.151) (-759.730) (-761.930) * [-754.301] (-758.209) (-750.974) (-758.779) -- 0:01:56
       9000 -- (-759.498) (-767.480) [-759.705] (-755.625) * (-754.879) (-760.631) (-749.005) [-762.033] -- 0:01:50
       9500 -- (-760.943) [-760.898] (-761.344) (-763.217) * (-759.096) (-756.938) [-749.361] (-758.894) -- 0:01:44
      10000 -- (-757.209) (-756.229) (-759.277) [-755.082] * (-759.000) [-759.548] (-753.737) (-765.271) -- 0:01:39

      Average standard deviation of split frequencies: 0.083189

      10500 -- [-754.014] (-762.223) (-762.536) (-764.007) * (-762.235) [-760.810] (-751.438) (-755.698) -- 0:01:34
      11000 -- (-764.155) (-758.180) (-758.928) [-755.785] * [-757.645] (-756.319) (-749.360) (-761.048) -- 0:01:29
      11500 -- [-757.313] (-760.330) (-760.076) (-761.909) * (-760.786) [-762.191] (-752.271) (-765.805) -- 0:01:25
      12000 -- (-755.885) (-766.758) [-760.498] (-762.341) * (-758.851) (-765.749) (-753.110) [-757.235] -- 0:01:22
      12500 -- (-756.854) (-762.450) [-757.138] (-755.986) * (-765.482) (-756.490) [-749.719] (-753.195) -- 0:01:19
      13000 -- (-752.913) (-760.628) (-756.434) [-752.494] * [-756.802] (-756.715) (-751.623) (-755.996) -- 0:01:15
      13500 -- [-750.325] (-759.018) (-758.239) (-756.107) * [-755.027] (-759.975) (-757.433) (-768.733) -- 0:01:13
      14000 -- (-754.191) [-757.310] (-761.744) (-758.700) * [-754.122] (-763.505) (-748.748) (-762.747) -- 0:01:10
      14500 -- (-753.408) (-764.368) [-761.413] (-757.537) * (-756.124) [-760.412] (-747.935) (-759.788) -- 0:01:07
      15000 -- (-752.743) (-758.192) [-761.057] (-769.181) * (-763.374) (-763.004) (-748.637) [-758.429] -- 0:01:05

      Average standard deviation of split frequencies: 0.070383

      15500 -- [-754.972] (-761.545) (-759.254) (-772.055) * (-759.249) (-759.810) (-752.078) [-756.715] -- 0:01:03
      16000 -- (-748.914) [-760.113] (-763.891) (-757.502) * (-757.004) (-763.873) (-749.542) [-758.012] -- 0:02:03
      16500 -- (-748.637) (-758.190) [-765.075] (-755.805) * (-769.857) (-761.388) [-749.170] (-760.363) -- 0:01:59
      17000 -- (-747.999) (-757.753) (-759.534) [-764.202] * (-761.102) (-755.362) [-748.669] (-770.564) -- 0:01:55
      17500 -- (-750.648) (-762.244) (-756.629) [-759.773] * (-758.707) [-758.859] (-752.811) (-756.212) -- 0:01:52
      18000 -- (-753.298) (-757.284) (-754.876) [-759.362] * (-757.111) (-759.728) (-751.622) [-760.139] -- 0:01:49
      18500 -- (-754.535) [-764.155] (-761.902) (-761.687) * (-767.112) (-760.408) [-753.460] (-751.406) -- 0:01:46
      19000 -- [-753.668] (-759.454) (-763.689) (-757.780) * [-763.906] (-762.050) (-756.815) (-748.770) -- 0:01:43
      19500 -- (-749.757) (-764.845) (-761.095) [-757.179] * (-758.745) (-765.516) (-748.773) [-750.253] -- 0:01:40
      20000 -- [-748.007] (-755.917) (-759.526) (-764.986) * (-759.205) (-758.337) (-751.025) [-748.242] -- 0:01:38

      Average standard deviation of split frequencies: 0.059559

      20500 -- (-750.478) (-757.921) [-762.680] (-762.070) * [-752.879] (-759.344) (-749.047) (-748.291) -- 0:01:35
      21000 -- [-751.036] (-762.250) (-758.201) (-764.267) * (-763.046) [-755.868] (-750.398) (-750.955) -- 0:01:33
      21500 -- (-748.574) (-756.481) [-759.941] (-762.196) * (-765.890) (-763.647) (-749.130) [-748.017] -- 0:01:31
      22000 -- (-748.705) (-755.558) [-761.990] (-757.040) * (-763.933) (-759.043) [-749.434] (-750.148) -- 0:01:28
      22500 -- (-753.691) (-766.300) [-763.676] (-764.869) * (-752.677) (-755.908) (-751.046) [-747.994] -- 0:01:26
      23000 -- (-748.497) (-761.842) (-758.670) [-760.223] * [-747.955] (-771.100) (-752.643) (-750.850) -- 0:01:24
      23500 -- (-753.374) [-757.497] (-764.307) (-760.341) * [-747.943] (-766.412) (-753.213) (-749.299) -- 0:01:23
      24000 -- (-754.163) (-757.443) [-760.085] (-757.214) * [-750.839] (-757.498) (-750.411) (-750.909) -- 0:01:21
      24500 -- (-751.347) (-753.333) [-756.867] (-758.219) * (-753.744) (-761.170) [-750.560] (-753.412) -- 0:01:19
      25000 -- [-751.801] (-748.634) (-761.429) (-757.873) * (-750.729) (-761.246) (-750.107) [-750.001] -- 0:01:18

      Average standard deviation of split frequencies: 0.037086

      25500 -- [-750.598] (-750.827) (-761.915) (-761.925) * (-751.842) [-756.384] (-749.230) (-750.317) -- 0:01:16
      26000 -- (-751.572) (-748.912) (-758.009) [-758.745] * [-753.070] (-757.099) (-755.053) (-750.958) -- 0:01:14
      26500 -- [-752.516] (-747.965) (-763.917) (-773.439) * (-750.482) (-763.804) (-750.290) [-748.938] -- 0:01:13
      27000 -- (-749.817) (-749.031) [-758.200] (-759.876) * [-752.651] (-762.049) (-749.877) (-748.368) -- 0:01:12
      27500 -- [-749.593] (-749.817) (-777.709) (-758.439) * (-752.939) (-758.665) (-748.653) [-748.410] -- 0:01:10
      28000 -- (-751.967) (-748.518) (-760.869) [-757.151] * (-752.982) [-759.484] (-749.255) (-748.565) -- 0:01:09
      28500 -- (-752.403) (-749.007) (-756.088) [-754.684] * (-749.917) [-763.651] (-751.117) (-752.672) -- 0:01:08
      29000 -- (-754.435) [-748.896] (-760.408) (-762.486) * (-750.048) (-755.302) (-752.145) [-751.091] -- 0:01:06
      29500 -- (-749.566) (-748.604) (-757.839) [-755.829] * (-750.577) (-758.749) [-754.608] (-751.004) -- 0:01:05
      30000 -- (-749.471) (-747.978) (-756.920) [-758.476] * (-752.515) (-748.675) [-752.052] (-749.001) -- 0:01:37

      Average standard deviation of split frequencies: 0.032141

      30500 -- [-748.972] (-753.756) (-759.183) (-769.839) * (-749.754) (-751.585) (-748.718) [-751.936] -- 0:01:35
      31000 -- (-749.021) (-754.147) [-753.894] (-757.832) * (-749.260) (-748.896) (-748.818) [-751.275] -- 0:01:33
      31500 -- [-749.224] (-754.714) (-765.651) (-755.878) * (-747.946) (-749.096) [-750.112] (-751.625) -- 0:01:32
      32000 -- (-748.801) (-750.739) [-756.404] (-761.888) * (-750.839) (-749.543) [-749.620] (-749.640) -- 0:01:30
      32500 -- (-748.272) (-749.556) (-760.471) [-756.737] * (-749.727) (-749.616) (-748.283) [-754.253] -- 0:01:29
      33000 -- (-749.597) (-749.567) (-757.161) [-757.672] * [-748.345] (-752.446) (-749.285) (-752.796) -- 0:01:27
      33500 -- (-752.653) [-748.715] (-759.247) (-756.571) * (-748.265) (-752.012) [-748.578] (-754.216) -- 0:01:26
      34000 -- [-748.247] (-754.279) (-755.591) (-762.367) * (-749.691) (-751.231) [-749.899] (-752.916) -- 0:01:25
      34500 -- (-748.276) (-754.635) [-760.039] (-758.413) * [-748.615] (-750.867) (-750.400) (-754.605) -- 0:01:23
      35000 -- (-754.975) (-750.234) [-755.085] (-754.287) * (-750.309) [-751.315] (-750.120) (-750.975) -- 0:01:22

      Average standard deviation of split frequencies: 0.028808

      35500 -- (-754.861) (-752.955) [-756.679] (-756.848) * (-752.403) (-751.068) [-751.130] (-749.322) -- 0:01:21
      36000 -- (-749.136) (-750.272) (-759.234) [-760.639] * (-750.256) (-750.143) (-752.337) [-752.926] -- 0:01:20
      36500 -- (-750.949) (-751.409) (-755.503) [-758.584] * (-754.970) [-751.665] (-752.898) (-749.562) -- 0:01:19
      37000 -- (-751.013) (-749.819) [-756.188] (-765.521) * (-750.062) [-752.939] (-751.678) (-755.028) -- 0:01:18
      37500 -- (-749.155) [-748.695] (-758.270) (-758.967) * (-748.460) (-749.845) [-750.601] (-753.792) -- 0:01:17
      38000 -- (-750.055) (-749.352) [-758.980] (-761.741) * (-754.809) (-750.480) (-750.006) [-753.391] -- 0:01:15
      38500 -- (-755.279) [-748.424] (-770.307) (-761.035) * (-749.798) (-750.666) [-752.368] (-749.393) -- 0:01:14
      39000 -- (-750.932) (-757.399) [-761.465] (-759.608) * [-753.651] (-750.950) (-750.242) (-749.515) -- 0:01:13
      39500 -- (-750.062) [-749.845] (-759.700) (-755.873) * (-752.014) [-749.632] (-750.080) (-750.756) -- 0:01:12
      40000 -- [-751.329] (-750.219) (-765.169) (-755.483) * (-750.792) (-750.630) [-753.446] (-749.894) -- 0:01:12

      Average standard deviation of split frequencies: 0.032335

      40500 -- (-752.205) (-749.556) [-761.880] (-755.025) * [-752.815] (-750.852) (-754.129) (-749.670) -- 0:01:11
      41000 -- (-749.657) [-753.121] (-760.752) (-756.318) * (-757.133) (-750.931) (-750.488) [-748.825] -- 0:01:10
      41500 -- (-750.278) [-755.195] (-756.538) (-758.416) * (-758.632) (-749.414) (-749.756) [-750.689] -- 0:01:09
      42000 -- [-748.587] (-751.545) (-755.841) (-759.958) * (-752.371) [-752.294] (-749.149) (-750.820) -- 0:01:08
      42500 -- (-749.465) [-750.824] (-760.227) (-762.974) * (-751.979) (-749.308) [-750.481] (-752.408) -- 0:01:07
      43000 -- [-749.189] (-750.974) (-755.500) (-765.102) * (-749.723) (-750.423) (-754.990) [-748.928] -- 0:01:06
      43500 -- [-749.531] (-752.497) (-762.459) (-755.083) * [-748.322] (-748.195) (-750.358) (-749.468) -- 0:01:05
      44000 -- (-748.539) [-750.714] (-761.743) (-766.907) * (-751.850) (-749.639) [-750.390] (-751.014) -- 0:01:05
      44500 -- (-750.541) (-749.877) [-759.657] (-758.798) * (-750.340) [-749.592] (-748.610) (-749.495) -- 0:01:04
      45000 -- (-750.610) [-752.624] (-764.532) (-762.536) * (-750.012) [-752.062] (-752.800) (-749.788) -- 0:01:03

      Average standard deviation of split frequencies: 0.031232

      45500 -- (-749.931) (-748.415) (-765.689) [-751.892] * (-750.897) (-751.035) [-749.913] (-751.348) -- 0:01:23
      46000 -- (-749.037) (-748.468) (-763.219) [-766.873] * (-749.372) (-751.002) [-748.747] (-750.613) -- 0:01:22
      46500 -- (-748.046) (-751.742) [-755.028] (-766.091) * (-752.845) [-749.070] (-748.485) (-753.006) -- 0:01:22
      47000 -- (-748.349) [-752.428] (-764.507) (-762.264) * (-748.616) (-748.890) [-749.418] (-749.790) -- 0:01:21
      47500 -- (-749.251) (-749.105) (-762.663) [-759.237] * (-750.977) (-750.026) (-749.438) [-751.893] -- 0:01:20
      48000 -- (-749.872) (-749.324) [-750.151] (-760.075) * [-748.949] (-750.176) (-749.781) (-753.269) -- 0:01:19
      48500 -- (-750.815) (-748.023) (-750.954) [-762.142] * (-752.547) [-750.248] (-748.918) (-750.230) -- 0:01:18
      49000 -- (-749.523) [-748.515] (-752.175) (-757.958) * (-756.011) (-749.474) [-749.814] (-751.216) -- 0:01:17
      49500 -- (-750.733) (-749.052) (-750.512) [-756.969] * (-753.944) (-749.871) (-749.786) [-749.850] -- 0:01:16
      50000 -- (-748.333) [-750.344] (-750.722) (-772.454) * (-751.198) (-749.875) [-749.252] (-750.327) -- 0:01:16

      Average standard deviation of split frequencies: 0.026220

      50500 -- (-749.109) (-750.080) [-751.766] (-760.883) * [-749.816] (-749.910) (-747.734) (-751.214) -- 0:01:15
      51000 -- [-748.886] (-752.486) (-750.607) (-753.398) * (-749.353) [-749.679] (-749.423) (-756.032) -- 0:01:14
      51500 -- (-748.138) (-749.255) [-753.138] (-749.763) * [-749.903] (-755.059) (-750.043) (-751.250) -- 0:01:13
      52000 -- (-748.738) (-749.798) [-749.858] (-749.515) * (-754.068) [-749.419] (-752.366) (-752.408) -- 0:01:12
      52500 -- [-750.411] (-749.579) (-749.570) (-749.721) * (-754.199) [-748.981] (-750.814) (-749.438) -- 0:01:12
      53000 -- [-750.174] (-748.756) (-750.690) (-750.977) * (-752.287) [-749.536] (-750.724) (-749.738) -- 0:01:11
      53500 -- (-748.981) (-754.090) [-748.580] (-750.797) * (-752.708) (-752.837) [-749.421] (-752.913) -- 0:01:10
      54000 -- (-748.461) (-750.158) [-750.245] (-751.296) * (-753.510) (-751.656) [-749.263] (-750.232) -- 0:01:10
      54500 -- (-748.740) (-749.950) (-752.796) [-750.359] * (-750.750) (-751.508) [-749.871] (-749.932) -- 0:01:09
      55000 -- [-749.413] (-749.312) (-758.445) (-750.927) * [-752.283] (-750.435) (-751.407) (-751.241) -- 0:01:08

      Average standard deviation of split frequencies: 0.027550

      55500 -- (-754.688) (-748.943) (-755.723) [-751.953] * (-751.852) (-750.329) (-750.441) [-749.190] -- 0:01:08
      56000 -- (-749.426) (-748.986) (-753.629) [-749.988] * (-751.602) [-752.615] (-749.528) (-749.133) -- 0:01:07
      56500 -- (-751.947) (-749.780) [-751.009] (-752.350) * (-750.582) (-752.311) [-750.192] (-749.801) -- 0:01:06
      57000 -- (-749.310) (-750.820) (-758.990) [-749.791] * (-751.031) (-750.098) (-750.763) [-749.431] -- 0:01:06
      57500 -- (-750.516) (-750.036) (-749.050) [-749.638] * (-751.549) [-755.033] (-749.092) (-752.058) -- 0:01:05
      58000 -- (-748.502) (-749.003) [-750.156] (-750.147) * [-751.050] (-750.509) (-749.518) (-749.867) -- 0:01:04
      58500 -- [-750.650] (-751.752) (-754.142) (-753.492) * (-754.204) [-750.958] (-750.141) (-749.863) -- 0:01:04
      59000 -- (-750.383) [-753.211] (-750.478) (-751.462) * (-749.594) (-749.612) [-751.488] (-750.046) -- 0:01:03
      59500 -- [-748.800] (-753.144) (-750.194) (-750.153) * (-752.104) (-750.106) (-750.294) [-748.326] -- 0:01:03
      60000 -- [-749.338] (-749.426) (-756.352) (-749.341) * (-752.572) (-748.763) (-751.765) [-750.882] -- 0:01:02

      Average standard deviation of split frequencies: 0.024791

      60500 -- (-750.346) (-749.334) [-750.487] (-751.053) * (-750.794) (-755.982) [-750.524] (-754.663) -- 0:01:02
      61000 -- (-752.005) (-751.553) (-754.033) [-751.738] * (-749.332) [-749.472] (-750.999) (-749.066) -- 0:01:01
      61500 -- (-748.812) [-749.378] (-761.592) (-748.972) * (-749.507) [-750.382] (-749.264) (-749.129) -- 0:01:01
      62000 -- [-750.085] (-748.582) (-752.187) (-752.380) * [-749.590] (-749.356) (-753.374) (-751.899) -- 0:01:15
      62500 -- (-748.490) [-748.611] (-749.159) (-754.391) * (-751.494) (-748.518) [-749.195] (-752.649) -- 0:01:15
      63000 -- [-748.862] (-751.029) (-750.385) (-750.291) * [-749.162] (-749.269) (-749.548) (-749.871) -- 0:01:14
      63500 -- [-748.540] (-750.604) (-749.389) (-750.941) * [-750.797] (-752.166) (-752.261) (-750.274) -- 0:01:13
      64000 -- (-748.694) [-750.474] (-753.777) (-751.814) * (-753.743) [-751.400] (-750.896) (-750.612) -- 0:01:13
      64500 -- (-749.011) [-748.958] (-753.627) (-751.325) * [-751.978] (-751.652) (-750.693) (-751.122) -- 0:01:12
      65000 -- (-749.041) [-750.206] (-752.959) (-749.126) * [-754.211] (-749.964) (-749.700) (-750.299) -- 0:01:11

      Average standard deviation of split frequencies: 0.023808

      65500 -- (-749.527) (-749.504) [-751.096] (-748.839) * (-751.229) [-750.419] (-751.777) (-751.931) -- 0:01:11
      66000 -- (-749.159) (-750.510) [-750.042] (-749.801) * (-752.220) [-752.101] (-752.086) (-751.265) -- 0:01:10
      66500 -- (-749.150) (-750.485) [-750.057] (-756.026) * [-750.153] (-751.072) (-751.845) (-754.655) -- 0:01:10
      67000 -- (-751.443) (-748.561) [-751.524] (-752.183) * (-748.016) (-749.237) [-749.578] (-753.353) -- 0:01:09
      67500 -- [-752.153] (-748.620) (-750.745) (-751.848) * [-749.162] (-749.133) (-749.854) (-752.466) -- 0:01:09
      68000 -- (-751.373) (-748.212) [-750.542] (-749.562) * (-748.156) [-753.370] (-748.752) (-753.621) -- 0:01:08
      68500 -- (-752.014) (-752.508) (-747.861) [-751.567] * (-752.343) (-750.637) [-748.064] (-749.948) -- 0:01:07
      69000 -- (-749.660) (-750.075) [-748.406] (-751.053) * (-751.616) [-749.390] (-750.386) (-751.170) -- 0:01:07
      69500 -- (-750.601) [-751.391] (-749.013) (-752.874) * [-750.943] (-749.527) (-750.456) (-749.015) -- 0:01:06
      70000 -- (-748.568) (-748.934) (-748.621) [-749.318] * (-748.351) (-749.196) (-749.417) [-751.344] -- 0:01:06

      Average standard deviation of split frequencies: 0.023348

      70500 -- (-748.517) [-749.161] (-752.498) (-751.557) * (-750.642) (-748.536) [-748.490] (-750.065) -- 0:01:05
      71000 -- [-748.995] (-749.408) (-751.721) (-750.782) * (-749.768) (-750.015) [-750.704] (-749.095) -- 0:01:05
      71500 -- (-749.892) [-750.224] (-751.230) (-751.902) * (-750.989) (-749.158) [-749.330] (-749.426) -- 0:01:04
      72000 -- [-747.989] (-749.645) (-750.421) (-751.611) * [-752.532] (-748.132) (-750.149) (-756.106) -- 0:01:04
      72500 -- (-752.621) (-749.997) (-750.492) [-750.224] * (-751.750) (-748.566) (-752.009) [-751.678] -- 0:01:03
      73000 -- [-748.680] (-748.208) (-750.773) (-749.718) * (-751.431) (-749.159) (-751.337) [-749.242] -- 0:01:03
      73500 -- [-752.018] (-750.931) (-748.478) (-749.142) * (-749.622) (-749.996) (-753.511) [-751.247] -- 0:01:03
      74000 -- [-750.501] (-751.300) (-750.064) (-749.863) * (-750.022) (-750.628) [-751.923] (-752.205) -- 0:01:02
      74500 -- [-749.144] (-752.229) (-751.223) (-749.986) * (-749.303) (-749.606) [-747.928] (-749.170) -- 0:01:02
      75000 -- [-748.860] (-749.245) (-749.347) (-755.933) * (-753.466) (-749.792) (-748.601) [-754.179] -- 0:01:01

      Average standard deviation of split frequencies: 0.022950

      75500 -- (-750.047) (-748.440) (-749.925) [-749.949] * (-751.025) (-751.039) (-749.345) [-748.942] -- 0:01:01
      76000 -- (-749.215) (-753.500) [-749.386] (-748.450) * (-751.041) [-749.525] (-750.383) (-750.701) -- 0:01:00
      76500 -- (-749.784) [-748.561] (-749.200) (-748.449) * (-751.035) [-749.936] (-751.350) (-748.553) -- 0:01:00
      77000 -- (-748.155) [-748.183] (-750.740) (-748.727) * (-748.984) (-750.660) (-752.183) [-750.208] -- 0:00:59
      77500 -- (-748.698) (-749.121) (-757.444) [-749.346] * (-748.745) (-754.632) (-749.761) [-750.832] -- 0:00:59
      78000 -- (-749.033) (-748.655) (-752.656) [-749.894] * (-752.251) (-748.502) (-749.404) [-750.121] -- 0:00:59
      78500 -- [-750.458] (-753.179) (-754.132) (-748.010) * (-751.963) (-748.400) (-748.245) [-750.433] -- 0:00:58
      79000 -- (-751.133) [-749.826] (-753.930) (-747.902) * (-749.699) [-748.797] (-748.334) (-748.586) -- 0:01:09
      79500 -- (-749.544) (-750.728) (-751.791) [-749.211] * (-749.095) (-748.921) [-748.280] (-748.392) -- 0:01:09
      80000 -- (-749.122) (-750.328) [-750.149] (-750.139) * (-748.231) (-750.042) [-748.730] (-750.554) -- 0:01:09

      Average standard deviation of split frequencies: 0.020300

      80500 -- (-753.789) (-749.715) [-750.992] (-751.471) * (-749.697) (-748.350) [-748.095] (-750.191) -- 0:01:08
      81000 -- [-748.362] (-751.093) (-749.610) (-751.025) * (-749.563) (-753.082) [-751.075] (-748.987) -- 0:01:08
      81500 -- (-750.086) (-752.227) (-749.428) [-750.199] * (-750.112) [-753.525] (-752.531) (-750.063) -- 0:01:07
      82000 -- (-751.655) [-751.515] (-751.585) (-749.641) * (-752.694) [-749.969] (-749.869) (-750.840) -- 0:01:07
      82500 -- (-752.392) (-752.542) (-751.301) [-750.735] * (-751.866) [-748.994] (-750.779) (-750.263) -- 0:01:06
      83000 -- (-751.398) (-753.921) (-750.922) [-751.122] * [-749.709] (-749.798) (-752.762) (-749.136) -- 0:01:06
      83500 -- (-753.036) [-755.768] (-752.036) (-750.828) * (-748.950) (-749.168) (-749.657) [-749.371] -- 0:01:05
      84000 -- [-750.943] (-751.857) (-748.924) (-750.601) * [-752.458] (-749.881) (-753.671) (-753.525) -- 0:01:05
      84500 -- [-749.777] (-751.601) (-750.036) (-749.013) * (-752.679) [-749.330] (-750.743) (-753.857) -- 0:01:05
      85000 -- (-750.039) (-749.462) [-748.921] (-751.340) * (-748.774) (-748.446) (-749.458) [-750.969] -- 0:01:04

      Average standard deviation of split frequencies: 0.019041

      85500 -- (-749.824) (-750.263) [-748.880] (-750.837) * (-752.383) (-749.612) (-748.577) [-750.216] -- 0:01:04
      86000 -- (-749.768) (-750.591) (-750.076) [-751.017] * (-751.360) (-749.854) (-748.630) [-751.711] -- 0:01:03
      86500 -- (-753.641) [-749.194] (-756.124) (-754.182) * (-749.310) (-752.767) (-753.029) [-749.027] -- 0:01:03
      87000 -- (-749.911) (-753.393) (-752.139) [-748.562] * (-750.129) (-751.370) (-751.877) [-750.108] -- 0:01:02
      87500 -- (-751.791) (-750.840) (-752.228) [-749.022] * [-749.436] (-750.000) (-750.803) (-750.586) -- 0:01:02
      88000 -- (-751.012) (-751.345) (-750.470) [-749.305] * (-752.499) [-749.967] (-750.200) (-748.655) -- 0:01:02
      88500 -- (-753.283) (-750.560) (-751.752) [-750.250] * (-749.107) [-749.868] (-750.672) (-751.125) -- 0:01:01
      89000 -- (-749.507) [-748.794] (-751.133) (-752.139) * (-748.506) [-753.018] (-751.796) (-748.242) -- 0:01:01
      89500 -- (-750.811) (-749.918) (-752.426) [-750.363] * (-750.020) (-749.392) [-750.351] (-751.582) -- 0:01:01
      90000 -- (-751.057) (-751.175) (-751.023) [-748.174] * [-754.410] (-752.079) (-748.033) (-750.388) -- 0:01:00

      Average standard deviation of split frequencies: 0.017678

      90500 -- (-750.115) (-750.851) [-749.478] (-748.221) * [-749.522] (-750.857) (-750.196) (-749.780) -- 0:01:00
      91000 -- (-749.982) (-751.538) [-751.501] (-748.501) * [-752.241] (-751.015) (-750.338) (-749.994) -- 0:00:59
      91500 -- [-749.959] (-751.438) (-754.718) (-753.215) * [-750.476] (-754.023) (-748.380) (-748.875) -- 0:00:59
      92000 -- (-751.732) [-750.216] (-754.102) (-750.525) * (-748.923) (-752.664) [-750.739] (-750.093) -- 0:00:59
      92500 -- (-750.854) (-747.780) (-751.438) [-750.811] * [-749.218] (-752.167) (-752.063) (-749.025) -- 0:00:58
      93000 -- (-749.433) [-748.036] (-752.735) (-749.210) * (-750.057) [-749.393] (-749.097) (-752.389) -- 0:00:58
      93500 -- (-751.658) [-750.344] (-751.242) (-748.412) * [-750.102] (-749.650) (-750.013) (-750.278) -- 0:00:58
      94000 -- [-750.095] (-750.314) (-751.550) (-749.120) * [-748.332] (-753.023) (-750.470) (-751.903) -- 0:00:57
      94500 -- (-748.275) (-749.620) (-749.197) [-750.093] * [-749.815] (-753.845) (-752.662) (-749.357) -- 0:00:57
      95000 -- (-750.096) (-752.059) [-752.067] (-749.469) * (-749.179) (-750.845) [-749.711] (-748.803) -- 0:00:57

      Average standard deviation of split frequencies: 0.018905

      95500 -- (-752.087) [-750.009] (-753.501) (-748.280) * [-748.710] (-750.086) (-750.477) (-752.747) -- 0:01:06
      96000 -- [-752.434] (-753.215) (-752.802) (-751.759) * (-753.129) (-750.393) (-752.708) [-749.572] -- 0:01:05
      96500 -- [-753.441] (-750.449) (-750.825) (-749.350) * (-750.733) [-748.537] (-755.143) (-751.529) -- 0:01:05
      97000 -- (-753.068) [-750.697] (-752.563) (-752.307) * [-750.231] (-748.913) (-755.822) (-750.226) -- 0:01:05
      97500 -- [-750.603] (-750.536) (-751.988) (-750.175) * (-750.477) (-749.474) (-751.865) [-748.917] -- 0:01:04
      98000 -- [-752.597] (-748.918) (-750.083) (-748.873) * (-754.510) (-750.016) (-750.215) [-749.344] -- 0:01:04
      98500 -- [-749.538] (-750.269) (-749.442) (-749.822) * (-756.818) [-748.981] (-748.142) (-749.742) -- 0:01:04
      99000 -- (-750.517) (-748.915) (-749.780) [-751.464] * (-751.566) [-749.762] (-748.255) (-756.319) -- 0:01:03
      99500 -- (-751.747) [-748.706] (-750.254) (-749.983) * (-750.774) [-750.058] (-749.728) (-751.895) -- 0:01:03
      100000 -- (-748.535) (-750.263) [-751.125] (-749.542) * (-750.755) (-749.613) (-749.280) [-750.981] -- 0:01:02

      Average standard deviation of split frequencies: 0.017795

      100500 -- [-748.744] (-751.299) (-750.926) (-750.231) * (-749.915) (-753.650) [-748.863] (-751.409) -- 0:01:02
      101000 -- [-748.145] (-750.306) (-750.344) (-750.805) * (-749.605) (-750.394) (-748.523) [-749.976] -- 0:01:02
      101500 -- [-748.968] (-751.357) (-749.466) (-752.190) * (-748.415) (-748.444) [-748.911] (-749.497) -- 0:01:01
      102000 -- (-749.450) (-748.670) [-748.492] (-753.355) * (-750.444) (-748.730) [-749.996] (-750.793) -- 0:01:01
      102500 -- (-749.230) (-749.135) [-748.795] (-748.941) * (-750.466) (-749.232) [-750.681] (-748.244) -- 0:01:01
      103000 -- [-747.817] (-749.507) (-751.622) (-748.618) * [-750.019] (-749.127) (-757.979) (-750.792) -- 0:01:00
      103500 -- (-749.342) (-753.465) (-754.655) [-749.210] * (-750.276) (-750.217) (-751.492) [-749.787] -- 0:01:00
      104000 -- [-748.243] (-756.037) (-751.041) (-750.300) * [-750.046] (-750.488) (-757.171) (-750.047) -- 0:01:00
      104500 -- (-749.595) (-750.688) (-749.020) [-749.036] * (-752.022) [-748.984] (-749.119) (-751.237) -- 0:00:59
      105000 -- [-750.231] (-752.973) (-755.032) (-750.466) * (-751.590) [-749.003] (-749.963) (-752.078) -- 0:00:59

      Average standard deviation of split frequencies: 0.016455

      105500 -- (-750.209) (-752.132) (-748.278) [-750.580] * (-753.808) (-748.932) (-748.824) [-751.370] -- 0:00:59
      106000 -- (-748.744) (-755.553) [-748.305] (-753.577) * (-750.839) (-748.352) (-754.695) [-750.271] -- 0:00:59
      106500 -- (-753.894) (-752.552) [-750.096] (-751.291) * (-749.563) [-748.927] (-751.699) (-754.886) -- 0:00:58
      107000 -- [-755.109] (-757.049) (-749.323) (-751.507) * (-748.331) (-751.344) (-752.223) [-753.387] -- 0:00:58
      107500 -- (-751.527) (-757.256) [-749.320] (-753.339) * (-748.477) (-752.148) [-751.052] (-750.240) -- 0:00:58
      108000 -- (-748.380) (-750.466) [-749.350] (-751.735) * [-750.041] (-753.498) (-749.672) (-752.371) -- 0:00:57
      108500 -- (-752.552) (-748.771) [-748.261] (-749.896) * (-748.201) (-748.927) (-752.158) [-750.292] -- 0:00:57
      109000 -- (-751.973) (-753.094) [-749.961] (-752.156) * (-748.371) [-751.967] (-751.916) (-749.700) -- 0:00:57
      109500 -- [-749.430] (-754.144) (-751.783) (-753.574) * [-748.871] (-748.994) (-750.240) (-749.196) -- 0:00:56
      110000 -- (-749.435) (-753.850) [-749.515] (-748.651) * (-749.256) (-749.802) [-748.755] (-748.687) -- 0:00:56

      Average standard deviation of split frequencies: 0.018530

      110500 -- (-753.084) (-750.202) (-749.926) [-750.553] * (-749.049) (-750.045) (-752.625) [-750.130] -- 0:00:56
      111000 -- [-750.458] (-751.336) (-754.768) (-750.154) * (-749.639) (-752.832) [-750.381] (-748.928) -- 0:00:56
      111500 -- [-750.792] (-751.068) (-751.906) (-753.367) * (-748.345) (-749.634) (-751.389) [-749.812] -- 0:00:55
      112000 -- (-752.453) (-754.002) [-749.700] (-752.695) * (-753.056) (-755.030) [-751.671] (-749.674) -- 0:01:03
      112500 -- [-748.996] (-753.759) (-749.898) (-751.916) * (-750.872) [-749.485] (-752.224) (-750.329) -- 0:01:03
      113000 -- (-750.098) (-750.598) [-749.865] (-756.916) * (-751.494) (-748.241) [-750.113] (-754.195) -- 0:01:02
      113500 -- (-749.356) [-749.994] (-748.440) (-752.026) * [-749.455] (-752.942) (-750.722) (-750.903) -- 0:01:02
      114000 -- [-748.649] (-751.877) (-748.978) (-751.111) * (-750.905) (-751.296) [-755.951] (-750.658) -- 0:01:02
      114500 -- [-748.836] (-751.271) (-753.168) (-749.761) * (-749.973) (-751.753) [-752.720] (-753.255) -- 0:01:01
      115000 -- [-750.323] (-749.577) (-751.037) (-750.922) * (-749.952) (-750.352) (-752.929) [-748.524] -- 0:01:01

      Average standard deviation of split frequencies: 0.018287

      115500 -- (-748.994) (-749.295) (-753.585) [-750.140] * (-751.091) (-751.316) (-750.516) [-749.391] -- 0:01:01
      116000 -- (-750.497) (-748.844) (-748.416) [-748.351] * (-753.855) [-753.366] (-750.279) (-749.724) -- 0:01:00
      116500 -- [-753.727] (-749.860) (-748.214) (-751.738) * (-749.960) (-753.694) [-749.586] (-750.616) -- 0:01:00
      117000 -- (-754.228) (-752.085) [-748.562] (-753.082) * [-749.799] (-753.259) (-748.168) (-749.717) -- 0:01:00
      117500 -- (-750.612) (-749.040) (-749.224) [-751.073] * (-753.121) (-750.688) [-749.262] (-749.652) -- 0:01:00
      118000 -- (-750.398) (-750.493) [-748.077] (-747.999) * (-753.140) (-749.997) [-751.599] (-749.703) -- 0:00:59
      118500 -- (-750.464) (-751.616) [-750.322] (-750.847) * [-753.181] (-752.188) (-750.592) (-749.613) -- 0:00:59
      119000 -- (-749.037) [-749.640] (-750.823) (-751.711) * (-750.256) (-753.388) (-749.366) [-748.486] -- 0:00:59
      119500 -- (-748.560) (-751.834) (-748.838) [-749.603] * (-752.994) [-749.891] (-751.410) (-749.729) -- 0:00:58
      120000 -- (-749.140) [-749.773] (-748.781) (-751.310) * (-750.986) (-750.924) (-749.773) [-750.690] -- 0:00:58

      Average standard deviation of split frequencies: 0.017775

      120500 -- (-752.780) (-749.317) (-749.963) [-755.089] * (-750.998) (-750.873) [-748.829] (-754.419) -- 0:00:58
      121000 -- (-754.540) (-749.901) (-749.794) [-751.494] * (-753.070) (-752.521) (-751.119) [-749.259] -- 0:00:58
      121500 -- (-751.884) (-749.126) [-750.470] (-751.442) * (-749.901) (-748.627) (-751.466) [-749.465] -- 0:00:57
      122000 -- (-752.629) (-750.601) (-749.037) [-752.868] * (-748.157) (-750.392) [-749.249] (-749.434) -- 0:00:57
      122500 -- (-749.818) (-750.338) (-748.822) [-750.079] * (-749.798) [-749.658] (-750.294) (-749.224) -- 0:00:57
      123000 -- [-750.844] (-750.447) (-750.313) (-752.583) * (-751.944) (-749.951) (-750.121) [-751.392] -- 0:00:57
      123500 -- [-749.749] (-751.138) (-749.466) (-750.377) * (-748.511) [-750.122] (-748.847) (-751.349) -- 0:00:56
      124000 -- (-749.684) (-751.075) (-752.087) [-748.577] * (-748.735) (-748.726) [-748.730] (-751.154) -- 0:00:56
      124500 -- [-750.064] (-750.562) (-756.550) (-749.340) * [-750.097] (-748.586) (-749.658) (-753.292) -- 0:00:56
      125000 -- (-749.336) [-750.378] (-750.013) (-751.242) * [-751.360] (-751.637) (-749.501) (-750.865) -- 0:00:56

      Average standard deviation of split frequencies: 0.017584

      125500 -- [-748.882] (-752.771) (-750.585) (-749.223) * [-749.294] (-749.638) (-751.369) (-749.809) -- 0:00:55
      126000 -- [-749.695] (-750.207) (-749.600) (-748.746) * (-753.295) (-751.464) (-751.069) [-748.760] -- 0:00:55
      126500 -- (-750.730) (-750.582) [-750.336] (-750.825) * (-750.836) (-752.324) (-749.413) [-748.359] -- 0:00:55
      127000 -- [-749.141] (-750.292) (-749.204) (-752.574) * [-751.440] (-750.117) (-747.926) (-753.692) -- 0:00:54
      127500 -- (-749.072) [-750.183] (-748.739) (-751.415) * (-749.296) (-750.842) [-747.892] (-749.097) -- 0:00:54
      128000 -- [-750.261] (-752.046) (-749.215) (-753.437) * (-748.387) [-755.536] (-755.565) (-751.857) -- 0:00:54
      128500 -- [-749.565] (-759.897) (-749.201) (-750.349) * (-749.222) [-749.757] (-751.239) (-749.202) -- 0:01:01
      129000 -- (-748.854) (-748.310) (-749.805) [-751.062] * (-748.489) [-749.438] (-750.619) (-749.801) -- 0:01:00
      129500 -- (-748.911) [-748.170] (-753.091) (-749.250) * (-749.318) [-749.771] (-751.333) (-750.841) -- 0:01:00
      130000 -- (-750.573) (-748.280) [-749.887] (-750.873) * [-750.667] (-748.797) (-750.418) (-748.923) -- 0:01:00

      Average standard deviation of split frequencies: 0.017437

      130500 -- (-752.326) (-752.034) (-750.886) [-749.363] * [-750.764] (-747.756) (-750.674) (-750.391) -- 0:00:59
      131000 -- [-748.923] (-751.020) (-749.587) (-749.638) * (-749.771) (-750.186) [-748.273] (-749.016) -- 0:00:59
      131500 -- (-749.705) (-750.330) (-751.255) [-750.934] * (-749.451) (-749.805) [-748.279] (-749.896) -- 0:00:59
      132000 -- (-755.000) (-750.656) [-749.947] (-748.977) * [-752.614] (-749.488) (-750.013) (-752.926) -- 0:00:59
      132500 -- (-752.690) [-754.021] (-753.772) (-748.391) * [-750.992] (-749.830) (-751.571) (-750.554) -- 0:00:58
      133000 -- (-756.901) [-749.879] (-750.787) (-752.000) * (-749.021) (-750.526) [-749.395] (-750.294) -- 0:00:58
      133500 -- [-749.524] (-751.029) (-751.075) (-751.237) * (-751.077) (-751.099) (-750.305) [-749.417] -- 0:00:58
      134000 -- (-750.884) [-750.424] (-749.593) (-749.199) * (-749.533) (-750.847) (-749.959) [-750.361] -- 0:00:58
      134500 -- (-750.511) (-752.235) [-751.226] (-748.130) * (-749.912) [-752.035] (-749.877) (-752.769) -- 0:00:57
      135000 -- (-749.705) [-751.109] (-750.753) (-750.917) * (-750.600) [-753.652] (-752.871) (-749.373) -- 0:00:57

      Average standard deviation of split frequencies: 0.016946

      135500 -- [-751.606] (-750.679) (-751.450) (-751.211) * (-750.081) [-749.558] (-754.272) (-748.750) -- 0:00:57
      136000 -- [-750.910] (-750.271) (-751.826) (-750.802) * (-749.922) (-751.438) (-750.244) [-749.513] -- 0:00:57
      136500 -- (-754.088) (-753.035) (-749.542) [-749.748] * (-748.454) (-749.848) [-752.750] (-750.927) -- 0:00:56
      137000 -- (-751.579) [-749.882] (-749.210) (-749.680) * (-748.706) (-748.725) (-754.982) [-751.671] -- 0:00:56
      137500 -- [-749.727] (-751.391) (-749.189) (-750.625) * (-748.966) (-749.345) [-753.811] (-757.862) -- 0:00:56
      138000 -- (-750.082) (-751.942) (-749.295) [-749.129] * (-748.555) (-750.045) (-755.765) [-750.645] -- 0:00:56
      138500 -- (-750.808) (-751.661) (-750.501) [-752.048] * (-750.168) (-749.776) (-750.253) [-751.049] -- 0:00:55
      139000 -- (-751.514) (-751.669) [-750.314] (-750.451) * (-751.502) (-749.203) [-748.569] (-752.671) -- 0:00:55
      139500 -- (-752.096) (-752.332) (-752.824) [-752.932] * (-758.055) (-750.426) (-749.216) [-753.117] -- 0:00:55
      140000 -- (-753.665) (-748.741) [-750.287] (-749.244) * (-750.726) [-749.257] (-755.613) (-748.549) -- 0:00:55

      Average standard deviation of split frequencies: 0.016011

      140500 -- (-753.508) (-749.951) (-749.978) [-750.601] * (-750.269) (-749.752) (-757.898) [-750.090] -- 0:00:55
      141000 -- (-750.776) [-749.108] (-751.609) (-749.865) * (-749.413) (-750.746) (-756.457) [-750.606] -- 0:00:54
      141500 -- (-751.544) (-749.492) (-749.717) [-750.290] * (-752.613) (-748.023) [-749.938] (-751.652) -- 0:00:54
      142000 -- (-750.075) (-750.505) [-749.711] (-750.863) * (-753.029) [-748.821] (-749.882) (-750.395) -- 0:00:54
      142500 -- (-753.572) [-751.044] (-752.642) (-751.676) * (-750.158) [-755.114] (-749.580) (-750.010) -- 0:00:54
      143000 -- (-750.749) [-748.708] (-749.559) (-749.930) * [-751.058] (-749.798) (-749.889) (-751.466) -- 0:00:53
      143500 -- (-752.913) [-750.881] (-749.501) (-750.131) * (-752.793) (-752.053) [-749.321] (-748.978) -- 0:00:53
      144000 -- (-749.318) (-751.496) (-752.952) [-751.576] * (-750.850) (-750.710) (-752.770) [-752.095] -- 0:00:53
      144500 -- (-749.489) (-752.878) [-752.299] (-750.171) * (-750.912) (-751.779) [-751.017] (-749.365) -- 0:00:53
      145000 -- (-751.871) (-753.584) (-752.783) [-750.481] * (-751.465) [-750.908] (-750.060) (-750.107) -- 0:00:58

      Average standard deviation of split frequencies: 0.016951

      145500 -- (-749.917) (-752.083) [-752.893] (-749.934) * [-750.005] (-749.185) (-751.836) (-749.154) -- 0:00:58
      146000 -- (-749.746) (-751.686) (-749.260) [-749.345] * (-754.031) (-749.311) [-752.480] (-749.567) -- 0:00:58
      146500 -- (-750.910) [-754.742] (-750.426) (-750.148) * (-753.009) [-748.002] (-748.804) (-749.646) -- 0:00:58
      147000 -- (-750.030) [-753.856] (-749.886) (-748.737) * [-752.166] (-754.531) (-756.627) (-749.489) -- 0:00:58
      147500 -- (-749.696) (-751.908) [-748.995] (-756.278) * (-750.161) [-754.444] (-748.687) (-752.779) -- 0:00:57
      148000 -- (-749.657) (-748.901) [-749.106] (-749.547) * (-749.603) [-750.535] (-750.200) (-752.641) -- 0:00:57
      148500 -- (-751.824) [-749.811] (-751.977) (-756.065) * (-749.428) [-750.396] (-750.084) (-752.655) -- 0:00:57
      149000 -- (-750.036) [-749.358] (-750.298) (-752.313) * (-749.686) [-754.561] (-748.768) (-755.247) -- 0:00:57
      149500 -- (-753.581) [-749.258] (-750.442) (-750.796) * (-751.460) (-748.549) (-750.739) [-751.723] -- 0:00:56
      150000 -- (-749.640) (-748.281) (-751.404) [-749.661] * [-748.643] (-749.187) (-750.936) (-751.326) -- 0:00:56

      Average standard deviation of split frequencies: 0.016961

      150500 -- (-750.454) (-749.385) (-748.886) [-749.912] * (-748.468) (-752.650) (-755.590) [-749.158] -- 0:00:56
      151000 -- [-750.668] (-749.705) (-749.850) (-750.684) * [-748.109] (-752.658) (-754.791) (-751.493) -- 0:00:56
      151500 -- (-749.898) (-749.714) [-751.236] (-750.467) * [-748.947] (-751.196) (-751.089) (-749.477) -- 0:00:56
      152000 -- (-749.194) (-751.013) [-750.300] (-748.840) * (-748.981) (-752.543) (-751.720) [-750.545] -- 0:00:55
      152500 -- (-751.132) (-752.131) (-750.412) [-749.212] * (-749.023) (-749.137) (-750.846) [-749.745] -- 0:00:55
      153000 -- (-751.516) (-751.985) (-750.835) [-749.589] * (-750.629) (-750.561) (-749.027) [-749.210] -- 0:00:55
      153500 -- (-753.244) (-750.678) (-749.025) [-750.172] * [-748.314] (-749.331) (-750.762) (-750.158) -- 0:00:55
      154000 -- (-750.759) (-749.269) (-755.094) [-750.632] * [-748.036] (-749.235) (-748.696) (-750.981) -- 0:00:54
      154500 -- (-751.657) [-748.318] (-752.909) (-750.299) * [-748.243] (-753.295) (-750.178) (-752.457) -- 0:00:54
      155000 -- [-751.106] (-748.739) (-754.984) (-749.107) * [-749.553] (-751.931) (-749.200) (-751.683) -- 0:00:54

      Average standard deviation of split frequencies: 0.016620

      155500 -- (-748.201) [-748.923] (-747.922) (-748.168) * (-749.021) [-752.838] (-752.201) (-749.200) -- 0:00:54
      156000 -- (-750.108) (-750.096) [-749.033] (-748.032) * (-751.264) (-751.480) [-749.904] (-747.980) -- 0:00:54
      156500 -- [-749.648] (-752.921) (-749.769) (-748.146) * (-750.543) (-751.939) [-751.551] (-747.867) -- 0:00:53
      157000 -- [-750.119] (-748.613) (-748.701) (-749.633) * (-748.518) (-751.751) [-751.261] (-748.277) -- 0:00:53
      157500 -- (-753.130) [-748.968] (-750.448) (-754.943) * (-749.726) (-752.153) [-749.446] (-752.844) -- 0:00:53
      158000 -- (-756.649) (-748.721) [-749.120] (-748.686) * [-754.577] (-751.475) (-751.532) (-749.168) -- 0:00:53
      158500 -- (-749.858) [-750.667] (-751.765) (-748.830) * (-754.014) [-750.380] (-751.312) (-752.337) -- 0:00:53
      159000 -- (-750.611) [-753.208] (-749.661) (-748.997) * (-750.831) (-748.884) (-753.862) [-749.675] -- 0:00:52
      159500 -- (-750.493) (-750.068) (-751.107) [-748.914] * (-749.537) (-748.986) (-751.613) [-748.818] -- 0:00:52
      160000 -- (-748.783) (-748.956) [-750.091] (-749.037) * (-751.251) [-750.500] (-752.001) (-749.301) -- 0:00:52

      Average standard deviation of split frequencies: 0.015257

      160500 -- (-751.093) [-749.821] (-752.864) (-753.364) * (-753.103) (-753.176) (-750.803) [-748.553] -- 0:00:52
      161000 -- [-752.238] (-750.210) (-751.088) (-751.733) * (-753.477) [-751.620] (-748.068) (-749.097) -- 0:00:52
      161500 -- (-755.490) [-748.790] (-752.721) (-750.540) * (-749.954) [-748.606] (-748.033) (-748.317) -- 0:00:51
      162000 -- (-749.347) (-748.483) [-753.402] (-748.615) * (-748.377) [-749.758] (-747.734) (-748.837) -- 0:00:56
      162500 -- (-751.250) [-754.045] (-750.204) (-748.900) * (-749.330) (-751.993) (-749.252) [-748.350] -- 0:00:56
      163000 -- (-750.124) [-755.444] (-752.274) (-750.955) * (-750.826) (-749.141) [-750.510] (-748.036) -- 0:00:56
      163500 -- (-748.229) [-751.978] (-754.523) (-749.448) * (-753.222) (-749.396) (-750.530) [-750.882] -- 0:00:56
      164000 -- (-748.455) [-751.322] (-749.580) (-749.429) * [-751.125] (-753.839) (-749.562) (-755.234) -- 0:00:56
      164500 -- (-749.010) (-748.961) (-749.524) [-752.523] * (-749.056) [-750.153] (-749.819) (-753.780) -- 0:00:55
      165000 -- (-751.438) [-749.057] (-751.837) (-749.985) * (-750.055) [-750.719] (-750.637) (-751.687) -- 0:00:55

      Average standard deviation of split frequencies: 0.014348

      165500 -- [-754.227] (-749.088) (-752.362) (-749.174) * [-749.506] (-751.618) (-748.718) (-750.856) -- 0:00:55
      166000 -- [-751.160] (-749.292) (-750.561) (-748.356) * [-748.443] (-752.205) (-748.985) (-751.373) -- 0:00:55
      166500 -- (-751.630) (-749.999) (-750.171) [-748.839] * (-750.500) (-748.899) (-751.209) [-750.352] -- 0:00:55
      167000 -- (-753.253) (-749.422) [-749.847] (-751.160) * (-752.346) (-750.392) (-750.211) [-750.014] -- 0:00:54
      167500 -- (-752.790) [-750.586] (-752.443) (-751.079) * (-752.962) (-755.384) (-752.469) [-748.603] -- 0:00:54
      168000 -- (-751.244) (-751.011) [-751.405] (-751.561) * (-749.315) (-751.839) (-752.858) [-751.808] -- 0:00:54
      168500 -- (-753.948) (-752.175) (-753.977) [-749.489] * (-751.811) (-748.634) (-751.236) [-753.476] -- 0:00:54
      169000 -- (-751.017) (-749.329) (-749.050) [-750.943] * (-752.328) (-749.791) [-751.272] (-750.692) -- 0:00:54
      169500 -- (-752.407) [-748.719] (-750.421) (-749.208) * (-751.716) (-748.373) (-749.105) [-751.426] -- 0:00:53
      170000 -- (-756.621) (-750.640) [-752.703] (-752.172) * (-751.658) (-748.058) [-750.192] (-752.013) -- 0:00:53

      Average standard deviation of split frequencies: 0.014600

      170500 -- [-752.486] (-750.104) (-753.728) (-750.120) * (-750.273) (-750.534) (-750.217) [-749.271] -- 0:00:53
      171000 -- (-753.053) (-749.882) [-753.744] (-751.653) * (-752.185) [-749.400] (-751.265) (-753.269) -- 0:00:53
      171500 -- [-750.896] (-750.332) (-753.754) (-756.311) * (-754.027) [-750.520] (-751.342) (-750.767) -- 0:00:53
      172000 -- (-749.240) (-750.431) [-750.233] (-751.812) * [-750.149] (-750.919) (-749.897) (-750.241) -- 0:00:52
      172500 -- [-750.709] (-749.715) (-750.370) (-748.585) * (-748.727) (-750.798) [-749.897] (-753.572) -- 0:00:52
      173000 -- (-749.506) (-752.048) (-752.374) [-748.638] * (-749.227) (-750.471) [-751.161] (-753.395) -- 0:00:52
      173500 -- (-750.864) (-751.559) [-749.829] (-750.714) * (-750.333) (-751.156) (-752.282) [-750.807] -- 0:00:52
      174000 -- (-750.475) (-750.133) [-749.010] (-749.366) * (-749.031) [-750.233] (-748.451) (-748.545) -- 0:00:52
      174500 -- [-752.977] (-748.563) (-750.702) (-749.281) * (-749.070) (-749.998) (-750.149) [-748.739] -- 0:00:52
      175000 -- (-751.356) (-749.251) (-751.922) [-750.656] * (-750.006) [-749.217] (-751.607) (-752.883) -- 0:00:51

      Average standard deviation of split frequencies: 0.012546

      175500 -- (-750.122) [-748.855] (-750.623) (-750.386) * (-749.463) [-751.611] (-755.579) (-750.896) -- 0:00:51
      176000 -- (-752.890) (-750.739) [-751.384] (-748.913) * [-749.060] (-751.888) (-752.736) (-750.053) -- 0:00:51
      176500 -- (-750.640) (-750.721) (-749.094) [-749.749] * (-748.524) (-750.808) (-754.226) [-748.626] -- 0:00:51
      177000 -- (-749.312) [-750.357] (-749.314) (-751.818) * (-748.680) (-749.815) (-750.060) [-749.386] -- 0:00:51
      177500 -- [-750.107] (-757.129) (-748.362) (-751.871) * (-748.521) [-748.084] (-754.529) (-749.381) -- 0:00:55
      178000 -- (-750.517) (-751.988) (-748.694) [-750.012] * (-748.274) (-749.064) (-754.118) [-750.763] -- 0:00:55
      178500 -- (-748.887) [-750.270] (-750.381) (-750.327) * [-750.583] (-749.206) (-751.025) (-751.194) -- 0:00:55
      179000 -- (-749.383) (-752.898) [-749.127] (-749.938) * (-755.164) (-749.455) [-749.654] (-750.268) -- 0:00:55
      179500 -- (-752.961) [-752.538] (-750.381) (-752.227) * [-750.408] (-750.045) (-749.647) (-749.679) -- 0:00:54
      180000 -- [-749.283] (-748.656) (-751.627) (-749.572) * [-755.164] (-750.307) (-750.336) (-749.847) -- 0:00:54

      Average standard deviation of split frequencies: 0.013626

      180500 -- [-752.658] (-748.949) (-753.342) (-751.164) * (-750.914) (-749.031) (-752.892) [-751.798] -- 0:00:54
      181000 -- [-748.896] (-749.661) (-749.071) (-751.114) * (-749.539) (-749.622) (-752.947) [-749.115] -- 0:00:54
      181500 -- (-753.782) (-749.337) [-751.755] (-751.957) * [-748.973] (-751.908) (-751.202) (-749.683) -- 0:00:54
      182000 -- (-748.053) (-749.284) [-747.938] (-753.014) * [-749.176] (-749.871) (-751.312) (-749.186) -- 0:00:53
      182500 -- (-748.369) (-752.984) (-748.411) [-749.987] * (-748.490) (-753.631) (-751.715) [-748.359] -- 0:00:53
      183000 -- [-749.904] (-748.663) (-749.724) (-749.969) * (-749.222) (-754.003) (-748.470) [-752.676] -- 0:00:53
      183500 -- [-752.195] (-749.850) (-752.507) (-749.947) * (-750.357) [-749.224] (-748.443) (-751.561) -- 0:00:53
      184000 -- (-761.234) [-750.687] (-751.604) (-750.584) * (-749.270) [-752.181] (-749.425) (-749.109) -- 0:00:53
      184500 -- (-752.513) [-751.383] (-749.785) (-752.133) * (-748.132) (-753.303) (-750.233) [-749.120] -- 0:00:53
      185000 -- (-749.004) (-751.461) (-750.067) [-749.900] * [-749.087] (-751.064) (-751.971) (-748.811) -- 0:00:52

      Average standard deviation of split frequencies: 0.016548

      185500 -- (-749.967) [-748.957] (-748.729) (-750.832) * (-748.317) (-752.732) (-750.889) [-749.145] -- 0:00:52
      186000 -- (-750.106) (-749.045) [-748.747] (-750.385) * (-749.242) [-749.278] (-750.601) (-749.711) -- 0:00:52
      186500 -- (-750.748) (-749.371) [-749.446] (-752.139) * (-749.864) (-749.378) (-755.314) [-750.290] -- 0:00:52
      187000 -- [-750.912] (-748.700) (-754.148) (-751.059) * [-750.140] (-753.951) (-751.533) (-749.240) -- 0:00:52
      187500 -- (-750.004) [-748.716] (-751.729) (-754.597) * (-750.561) [-752.247] (-756.147) (-751.360) -- 0:00:52
      188000 -- [-749.597] (-750.159) (-750.853) (-753.666) * (-752.685) (-751.450) (-752.357) [-751.416] -- 0:00:51
      188500 -- (-752.036) (-749.504) [-748.572] (-750.948) * [-749.887] (-755.311) (-751.134) (-748.786) -- 0:00:51
      189000 -- (-749.151) (-749.928) (-751.553) [-748.870] * (-749.166) [-752.321] (-749.942) (-749.712) -- 0:00:51
      189500 -- [-749.372] (-750.704) (-751.394) (-754.759) * (-748.885) (-751.906) (-749.991) [-749.449] -- 0:00:51
      190000 -- (-749.263) (-749.850) [-747.944] (-752.147) * (-750.090) (-748.939) [-749.304] (-750.308) -- 0:00:51

      Average standard deviation of split frequencies: 0.015109

      190500 -- (-748.863) (-748.569) (-749.395) [-749.711] * (-749.657) (-747.840) (-747.948) [-750.053] -- 0:00:50
      191000 -- (-749.617) (-751.394) [-749.863] (-750.666) * (-749.553) [-748.246] (-749.716) (-751.032) -- 0:00:55
      191500 -- [-751.300] (-749.975) (-748.931) (-748.550) * (-749.734) (-749.216) (-750.093) [-754.241] -- 0:00:54
      192000 -- (-752.082) (-752.291) [-751.119] (-750.303) * (-749.641) [-749.743] (-750.739) (-750.129) -- 0:00:54
      192500 -- [-750.068] (-749.370) (-751.005) (-748.832) * [-753.957] (-751.658) (-754.282) (-749.333) -- 0:00:54
      193000 -- (-748.486) [-749.954] (-748.554) (-749.540) * (-749.763) (-750.580) (-749.819) [-750.128] -- 0:00:54
      193500 -- (-748.725) (-749.974) [-749.749] (-749.413) * (-749.920) (-749.217) [-750.642] (-750.254) -- 0:00:54
      194000 -- (-748.457) [-749.252] (-749.375) (-751.369) * (-749.481) [-748.340] (-749.082) (-754.277) -- 0:00:54
      194500 -- (-749.142) [-749.828] (-750.193) (-751.718) * [-750.699] (-748.352) (-749.625) (-751.036) -- 0:00:53
      195000 -- [-752.985] (-751.863) (-749.206) (-748.060) * (-751.151) [-748.525] (-749.307) (-748.971) -- 0:00:53

      Average standard deviation of split frequencies: 0.017437

      195500 -- [-752.400] (-755.125) (-751.264) (-748.715) * (-753.814) (-749.055) [-750.950] (-753.086) -- 0:00:53
      196000 -- (-751.863) (-753.075) (-754.254) [-748.956] * (-753.289) [-749.479] (-753.752) (-748.353) -- 0:00:53
      196500 -- (-749.944) (-749.621) [-749.753] (-750.505) * (-755.505) [-750.335] (-750.917) (-749.563) -- 0:00:53
      197000 -- (-749.461) (-748.575) [-749.292] (-752.253) * (-753.425) (-749.485) (-749.631) [-748.804] -- 0:00:52
      197500 -- [-753.268] (-749.353) (-748.432) (-749.967) * (-748.930) [-749.688] (-753.996) (-749.559) -- 0:00:52
      198000 -- (-752.286) [-748.984] (-752.785) (-751.537) * [-749.629] (-749.087) (-748.246) (-749.303) -- 0:00:52
      198500 -- (-750.685) (-749.458) (-749.183) [-753.413] * [-750.378] (-751.956) (-750.501) (-750.961) -- 0:00:52
      199000 -- [-750.250] (-754.100) (-750.991) (-753.435) * (-757.534) [-751.530] (-749.423) (-748.359) -- 0:00:52
      199500 -- (-749.609) (-755.488) (-750.541) [-754.568] * [-752.055] (-750.340) (-749.402) (-752.352) -- 0:00:52
      200000 -- [-751.702] (-755.490) (-752.697) (-750.531) * (-750.048) [-752.448] (-751.061) (-750.676) -- 0:00:51

      Average standard deviation of split frequencies: 0.016601

      200500 -- (-752.615) (-752.667) [-750.138] (-750.536) * (-749.170) [-750.370] (-750.393) (-754.855) -- 0:00:51
      201000 -- (-750.227) [-749.372] (-748.529) (-749.677) * (-754.322) (-754.050) (-750.955) [-750.091] -- 0:00:51
      201500 -- [-749.288] (-753.391) (-748.416) (-749.322) * (-750.796) [-748.500] (-751.604) (-750.822) -- 0:00:51
      202000 -- (-748.870) (-750.460) (-752.925) [-752.427] * (-756.404) [-748.174] (-750.545) (-758.837) -- 0:00:51
      202500 -- (-748.491) [-751.505] (-749.748) (-752.472) * (-751.108) (-752.773) [-749.421] (-751.081) -- 0:00:51
      203000 -- (-748.719) [-750.905] (-748.799) (-755.718) * (-750.202) (-750.209) [-750.095] (-748.881) -- 0:00:51
      203500 -- (-750.081) (-751.850) (-759.706) [-753.952] * (-750.158) (-750.531) [-749.256] (-748.598) -- 0:00:50
      204000 -- (-751.484) (-749.298) [-753.341] (-750.891) * (-755.255) (-750.507) (-756.580) [-750.154] -- 0:00:50
      204500 -- (-753.414) (-753.558) [-752.505] (-752.524) * (-756.102) [-750.515] (-753.831) (-749.524) -- 0:00:50
      205000 -- (-751.335) (-750.738) (-749.553) [-750.887] * (-749.837) (-748.376) (-749.526) [-748.977] -- 0:00:54

      Average standard deviation of split frequencies: 0.014588

      205500 -- (-750.621) (-748.957) (-748.866) [-754.878] * [-751.369] (-753.866) (-754.723) (-751.723) -- 0:00:54
      206000 -- (-749.582) (-749.387) (-750.032) [-750.962] * (-748.080) (-752.060) (-751.206) [-751.426] -- 0:00:53
      206500 -- [-748.490] (-749.503) (-751.084) (-748.346) * (-749.137) (-750.372) [-752.099] (-749.587) -- 0:00:53
      207000 -- (-750.536) (-748.882) [-754.760] (-748.775) * (-751.122) (-749.153) [-750.612] (-748.629) -- 0:00:53
      207500 -- (-749.488) (-750.511) [-749.916] (-751.257) * (-753.107) (-750.316) [-751.647] (-749.571) -- 0:00:53
      208000 -- (-749.109) (-753.238) (-748.833) [-750.211] * (-751.425) [-754.210] (-748.529) (-752.818) -- 0:00:53
      208500 -- (-750.937) (-750.566) (-749.186) [-749.773] * (-749.031) (-754.513) (-749.802) [-750.222] -- 0:00:53
      209000 -- (-751.276) (-750.946) (-750.618) [-750.965] * (-750.136) (-751.220) [-750.611] (-751.452) -- 0:00:52
      209500 -- (-750.739) (-750.149) [-751.110] (-752.009) * (-748.675) (-756.144) [-752.371] (-751.861) -- 0:00:52
      210000 -- (-749.731) (-753.030) (-751.885) [-749.710] * (-750.564) (-752.798) (-749.223) [-749.101] -- 0:00:52

      Average standard deviation of split frequencies: 0.014545

      210500 -- (-750.591) (-749.216) (-749.877) [-753.746] * (-752.493) (-752.588) (-748.614) [-749.218] -- 0:00:52
      211000 -- [-750.072] (-748.180) (-750.076) (-749.389) * (-759.459) (-751.993) [-750.317] (-750.629) -- 0:00:52
      211500 -- (-751.892) (-748.862) [-748.756] (-751.109) * (-751.369) [-748.373] (-748.939) (-749.602) -- 0:00:52
      212000 -- (-752.476) (-751.993) (-750.967) [-753.200] * [-750.284] (-751.802) (-748.788) (-750.354) -- 0:00:52
      212500 -- (-751.575) (-752.846) (-748.832) [-752.085] * (-750.314) (-752.505) (-749.613) [-752.623] -- 0:00:51
      213000 -- (-751.392) [-748.450] (-748.205) (-750.363) * [-748.654] (-753.245) (-749.784) (-748.488) -- 0:00:51
      213500 -- [-750.738] (-748.472) (-749.326) (-753.338) * (-749.296) (-752.864) [-750.387] (-751.791) -- 0:00:51
      214000 -- (-752.136) (-749.105) [-749.631] (-751.292) * (-749.391) (-752.471) [-753.898] (-748.408) -- 0:00:51
      214500 -- (-752.687) (-749.076) [-748.653] (-748.891) * (-750.771) (-748.593) [-752.632] (-749.405) -- 0:00:51
      215000 -- (-748.996) (-749.958) [-748.390] (-754.692) * (-749.803) [-749.107] (-748.623) (-748.717) -- 0:00:51

      Average standard deviation of split frequencies: 0.011731

      215500 -- (-752.227) (-749.276) [-749.595] (-754.057) * (-748.481) [-749.596] (-748.963) (-753.202) -- 0:00:50
      216000 -- [-748.292] (-753.643) (-753.338) (-754.313) * (-748.865) [-750.118] (-751.864) (-755.149) -- 0:00:50
      216500 -- [-748.924] (-752.715) (-754.830) (-749.970) * [-751.267] (-753.774) (-751.081) (-750.827) -- 0:00:50
      217000 -- (-748.726) (-752.474) [-751.481] (-750.779) * [-749.280] (-752.980) (-748.123) (-752.339) -- 0:00:50
      217500 -- (-749.787) [-749.046] (-749.513) (-751.082) * (-750.579) [-752.523] (-749.221) (-752.216) -- 0:00:53
      218000 -- (-750.635) (-750.201) [-750.749] (-750.293) * (-750.305) [-752.018] (-750.747) (-751.386) -- 0:00:53
      218500 -- (-750.244) (-750.567) (-751.503) [-748.384] * (-750.109) (-749.257) (-751.823) [-753.850] -- 0:00:53
      219000 -- [-749.105] (-752.447) (-749.810) (-749.765) * (-751.271) (-750.469) (-750.074) [-756.343] -- 0:00:53
      219500 -- (-748.928) (-751.416) (-749.487) [-749.839] * (-752.178) [-749.663] (-749.452) (-750.244) -- 0:00:53
      220000 -- (-753.944) [-750.244] (-748.636) (-749.871) * [-751.394] (-748.943) (-748.624) (-747.956) -- 0:00:53

      Average standard deviation of split frequencies: 0.011109

      220500 -- (-751.273) [-751.685] (-748.701) (-748.424) * (-748.076) [-748.496] (-748.904) (-748.849) -- 0:00:53
      221000 -- (-749.826) (-749.878) [-752.383] (-751.253) * (-750.952) (-752.032) [-750.944] (-750.516) -- 0:00:52
      221500 -- (-754.139) (-751.598) [-749.269] (-751.571) * (-753.333) (-751.194) [-751.405] (-749.588) -- 0:00:52
      222000 -- (-753.009) [-748.615] (-748.902) (-749.025) * (-749.988) [-750.252] (-754.821) (-749.778) -- 0:00:52
      222500 -- (-752.585) (-747.928) [-748.691] (-748.848) * (-755.825) [-752.218] (-753.322) (-749.579) -- 0:00:52
      223000 -- (-750.264) (-747.985) [-751.730] (-752.415) * [-751.565] (-751.804) (-754.156) (-748.227) -- 0:00:52
      223500 -- [-750.944] (-751.852) (-752.331) (-752.322) * (-749.731) (-749.128) [-748.830] (-748.448) -- 0:00:52
      224000 -- (-748.789) (-749.853) (-752.102) [-747.981] * (-750.541) (-749.909) (-751.914) [-749.972] -- 0:00:51
      224500 -- (-750.924) (-749.004) [-749.543] (-750.254) * (-750.175) (-749.197) (-749.407) [-749.176] -- 0:00:51
      225000 -- (-751.863) (-748.702) [-749.797] (-751.722) * (-750.776) (-748.845) (-751.668) [-748.052] -- 0:00:51

      Average standard deviation of split frequencies: 0.011656

      225500 -- (-753.005) [-749.843] (-749.908) (-750.028) * [-749.938] (-750.864) (-751.203) (-749.165) -- 0:00:51
      226000 -- (-748.772) [-752.900] (-750.918) (-752.417) * (-749.335) (-750.777) [-750.577] (-751.313) -- 0:00:51
      226500 -- (-749.278) (-751.397) (-752.228) [-750.493] * (-749.843) (-750.147) [-749.810] (-750.513) -- 0:00:51
      227000 -- (-753.219) (-750.048) (-749.995) [-752.006] * [-749.945] (-752.853) (-749.343) (-748.911) -- 0:00:51
      227500 -- [-749.833] (-752.123) (-749.611) (-749.789) * (-750.344) (-750.235) (-748.299) [-748.533] -- 0:00:50
      228000 -- (-752.939) (-750.912) (-751.243) [-751.075] * (-752.118) [-750.579] (-750.836) (-751.044) -- 0:00:50
      228500 -- (-749.449) (-749.637) [-749.625] (-754.450) * (-749.628) (-749.445) [-750.678] (-750.256) -- 0:00:50
      229000 -- (-750.517) [-752.683] (-749.344) (-752.003) * (-751.686) [-750.492] (-751.808) (-750.101) -- 0:00:50
      229500 -- (-756.255) (-760.028) [-750.867] (-752.736) * (-752.196) [-748.089] (-749.722) (-749.978) -- 0:00:50
      230000 -- (-750.929) (-753.145) [-753.275] (-749.497) * (-750.182) (-748.194) [-748.106] (-753.066) -- 0:00:50

      Average standard deviation of split frequencies: 0.012035

      230500 -- [-748.447] (-749.830) (-749.924) (-748.487) * [-750.793] (-749.748) (-750.030) (-751.962) -- 0:00:50
      231000 -- (-748.501) (-750.114) (-748.107) [-750.414] * (-750.484) [-750.550] (-749.191) (-750.547) -- 0:00:53
      231500 -- (-748.749) (-752.832) (-749.879) [-748.638] * (-749.507) (-750.505) (-748.810) [-749.747] -- 0:00:53
      232000 -- [-753.275] (-749.888) (-749.843) (-750.180) * (-752.717) (-749.968) (-749.169) [-750.351] -- 0:00:52
      232500 -- (-755.339) [-749.397] (-752.384) (-750.496) * (-753.304) (-753.946) (-749.496) [-749.916] -- 0:00:52
      233000 -- (-752.493) (-750.805) [-751.099] (-749.897) * (-750.458) (-752.633) [-750.581] (-750.339) -- 0:00:52
      233500 -- (-749.512) (-751.340) (-752.128) [-749.884] * (-751.446) (-755.957) (-750.359) [-751.093] -- 0:00:52
      234000 -- (-748.901) (-751.498) (-750.615) [-749.200] * (-751.423) [-748.706] (-750.319) (-750.386) -- 0:00:52
      234500 -- (-749.881) [-748.365] (-748.351) (-749.252) * [-749.016] (-750.469) (-750.476) (-749.067) -- 0:00:52
      235000 -- (-750.861) [-751.769] (-750.231) (-749.782) * (-752.758) (-749.573) [-750.997] (-749.052) -- 0:00:52

      Average standard deviation of split frequencies: 0.012984

      235500 -- (-749.061) (-749.256) (-749.496) [-753.355] * (-749.384) (-754.098) [-749.727] (-748.929) -- 0:00:51
      236000 -- [-751.870] (-749.166) (-750.947) (-754.571) * [-749.299] (-750.294) (-749.180) (-750.613) -- 0:00:51
      236500 -- (-749.532) (-748.261) (-748.759) [-749.619] * (-750.299) (-749.520) (-749.221) [-748.521] -- 0:00:51
      237000 -- (-752.613) (-750.135) (-749.012) [-750.979] * (-749.917) (-748.180) [-749.906] (-754.780) -- 0:00:51
      237500 -- [-750.377] (-749.710) (-751.438) (-750.302) * (-749.226) (-752.789) (-757.150) [-750.533] -- 0:00:51
      238000 -- (-751.216) (-751.234) (-750.223) [-748.120] * (-749.399) (-751.044) [-750.714] (-749.840) -- 0:00:51
      238500 -- (-754.085) [-752.530] (-752.822) (-748.135) * (-749.986) (-755.275) [-748.566] (-753.163) -- 0:00:51
      239000 -- (-748.583) (-751.324) [-752.718] (-749.699) * (-748.637) (-752.842) (-751.950) [-748.198] -- 0:00:50
      239500 -- (-757.641) (-751.375) (-750.448) [-749.241] * [-749.571] (-752.405) (-752.284) (-748.199) -- 0:00:50
      240000 -- (-754.107) [-750.776] (-749.729) (-752.007) * (-752.245) (-751.263) [-752.452] (-750.515) -- 0:00:50

      Average standard deviation of split frequencies: 0.013366

      240500 -- (-750.037) (-750.560) [-750.660] (-750.335) * (-749.404) [-754.278] (-751.639) (-749.068) -- 0:00:50
      241000 -- [-749.564] (-752.295) (-750.527) (-750.310) * (-749.679) [-749.372] (-751.228) (-750.480) -- 0:00:50
      241500 -- (-751.224) (-749.979) [-751.365] (-760.600) * (-749.479) [-750.345] (-753.256) (-752.660) -- 0:00:50
      242000 -- (-752.239) (-749.015) (-749.397) [-749.921] * (-747.852) [-749.259] (-749.181) (-749.788) -- 0:00:50
      242500 -- (-751.405) (-749.019) [-749.450] (-754.053) * (-747.822) (-748.873) [-749.273] (-754.072) -- 0:00:49
      243000 -- (-749.878) (-747.905) [-749.866] (-752.941) * [-748.689] (-749.317) (-748.165) (-749.921) -- 0:00:49
      243500 -- (-749.142) (-748.001) (-750.887) [-750.507] * (-750.388) [-750.723] (-752.431) (-748.481) -- 0:00:49
      244000 -- (-748.063) (-748.705) (-748.871) [-750.452] * [-748.639] (-750.501) (-749.814) (-748.750) -- 0:00:49
      244500 -- [-748.681] (-749.298) (-750.174) (-754.411) * (-752.683) [-750.190] (-748.229) (-752.711) -- 0:00:52
      245000 -- [-749.137] (-750.587) (-748.856) (-755.777) * (-749.478) [-751.051] (-748.462) (-752.632) -- 0:00:52

      Average standard deviation of split frequencies: 0.013189

      245500 -- (-751.507) [-749.003] (-748.296) (-750.390) * (-748.910) (-752.681) [-751.384] (-753.443) -- 0:00:52
      246000 -- (-753.996) (-750.861) [-751.895] (-748.807) * (-751.136) [-751.830] (-751.103) (-748.468) -- 0:00:52
      246500 -- (-750.390) (-751.834) [-749.868] (-750.252) * [-748.762] (-748.517) (-751.488) (-751.432) -- 0:00:51
      247000 -- [-750.361] (-748.810) (-749.480) (-750.439) * (-749.701) [-748.300] (-749.670) (-749.327) -- 0:00:51
      247500 -- (-749.074) (-748.721) (-749.580) [-749.428] * (-752.427) [-748.380] (-749.650) (-747.859) -- 0:00:51
      248000 -- (-748.454) [-749.680] (-750.254) (-749.750) * [-748.956] (-749.783) (-749.494) (-750.310) -- 0:00:51
      248500 -- [-751.167] (-751.233) (-750.370) (-749.930) * (-749.744) (-749.785) [-748.361] (-751.272) -- 0:00:51
      249000 -- [-749.581] (-752.291) (-749.905) (-749.075) * (-749.859) (-749.903) (-748.439) [-749.118] -- 0:00:51
      249500 -- (-749.162) (-752.198) (-749.578) [-749.539] * (-748.183) [-752.526] (-750.230) (-750.526) -- 0:00:51
      250000 -- (-749.281) (-749.972) [-749.285] (-751.626) * (-750.137) (-752.036) [-747.983] (-754.361) -- 0:00:51

      Average standard deviation of split frequencies: 0.011505

      250500 -- (-750.707) [-749.319] (-749.598) (-750.698) * (-748.831) (-755.192) [-748.030] (-753.064) -- 0:00:50
      251000 -- (-749.798) (-749.209) [-748.861] (-753.807) * [-749.595] (-751.553) (-750.811) (-753.559) -- 0:00:50
      251500 -- (-749.891) (-748.142) (-751.172) [-751.275] * (-749.148) [-750.681] (-752.063) (-751.632) -- 0:00:50
      252000 -- [-748.309] (-749.059) (-754.611) (-748.988) * [-749.213] (-750.850) (-748.872) (-750.145) -- 0:00:50
      252500 -- (-752.394) (-749.118) (-750.628) [-750.060] * (-751.388) (-750.366) (-758.936) [-752.364] -- 0:00:50
      253000 -- (-756.313) [-747.966] (-749.225) (-748.380) * (-756.136) (-750.369) (-751.023) [-749.149] -- 0:00:50
      253500 -- (-749.559) (-750.276) (-748.472) [-749.257] * (-748.486) [-750.746] (-752.678) (-750.250) -- 0:00:50
      254000 -- (-750.738) [-752.063] (-753.239) (-748.097) * (-750.135) [-749.273] (-749.391) (-752.863) -- 0:00:49
      254500 -- (-749.869) (-750.568) (-750.153) [-748.409] * [-749.782] (-748.182) (-751.508) (-752.689) -- 0:00:49
      255000 -- (-752.126) (-752.932) [-750.252] (-748.046) * (-751.391) [-749.024] (-750.285) (-749.427) -- 0:00:49

      Average standard deviation of split frequencies: 0.011854

      255500 -- (-754.278) [-750.852] (-748.917) (-751.862) * (-750.429) (-749.872) [-749.630] (-749.620) -- 0:00:49
      256000 -- (-753.409) [-749.995] (-753.904) (-748.014) * (-748.915) (-749.825) (-754.294) [-749.446] -- 0:00:49
      256500 -- (-755.738) [-751.251] (-750.881) (-748.946) * (-751.082) [-748.780] (-752.513) (-748.369) -- 0:00:49
      257000 -- (-755.298) (-749.897) (-749.984) [-748.992] * (-749.417) (-752.707) [-749.470] (-748.925) -- 0:00:49
      257500 -- [-749.618] (-749.121) (-748.777) (-751.074) * [-749.467] (-749.381) (-750.566) (-754.409) -- 0:00:51
      258000 -- (-750.718) (-749.967) (-749.818) [-749.873] * (-755.788) (-751.239) [-750.616] (-750.549) -- 0:00:51
      258500 -- (-748.676) [-748.098] (-748.703) (-748.256) * (-753.951) (-751.181) [-751.202] (-751.023) -- 0:00:51
      259000 -- (-748.734) [-753.010] (-749.990) (-750.484) * (-751.038) [-749.050] (-751.121) (-750.239) -- 0:00:51
      259500 -- (-747.901) (-749.977) [-751.854] (-749.607) * (-748.838) [-751.546] (-754.331) (-749.257) -- 0:00:51
      260000 -- [-750.610] (-751.415) (-750.909) (-748.529) * (-749.262) (-749.964) [-751.895] (-752.397) -- 0:00:51

      Average standard deviation of split frequencies: 0.012885

      260500 -- (-750.756) [-748.785] (-750.724) (-750.196) * [-749.948] (-749.244) (-751.135) (-750.953) -- 0:00:51
      261000 -- [-748.337] (-752.117) (-753.334) (-750.177) * [-749.851] (-749.922) (-749.336) (-753.655) -- 0:00:50
      261500 -- (-750.272) (-752.416) (-750.355) [-751.750] * [-751.616] (-750.574) (-750.722) (-750.766) -- 0:00:50
      262000 -- (-748.740) (-751.224) [-749.957] (-752.528) * (-752.206) (-751.197) [-749.864] (-753.210) -- 0:00:50
      262500 -- (-751.465) [-750.712] (-752.703) (-748.000) * [-751.027] (-748.750) (-749.084) (-749.367) -- 0:00:50
      263000 -- (-752.707) [-750.382] (-751.682) (-750.471) * (-752.910) [-748.104] (-752.244) (-751.437) -- 0:00:50
      263500 -- (-753.997) [-752.366] (-752.300) (-748.661) * [-748.069] (-749.480) (-749.174) (-752.264) -- 0:00:50
      264000 -- (-752.427) [-750.191] (-749.130) (-750.544) * [-749.307] (-749.409) (-752.114) (-755.249) -- 0:00:50
      264500 -- [-752.033] (-753.337) (-750.163) (-749.602) * (-749.953) (-751.388) (-750.561) [-751.211] -- 0:00:50
      265000 -- (-749.201) [-753.318] (-750.534) (-750.619) * (-748.690) (-750.544) (-750.606) [-752.456] -- 0:00:49

      Average standard deviation of split frequencies: 0.013239

      265500 -- [-749.183] (-750.828) (-748.433) (-750.715) * (-751.030) (-748.217) (-748.777) [-749.028] -- 0:00:49
      266000 -- [-752.159] (-749.824) (-749.444) (-752.836) * (-749.343) (-749.099) [-748.813] (-748.546) -- 0:00:49
      266500 -- (-751.733) [-749.372] (-752.314) (-750.554) * (-748.992) [-751.222] (-752.104) (-749.902) -- 0:00:49
      267000 -- (-750.141) (-749.487) [-749.737] (-749.339) * (-755.823) (-749.004) [-752.185] (-750.110) -- 0:00:49
      267500 -- (-749.512) (-751.638) (-749.575) [-749.938] * (-748.065) [-751.080] (-749.040) (-748.167) -- 0:00:49
      268000 -- (-750.872) (-749.087) (-748.122) [-749.623] * (-749.795) [-750.734] (-748.843) (-749.176) -- 0:00:49
      268500 -- (-750.457) [-749.463] (-752.276) (-749.334) * (-748.400) (-750.658) [-749.217] (-749.086) -- 0:00:49
      269000 -- (-750.633) [-750.413] (-750.712) (-750.251) * (-750.068) (-752.789) [-749.242] (-757.693) -- 0:00:48
      269500 -- [-750.166] (-752.882) (-751.700) (-752.837) * (-750.263) (-750.210) [-749.912] (-753.806) -- 0:00:48
      270000 -- (-749.207) [-748.361] (-748.855) (-750.499) * (-750.388) (-749.915) [-748.525] (-749.062) -- 0:00:48

      Average standard deviation of split frequencies: 0.014445

      270500 -- [-749.242] (-754.067) (-751.280) (-749.862) * (-748.612) (-750.279) [-748.443] (-751.493) -- 0:00:51
      271000 -- (-748.924) [-748.675] (-756.198) (-753.610) * (-748.341) [-750.991] (-749.507) (-749.836) -- 0:00:51
      271500 -- [-751.323] (-750.859) (-751.031) (-752.193) * (-748.296) (-751.540) (-750.458) [-751.959] -- 0:00:50
      272000 -- (-748.673) [-748.204] (-753.917) (-751.106) * [-751.885] (-749.980) (-750.816) (-749.260) -- 0:00:50
      272500 -- (-750.039) (-748.276) (-754.689) [-748.887] * (-748.764) (-748.236) [-751.771] (-748.315) -- 0:00:50
      273000 -- (-750.029) [-749.994] (-750.807) (-748.918) * [-748.148] (-751.914) (-751.257) (-751.056) -- 0:00:50
      273500 -- (-750.153) [-748.491] (-747.914) (-747.846) * (-749.310) (-750.370) [-751.839] (-750.055) -- 0:00:50
      274000 -- [-750.302] (-751.612) (-752.540) (-749.951) * (-749.197) (-751.773) (-749.650) [-749.746] -- 0:00:50
      274500 -- (-751.764) [-749.978] (-748.717) (-750.095) * (-753.017) (-749.592) [-754.187] (-750.780) -- 0:00:50
      275000 -- (-751.608) (-750.574) [-749.004] (-751.307) * (-755.531) (-748.422) (-749.792) [-748.892] -- 0:00:50

      Average standard deviation of split frequencies: 0.013162

      275500 -- (-751.085) (-750.046) (-748.991) [-748.286] * (-749.279) (-750.318) (-749.323) [-749.133] -- 0:00:49
      276000 -- (-750.576) (-748.636) [-749.469] (-749.107) * (-749.643) [-748.257] (-749.120) (-749.768) -- 0:00:49
      276500 -- (-751.248) (-748.137) (-754.552) [-751.578] * (-752.912) (-748.608) [-749.377] (-756.113) -- 0:00:49
      277000 -- (-750.708) (-749.637) (-749.600) [-750.719] * [-749.222] (-750.744) (-749.436) (-750.001) -- 0:00:49
      277500 -- (-749.112) (-748.523) (-752.314) [-749.372] * (-750.442) (-748.985) (-749.934) [-751.117] -- 0:00:49
      278000 -- (-749.896) (-748.382) [-750.772] (-752.777) * (-749.055) (-750.556) [-751.650] (-752.165) -- 0:00:49
      278500 -- (-751.448) (-749.558) [-749.338] (-749.721) * [-748.688] (-750.283) (-750.923) (-754.525) -- 0:00:49
      279000 -- (-757.967) (-748.691) [-750.343] (-748.745) * (-749.917) (-748.700) (-751.480) [-748.919] -- 0:00:49
      279500 -- [-749.602] (-751.343) (-749.461) (-756.198) * [-748.682] (-751.894) (-752.184) (-751.781) -- 0:00:48
      280000 -- (-748.032) [-751.630] (-749.395) (-751.220) * (-749.523) (-749.780) (-750.067) [-752.971] -- 0:00:48

      Average standard deviation of split frequencies: 0.013140

      280500 -- (-749.108) [-750.685] (-752.074) (-751.503) * [-749.499] (-752.809) (-750.848) (-750.043) -- 0:00:48
      281000 -- (-749.089) [-748.124] (-749.517) (-750.930) * (-749.029) (-748.693) (-750.134) [-749.874] -- 0:00:48
      281500 -- (-749.429) (-752.483) [-751.088] (-752.319) * (-751.932) [-749.477] (-750.875) (-750.311) -- 0:00:48
      282000 -- (-748.582) (-750.254) [-754.322] (-759.052) * [-751.739] (-749.918) (-749.148) (-749.182) -- 0:00:48
      282500 -- (-751.645) [-751.843] (-752.041) (-749.318) * (-750.254) (-749.849) [-750.508] (-752.181) -- 0:00:48
      283000 -- (-755.395) (-751.804) (-754.035) [-750.306] * (-749.993) [-749.439] (-753.881) (-751.268) -- 0:00:48
      283500 -- (-752.706) (-750.186) [-750.737] (-748.927) * (-748.454) (-748.841) [-751.736] (-750.952) -- 0:00:48
      284000 -- [-748.949] (-750.240) (-749.838) (-748.112) * (-749.071) [-748.527] (-748.520) (-754.897) -- 0:00:47
      284500 -- (-755.339) (-749.875) (-754.991) [-753.647] * (-750.763) (-751.294) (-748.495) [-758.499] -- 0:00:50
      285000 -- (-751.926) (-750.945) [-749.519] (-750.045) * (-749.553) (-749.944) [-748.216] (-753.804) -- 0:00:50

      Average standard deviation of split frequencies: 0.012992

      285500 -- (-752.333) [-748.011] (-750.598) (-751.324) * (-753.842) (-750.531) [-749.383] (-751.732) -- 0:00:50
      286000 -- (-749.289) [-748.801] (-749.988) (-749.827) * (-756.735) (-748.387) (-748.844) [-749.390] -- 0:00:49
      286500 -- [-750.614] (-748.772) (-748.444) (-753.416) * [-752.809] (-749.189) (-752.144) (-750.516) -- 0:00:49
      287000 -- [-749.685] (-752.153) (-748.886) (-748.350) * (-751.168) (-751.862) [-749.402] (-752.398) -- 0:00:49
      287500 -- (-748.786) (-751.854) [-748.324] (-749.524) * [-752.147] (-752.794) (-749.841) (-751.485) -- 0:00:49
      288000 -- (-754.315) [-750.004] (-751.192) (-749.198) * [-748.916] (-750.699) (-751.046) (-754.627) -- 0:00:49
      288500 -- [-753.812] (-753.386) (-748.025) (-748.524) * (-750.535) (-750.509) (-749.783) [-751.674] -- 0:00:49
      289000 -- (-752.850) (-752.512) [-751.831] (-749.509) * (-749.656) (-748.569) [-748.147] (-748.747) -- 0:00:49
      289500 -- [-750.860] (-751.205) (-750.847) (-748.918) * (-749.811) (-748.070) (-754.240) [-753.716] -- 0:00:49
      290000 -- (-748.812) [-750.410] (-750.585) (-748.035) * (-751.883) (-748.278) (-750.440) [-750.355] -- 0:00:48

      Average standard deviation of split frequencies: 0.013165

      290500 -- [-748.987] (-752.098) (-750.714) (-750.115) * (-748.799) [-751.864] (-749.398) (-749.307) -- 0:00:48
      291000 -- (-751.879) (-751.273) [-748.479] (-750.834) * [-750.078] (-749.035) (-750.517) (-749.707) -- 0:00:48
      291500 -- [-750.121] (-749.838) (-748.474) (-749.678) * (-751.046) [-749.063] (-749.357) (-750.198) -- 0:00:48
      292000 -- (-747.941) (-750.554) (-750.864) [-747.931] * (-749.131) [-750.334] (-749.751) (-749.659) -- 0:00:48
      292500 -- (-748.162) (-755.727) (-750.825) [-748.333] * (-749.299) (-750.348) [-749.439] (-748.119) -- 0:00:48
      293000 -- (-748.161) [-750.165] (-749.994) (-748.333) * (-748.579) [-749.773] (-751.253) (-753.675) -- 0:00:48
      293500 -- (-750.147) (-752.859) (-751.552) [-749.817] * (-751.084) (-750.823) [-752.692] (-751.456) -- 0:00:48
      294000 -- (-750.388) [-748.421] (-752.091) (-749.206) * (-748.462) (-749.957) (-751.882) [-750.576] -- 0:00:48
      294500 -- (-750.572) [-750.546] (-749.533) (-751.436) * [-749.638] (-749.867) (-750.429) (-753.206) -- 0:00:47
      295000 -- (-755.445) (-752.004) (-750.030) [-758.825] * (-752.547) (-751.335) (-751.850) [-751.492] -- 0:00:47

      Average standard deviation of split frequencies: 0.013490

      295500 -- (-749.867) (-749.320) [-750.655] (-751.342) * (-751.530) [-751.974] (-751.009) (-750.665) -- 0:00:47
      296000 -- (-749.555) (-747.929) (-748.145) [-749.348] * [-750.401] (-753.135) (-751.813) (-752.094) -- 0:00:47
      296500 -- (-748.419) (-748.317) [-749.384] (-749.436) * (-752.332) [-749.756] (-749.925) (-751.578) -- 0:00:47
      297000 -- (-752.015) (-749.813) [-748.808] (-750.086) * (-749.399) (-752.207) [-750.435] (-751.982) -- 0:00:47
      297500 -- (-749.115) [-750.647] (-749.191) (-752.881) * (-751.057) [-749.110] (-752.150) (-752.166) -- 0:00:49
      298000 -- (-750.143) [-749.341] (-753.067) (-751.731) * (-748.623) [-750.585] (-750.532) (-752.274) -- 0:00:49
      298500 -- (-750.742) (-751.513) (-751.816) [-751.025] * (-752.932) [-749.874] (-752.957) (-751.977) -- 0:00:49
      299000 -- (-753.469) (-753.001) (-750.577) [-749.440] * (-750.644) (-752.592) (-749.204) [-749.998] -- 0:00:49
      299500 -- (-752.424) (-753.876) [-749.751] (-749.722) * (-750.934) (-755.730) [-749.615] (-751.721) -- 0:00:49
      300000 -- (-755.057) (-753.425) [-752.818] (-749.702) * (-751.398) (-751.782) (-749.454) [-749.281] -- 0:00:48

      Average standard deviation of split frequencies: 0.012820

      300500 -- [-749.198] (-752.415) (-748.455) (-749.277) * (-750.880) (-749.092) (-751.089) [-750.202] -- 0:00:48
      301000 -- (-750.970) (-748.366) [-751.224] (-748.397) * (-752.147) [-751.269] (-749.420) (-749.807) -- 0:00:48
      301500 -- (-749.947) (-748.867) [-749.590] (-749.333) * (-752.173) (-748.879) [-752.903] (-750.732) -- 0:00:48
      302000 -- [-753.952] (-748.029) (-749.005) (-749.530) * (-752.382) (-749.019) (-749.934) [-750.594] -- 0:00:48
      302500 -- (-748.704) [-749.658] (-750.638) (-750.440) * [-749.516] (-753.411) (-752.711) (-751.702) -- 0:00:48
      303000 -- (-748.273) (-750.687) (-752.033) [-749.926] * (-749.796) (-755.455) [-748.118] (-750.332) -- 0:00:48
      303500 -- [-748.273] (-748.433) (-749.355) (-749.326) * (-751.899) (-755.035) [-748.113] (-754.974) -- 0:00:48
      304000 -- (-750.726) (-748.600) (-749.730) [-751.431] * [-750.436] (-751.739) (-749.565) (-755.324) -- 0:00:48
      304500 -- (-749.845) [-750.065] (-747.958) (-750.052) * [-748.423] (-750.754) (-749.158) (-749.403) -- 0:00:47
      305000 -- (-752.479) (-750.876) (-747.957) [-749.409] * (-749.928) (-751.326) [-749.702] (-748.368) -- 0:00:47

      Average standard deviation of split frequencies: 0.011871

      305500 -- (-750.493) (-751.660) [-750.783] (-750.208) * (-750.503) (-749.907) [-749.016] (-754.246) -- 0:00:47
      306000 -- (-749.383) (-754.649) (-754.244) [-750.877] * [-748.621] (-753.049) (-751.550) (-755.728) -- 0:00:47
      306500 -- (-749.532) (-748.869) (-752.628) [-749.449] * (-749.029) [-753.665] (-749.404) (-750.464) -- 0:00:47
      307000 -- (-751.191) [-751.614] (-755.284) (-750.556) * (-748.267) (-748.218) [-752.747] (-748.926) -- 0:00:47
      307500 -- (-752.430) [-748.522] (-749.252) (-750.920) * [-749.651] (-755.219) (-752.012) (-748.576) -- 0:00:47
      308000 -- (-753.177) (-749.980) [-751.257] (-749.290) * (-757.671) (-752.001) (-748.906) [-749.400] -- 0:00:47
      308500 -- [-751.951] (-749.020) (-751.067) (-753.458) * (-753.147) (-750.730) [-748.672] (-748.338) -- 0:00:47
      309000 -- [-751.042] (-749.450) (-751.946) (-749.797) * (-751.962) [-748.026] (-751.836) (-748.631) -- 0:00:46
      309500 -- (-751.136) (-752.288) [-749.889] (-750.624) * (-749.636) (-749.377) [-750.479] (-749.948) -- 0:00:46
      310000 -- (-751.735) [-748.684] (-748.834) (-749.595) * (-748.999) (-749.298) [-751.307] (-749.061) -- 0:00:46

      Average standard deviation of split frequencies: 0.011380

      310500 -- (-754.195) (-751.088) [-748.823] (-749.690) * (-751.188) (-750.029) [-750.172] (-749.470) -- 0:00:46
      311000 -- (-750.077) (-750.076) [-752.885] (-749.011) * [-750.597] (-753.933) (-749.179) (-750.430) -- 0:00:48
      311500 -- (-750.315) (-751.346) (-752.366) [-749.657] * (-752.254) [-752.210] (-748.165) (-750.589) -- 0:00:48
      312000 -- (-747.827) [-751.108] (-753.542) (-750.243) * (-749.980) [-752.191] (-748.626) (-748.427) -- 0:00:48
      312500 -- (-750.355) (-752.321) (-755.781) [-752.876] * (-753.044) (-750.577) (-749.384) [-752.259] -- 0:00:48
      313000 -- (-749.934) (-750.832) (-753.639) [-751.843] * (-752.586) (-748.978) [-753.382] (-748.370) -- 0:00:48
      313500 -- (-749.631) (-749.071) [-751.119] (-751.544) * (-748.530) (-748.492) (-751.145) [-750.115] -- 0:00:48
      314000 -- (-750.892) (-755.115) [-749.519] (-748.467) * (-750.269) [-749.862] (-750.014) (-749.790) -- 0:00:48
      314500 -- [-749.930] (-749.330) (-750.953) (-749.514) * [-749.801] (-750.511) (-749.085) (-749.063) -- 0:00:47
      315000 -- (-751.688) (-749.590) [-751.270] (-753.966) * [-750.723] (-748.652) (-748.660) (-748.801) -- 0:00:47

      Average standard deviation of split frequencies: 0.010815

      315500 -- (-749.706) (-750.089) [-750.909] (-755.406) * (-753.890) [-750.944] (-750.362) (-751.373) -- 0:00:47
      316000 -- (-749.962) (-750.292) (-751.220) [-751.093] * (-755.141) [-750.011] (-750.645) (-751.370) -- 0:00:47
      316500 -- (-751.023) (-749.287) [-749.833] (-749.137) * (-752.354) (-751.726) (-749.239) [-752.189] -- 0:00:47
      317000 -- (-752.595) [-749.341] (-754.090) (-751.008) * (-752.620) (-750.267) (-748.160) [-748.996] -- 0:00:47
      317500 -- (-753.037) (-749.170) (-751.881) [-750.626] * (-749.182) (-751.990) [-749.693] (-748.483) -- 0:00:47
      318000 -- (-748.349) (-750.335) (-752.770) [-750.452] * (-748.096) [-749.047] (-749.564) (-750.541) -- 0:00:47
      318500 -- [-750.080] (-748.373) (-748.960) (-749.437) * [-748.549] (-749.726) (-750.744) (-752.599) -- 0:00:47
      319000 -- (-751.549) [-751.511] (-754.006) (-748.787) * [-749.186] (-752.581) (-749.275) (-750.264) -- 0:00:46
      319500 -- (-751.572) (-751.719) (-759.364) [-748.346] * [-749.933] (-750.934) (-750.200) (-753.656) -- 0:00:46
      320000 -- [-752.883] (-748.980) (-755.244) (-754.586) * (-749.060) (-748.302) [-749.035] (-749.735) -- 0:00:46

      Average standard deviation of split frequencies: 0.010781

      320500 -- (-751.798) [-751.311] (-756.480) (-749.677) * (-750.737) (-750.492) (-750.013) [-749.937] -- 0:00:46
      321000 -- [-749.538] (-751.351) (-749.014) (-752.822) * (-748.786) [-751.585] (-753.703) (-748.804) -- 0:00:46
      321500 -- (-749.976) (-749.530) (-755.155) [-752.238] * (-756.329) (-748.750) [-748.991] (-749.334) -- 0:00:46
      322000 -- (-750.001) (-749.322) (-749.781) [-755.107] * (-749.151) (-751.784) (-752.113) [-748.372] -- 0:00:46
      322500 -- (-750.160) (-750.664) (-751.372) [-752.869] * (-749.232) (-750.470) [-749.319] (-749.085) -- 0:00:46
      323000 -- (-751.561) [-751.341] (-754.385) (-751.574) * [-749.479] (-748.924) (-747.739) (-752.166) -- 0:00:46
      323500 -- (-750.848) (-748.540) (-751.782) [-749.983] * (-751.496) (-751.488) [-750.164] (-752.109) -- 0:00:46
      324000 -- (-750.042) [-749.913] (-755.678) (-750.166) * [-749.381] (-749.110) (-749.433) (-751.502) -- 0:00:45
      324500 -- (-752.041) [-748.870] (-752.366) (-754.015) * (-749.251) (-749.692) [-749.645] (-751.534) -- 0:00:47
      325000 -- (-753.390) [-749.054] (-751.149) (-749.651) * (-750.855) [-749.721] (-752.363) (-750.267) -- 0:00:47

      Average standard deviation of split frequencies: 0.010213

      325500 -- [-751.751] (-749.490) (-750.655) (-749.250) * (-750.668) [-748.564] (-754.560) (-750.782) -- 0:00:47
      326000 -- [-748.454] (-754.970) (-749.460) (-750.489) * (-748.341) (-749.071) [-750.784] (-751.586) -- 0:00:47
      326500 -- [-748.997] (-750.223) (-749.351) (-749.966) * (-749.484) (-751.316) [-749.605] (-752.179) -- 0:00:47
      327000 -- [-750.767] (-749.327) (-754.449) (-750.604) * (-749.349) [-749.819] (-753.004) (-749.794) -- 0:00:47
      327500 -- (-748.966) [-748.922] (-751.956) (-752.781) * (-749.066) (-750.028) [-750.781] (-750.054) -- 0:00:47
      328000 -- [-748.686] (-752.138) (-750.022) (-751.649) * (-748.820) (-751.196) [-749.258] (-748.461) -- 0:00:47
      328500 -- (-752.403) (-748.803) (-750.467) [-750.460] * (-749.180) (-749.230) (-748.621) [-749.256] -- 0:00:47
      329000 -- (-749.959) (-750.210) [-747.778] (-749.944) * (-749.304) [-747.945] (-751.426) (-748.616) -- 0:00:46
      329500 -- (-748.444) (-750.318) (-749.938) [-751.692] * (-753.160) (-750.795) [-751.561] (-752.917) -- 0:00:46
      330000 -- (-749.258) [-748.929] (-750.254) (-748.693) * [-755.757] (-749.380) (-750.184) (-750.391) -- 0:00:46

      Average standard deviation of split frequencies: 0.009219

      330500 -- (-752.510) (-749.622) [-748.810] (-749.246) * (-753.291) [-750.031] (-748.806) (-750.905) -- 0:00:46
      331000 -- (-756.983) (-752.079) [-750.505] (-749.099) * [-749.910] (-750.254) (-749.958) (-750.698) -- 0:00:46
      331500 -- (-752.730) (-750.575) (-751.286) [-748.702] * (-748.138) (-751.645) [-749.898] (-751.745) -- 0:00:46
      332000 -- (-751.708) (-754.437) (-751.525) [-748.707] * (-750.123) (-749.427) (-749.114) [-750.196] -- 0:00:46
      332500 -- (-751.031) (-758.013) (-749.696) [-748.953] * (-749.647) [-749.426] (-752.965) (-751.746) -- 0:00:46
      333000 -- [-751.017] (-751.243) (-747.875) (-753.522) * (-752.875) [-748.277] (-750.599) (-750.541) -- 0:00:46
      333500 -- (-750.636) (-752.862) (-750.352) [-751.052] * (-754.544) (-749.317) [-756.284] (-749.906) -- 0:00:45
      334000 -- (-752.824) (-750.804) [-750.821] (-749.748) * (-748.887) (-749.676) [-749.127] (-751.690) -- 0:00:45
      334500 -- (-748.531) [-751.662] (-750.526) (-749.684) * (-748.702) [-750.049] (-749.220) (-754.584) -- 0:00:45
      335000 -- (-748.581) (-750.406) (-750.051) [-751.770] * (-749.579) [-748.863] (-748.658) (-751.648) -- 0:00:45

      Average standard deviation of split frequencies: 0.008979

      335500 -- (-750.328) (-750.798) [-749.652] (-748.872) * [-748.010] (-752.399) (-750.516) (-755.305) -- 0:00:47
      336000 -- (-749.855) [-750.090] (-751.018) (-752.620) * [-748.866] (-748.230) (-752.686) (-752.716) -- 0:00:47
      336500 -- (-748.425) (-750.827) (-748.396) [-752.043] * [-751.537] (-750.232) (-749.056) (-752.746) -- 0:00:47
      337000 -- [-748.237] (-748.735) (-750.331) (-750.200) * (-749.048) [-750.094] (-756.319) (-749.868) -- 0:00:47
      337500 -- [-748.308] (-748.840) (-752.047) (-748.644) * (-749.617) (-751.430) [-755.331] (-750.671) -- 0:00:47
      338000 -- (-750.318) [-748.190] (-750.940) (-748.939) * (-752.842) [-750.569] (-748.163) (-748.661) -- 0:00:47
      338500 -- [-749.067] (-750.008) (-750.697) (-750.461) * [-749.850] (-751.811) (-748.289) (-749.460) -- 0:00:46
      339000 -- (-748.796) (-750.054) (-750.286) [-750.388] * [-752.531] (-749.143) (-752.415) (-750.367) -- 0:00:46
      339500 -- (-753.134) (-753.374) [-749.970] (-748.194) * (-749.706) (-750.956) [-748.865] (-749.921) -- 0:00:46
      340000 -- [-753.480] (-753.307) (-753.799) (-748.796) * (-749.612) (-750.296) [-750.165] (-749.111) -- 0:00:46

      Average standard deviation of split frequencies: 0.009963

      340500 -- (-753.350) (-751.782) (-752.733) [-749.584] * [-748.739] (-753.197) (-750.529) (-751.718) -- 0:00:46
      341000 -- (-750.204) [-750.622] (-752.457) (-748.843) * (-748.667) [-754.041] (-749.173) (-751.538) -- 0:00:46
      341500 -- (-750.447) [-749.687] (-753.882) (-755.219) * (-749.308) (-751.881) (-753.414) [-751.563] -- 0:00:46
      342000 -- (-750.509) (-749.892) [-750.083] (-751.213) * [-748.427] (-752.466) (-750.241) (-749.711) -- 0:00:46
      342500 -- (-754.087) [-749.034] (-748.532) (-750.375) * [-749.868] (-749.607) (-752.978) (-753.393) -- 0:00:46
      343000 -- (-749.461) (-749.034) (-750.199) [-749.757] * (-749.944) [-753.300] (-748.212) (-751.595) -- 0:00:45
      343500 -- (-750.968) (-751.838) [-749.589] (-752.778) * (-753.282) (-755.398) (-752.485) [-749.024] -- 0:00:45
      344000 -- (-748.142) [-750.727] (-750.309) (-753.988) * (-750.867) [-751.666] (-757.901) (-748.460) -- 0:00:45
      344500 -- [-751.002] (-751.089) (-751.444) (-750.589) * (-751.293) (-749.143) [-749.658] (-748.314) -- 0:00:45
      345000 -- (-749.454) (-751.842) [-751.030] (-751.130) * (-752.442) [-748.992] (-750.360) (-749.256) -- 0:00:45

      Average standard deviation of split frequencies: 0.011836

      345500 -- (-752.791) [-754.283] (-754.712) (-750.587) * [-748.908] (-748.962) (-750.468) (-748.805) -- 0:00:45
      346000 -- (-749.629) [-751.599] (-749.084) (-750.048) * [-749.153] (-747.927) (-748.557) (-749.258) -- 0:00:45
      346500 -- (-748.013) (-753.347) (-751.500) [-749.729] * (-751.605) (-749.812) [-749.806] (-752.311) -- 0:00:45
      347000 -- (-748.522) [-753.187] (-754.149) (-749.517) * [-750.969] (-751.662) (-749.134) (-757.478) -- 0:00:45
      347500 -- (-750.100) [-751.090] (-755.743) (-749.814) * (-753.154) [-752.256] (-748.962) (-747.995) -- 0:00:45
      348000 -- (-749.438) (-750.339) [-749.284] (-749.332) * (-751.168) [-749.292] (-749.656) (-757.506) -- 0:00:44
      348500 -- (-748.296) (-753.280) (-751.812) [-750.683] * [-751.486] (-752.584) (-752.454) (-751.444) -- 0:00:44
      349000 -- (-753.872) [-752.267] (-749.381) (-752.360) * (-749.448) (-749.836) [-749.697] (-748.149) -- 0:00:46
      349500 -- (-752.169) (-748.463) [-749.222] (-749.329) * (-750.152) (-748.129) (-752.279) [-752.189] -- 0:00:46
      350000 -- (-753.474) [-750.629] (-749.485) (-748.327) * (-750.400) [-748.145] (-749.129) (-748.679) -- 0:00:46

      Average standard deviation of split frequencies: 0.012771

      350500 -- [-748.819] (-753.934) (-749.835) (-749.601) * (-750.919) (-748.849) (-748.082) [-748.532] -- 0:00:46
      351000 -- (-749.301) (-752.041) [-748.829] (-753.546) * (-749.947) (-748.315) [-748.527] (-752.024) -- 0:00:46
      351500 -- (-748.381) (-751.419) [-748.672] (-753.615) * (-751.593) [-753.779] (-748.138) (-749.256) -- 0:00:46
      352000 -- (-748.809) (-751.783) [-749.841] (-749.475) * [-748.935] (-750.749) (-749.959) (-749.469) -- 0:00:46
      352500 -- [-750.701] (-748.872) (-749.278) (-749.704) * (-750.492) (-753.548) (-749.731) [-749.124] -- 0:00:45
      353000 -- (-754.700) [-748.363] (-751.026) (-751.299) * [-749.797] (-753.043) (-750.379) (-751.103) -- 0:00:45
      353500 -- (-749.934) [-749.719] (-751.588) (-756.057) * [-750.229] (-751.730) (-751.651) (-750.238) -- 0:00:45
      354000 -- (-750.406) [-751.566] (-752.658) (-748.895) * (-750.329) (-747.931) [-750.087] (-749.670) -- 0:00:45
      354500 -- [-749.818] (-749.414) (-748.666) (-749.924) * (-749.082) (-749.379) (-752.920) [-750.665] -- 0:00:45
      355000 -- (-758.154) [-750.591] (-750.990) (-749.786) * (-750.673) (-748.923) [-748.709] (-751.572) -- 0:00:45

      Average standard deviation of split frequencies: 0.013738

      355500 -- (-751.581) [-749.014] (-749.630) (-752.803) * [-748.167] (-750.548) (-750.257) (-749.097) -- 0:00:45
      356000 -- [-749.128] (-749.192) (-750.646) (-748.672) * (-748.678) (-751.215) (-750.661) [-751.942] -- 0:00:45
      356500 -- (-753.051) (-751.063) (-752.912) [-749.387] * (-753.404) [-749.091] (-749.320) (-750.972) -- 0:00:45
      357000 -- (-753.504) (-748.296) [-749.891] (-752.006) * [-749.069] (-751.383) (-752.943) (-751.656) -- 0:00:45
      357500 -- (-750.877) [-749.481] (-753.332) (-754.790) * (-750.006) (-757.813) (-749.518) [-749.440] -- 0:00:44
      358000 -- [-750.062] (-748.488) (-748.763) (-748.162) * (-752.037) (-758.401) [-750.108] (-753.365) -- 0:00:44
      358500 -- (-751.337) (-750.583) [-750.003] (-752.707) * (-751.488) (-751.807) [-750.020] (-751.504) -- 0:00:44
      359000 -- (-748.605) (-750.030) [-750.375] (-750.966) * (-751.626) [-749.905] (-755.993) (-753.289) -- 0:00:44
      359500 -- [-753.777] (-750.830) (-750.303) (-749.858) * (-750.363) (-749.710) (-754.620) [-748.559] -- 0:00:44
      360000 -- (-748.519) [-749.137] (-748.192) (-750.308) * (-752.999) (-751.396) [-753.441] (-748.542) -- 0:00:44

      Average standard deviation of split frequencies: 0.014132

      360500 -- (-749.144) [-749.261] (-749.627) (-750.295) * (-750.418) (-753.723) (-749.096) [-748.119] -- 0:00:44
      361000 -- (-749.559) (-750.494) [-753.439] (-750.240) * (-749.926) (-750.218) [-753.201] (-749.546) -- 0:00:44
      361500 -- (-749.787) (-750.342) (-749.084) [-749.345] * [-748.955] (-750.570) (-750.567) (-751.694) -- 0:00:44
      362000 -- (-749.365) (-748.652) (-749.024) [-748.697] * [-748.780] (-749.977) (-752.342) (-751.630) -- 0:00:44
      362500 -- (-752.949) [-748.911] (-749.676) (-749.144) * (-748.638) (-749.336) [-750.772] (-748.942) -- 0:00:43
      363000 -- (-748.871) [-750.895] (-750.554) (-749.211) * (-750.158) [-749.203] (-751.132) (-749.560) -- 0:00:43
      363500 -- (-754.842) [-750.153] (-751.362) (-749.472) * (-751.332) (-749.757) (-751.120) [-748.684] -- 0:00:43
      364000 -- [-750.232] (-748.513) (-750.552) (-748.815) * (-748.597) (-750.819) [-751.156] (-748.567) -- 0:00:43
      364500 -- (-753.343) (-749.273) (-751.221) [-748.002] * (-749.619) [-752.407] (-748.828) (-750.694) -- 0:00:43
      365000 -- (-750.348) (-747.824) [-751.979] (-748.952) * (-750.984) (-750.709) [-748.953] (-751.813) -- 0:00:45

      Average standard deviation of split frequencies: 0.014016

      365500 -- [-754.031] (-753.626) (-757.657) (-751.705) * (-749.433) [-750.156] (-749.932) (-750.334) -- 0:00:45
      366000 -- [-749.442] (-750.271) (-752.264) (-748.709) * (-751.263) (-750.162) [-751.493] (-749.314) -- 0:00:45
      366500 -- (-753.986) [-747.962] (-756.448) (-749.425) * (-751.433) (-755.627) [-749.275] (-748.901) -- 0:00:44
      367000 -- (-752.500) [-749.162] (-753.506) (-752.352) * [-750.044] (-749.079) (-751.477) (-750.221) -- 0:00:44
      367500 -- (-749.712) (-750.705) (-750.770) [-749.710] * (-751.674) (-748.359) [-748.532] (-749.796) -- 0:00:44
      368000 -- [-749.485] (-751.845) (-753.560) (-754.950) * [-749.974] (-747.739) (-749.664) (-749.289) -- 0:00:44
      368500 -- [-749.229] (-750.120) (-750.737) (-749.624) * (-752.393) (-750.117) [-750.036] (-752.664) -- 0:00:44
      369000 -- (-748.684) [-750.783] (-750.899) (-748.273) * [-749.184] (-749.283) (-748.621) (-749.419) -- 0:00:44
      369500 -- (-748.937) [-748.740] (-751.850) (-754.143) * (-749.037) (-749.682) [-748.576] (-749.538) -- 0:00:44
      370000 -- (-751.844) [-752.029] (-751.400) (-749.410) * (-749.245) (-751.225) (-748.492) [-748.567] -- 0:00:44

      Average standard deviation of split frequencies: 0.013690

      370500 -- (-751.176) (-752.498) (-750.580) [-749.365] * (-749.667) (-750.103) [-748.709] (-752.140) -- 0:00:44
      371000 -- (-756.102) (-752.892) (-749.412) [-749.848] * (-749.732) [-748.410] (-748.637) (-750.777) -- 0:00:44
      371500 -- (-755.071) (-753.133) [-749.726] (-751.027) * (-751.274) [-754.015] (-749.950) (-751.253) -- 0:00:43
      372000 -- (-755.470) (-748.905) (-747.967) [-750.147] * [-748.834] (-750.024) (-749.186) (-749.438) -- 0:00:43
      372500 -- (-750.670) (-753.939) (-748.082) [-752.359] * (-749.281) (-750.162) (-749.179) [-748.462] -- 0:00:43
      373000 -- (-749.510) (-749.381) (-753.197) [-748.758] * (-749.599) (-750.153) [-751.353] (-747.967) -- 0:00:43
      373500 -- (-749.651) [-752.112] (-751.710) (-751.109) * (-750.409) (-748.627) [-749.136] (-748.836) -- 0:00:43
      374000 -- (-750.398) [-751.854] (-751.000) (-756.242) * (-749.875) (-749.084) (-752.559) [-749.511] -- 0:00:43
      374500 -- (-749.492) (-750.425) (-751.898) [-750.885] * (-749.582) (-748.829) [-750.130] (-748.803) -- 0:00:43
      375000 -- (-750.024) (-752.032) (-750.750) [-748.779] * (-748.822) (-749.587) (-751.776) [-750.137] -- 0:00:43

      Average standard deviation of split frequencies: 0.013634

      375500 -- (-750.677) (-753.170) (-749.614) [-749.750] * (-754.793) [-748.401] (-749.168) (-750.640) -- 0:00:43
      376000 -- (-752.082) [-753.384] (-748.369) (-750.835) * [-751.172] (-749.848) (-752.007) (-753.128) -- 0:00:43
      376500 -- (-749.569) (-752.980) [-751.317] (-748.763) * [-753.901] (-748.677) (-751.077) (-747.888) -- 0:00:43
      377000 -- [-749.632] (-748.418) (-754.134) (-748.522) * (-755.805) (-748.484) [-749.558] (-750.145) -- 0:00:42
      377500 -- (-752.381) (-748.594) (-757.927) [-748.918] * [-751.565] (-748.504) (-750.944) (-750.695) -- 0:00:42
      378000 -- [-749.639] (-751.583) (-752.536) (-749.633) * (-750.659) [-749.862] (-749.094) (-748.953) -- 0:00:42
      378500 -- (-749.698) (-751.612) [-749.366] (-752.567) * (-751.070) (-752.832) (-748.542) [-749.618] -- 0:00:42
      379000 -- [-753.797] (-760.680) (-748.941) (-752.360) * (-749.014) [-749.907] (-748.911) (-748.837) -- 0:00:42
      379500 -- [-750.932] (-749.538) (-749.508) (-751.512) * (-749.011) (-750.239) (-748.260) [-748.799] -- 0:00:42
      380000 -- (-749.153) (-750.481) [-750.367] (-748.506) * [-749.262] (-750.704) (-749.452) (-749.612) -- 0:00:42

      Average standard deviation of split frequencies: 0.013913

      380500 -- [-749.011] (-749.041) (-748.373) (-748.714) * (-753.055) (-752.167) [-751.000] (-749.455) -- 0:00:42
      381000 -- (-750.262) [-749.938] (-748.931) (-748.741) * (-751.854) [-749.528] (-756.578) (-753.127) -- 0:00:42
      381500 -- [-749.667] (-749.942) (-749.164) (-756.791) * (-749.410) (-750.743) [-756.071] (-752.968) -- 0:00:43
      382000 -- [-748.483] (-750.251) (-751.175) (-749.972) * (-751.464) [-751.828] (-750.927) (-749.063) -- 0:00:43
      382500 -- (-751.066) (-750.486) (-756.722) [-749.939] * [-749.440] (-752.497) (-749.467) (-748.372) -- 0:00:43
      383000 -- (-753.484) (-750.589) [-749.120] (-751.920) * [-749.225] (-751.284) (-751.266) (-749.735) -- 0:00:43
      383500 -- (-753.533) (-751.078) [-748.896] (-753.314) * (-748.899) [-749.454] (-750.790) (-751.445) -- 0:00:43
      384000 -- [-749.300] (-750.346) (-749.950) (-752.401) * (-752.893) (-749.774) [-749.111] (-752.360) -- 0:00:43
      384500 -- (-749.891) [-753.147] (-752.904) (-748.449) * (-753.719) (-748.754) (-750.164) [-749.627] -- 0:00:43
      385000 -- (-751.428) (-750.005) (-750.838) [-749.077] * (-752.451) [-751.159] (-750.951) (-751.997) -- 0:00:43

      Average standard deviation of split frequencies: 0.014296

      385500 -- (-751.299) [-750.951] (-751.776) (-750.235) * (-748.094) (-751.999) (-750.179) [-749.195] -- 0:00:43
      386000 -- [-750.895] (-750.616) (-750.385) (-751.054) * (-749.089) (-749.837) [-749.118] (-750.275) -- 0:00:42
      386500 -- [-748.264] (-749.262) (-751.560) (-749.294) * (-749.369) (-752.293) [-748.865] (-749.854) -- 0:00:42
      387000 -- [-748.507] (-750.575) (-751.712) (-748.460) * (-749.342) [-752.333] (-750.543) (-753.149) -- 0:00:42
      387500 -- (-749.079) (-752.984) [-751.722] (-753.201) * (-749.859) [-750.086] (-748.139) (-750.625) -- 0:00:42
      388000 -- (-753.161) (-749.965) [-751.927] (-749.214) * (-751.912) (-750.456) [-751.566] (-756.207) -- 0:00:42
      388500 -- [-751.488] (-750.391) (-750.666) (-750.051) * [-752.122] (-751.735) (-748.566) (-753.272) -- 0:00:42
      389000 -- (-748.910) (-750.466) (-749.155) [-751.799] * (-750.562) [-749.661] (-748.702) (-748.350) -- 0:00:42
      389500 -- (-755.042) (-755.784) [-748.709] (-751.719) * (-750.391) (-752.636) [-749.070] (-748.534) -- 0:00:42
      390000 -- (-751.667) (-751.118) [-749.957] (-750.379) * (-755.283) [-749.836] (-750.348) (-749.811) -- 0:00:42

      Average standard deviation of split frequencies: 0.014125

      390500 -- (-749.808) (-750.627) [-747.723] (-751.199) * [-751.374] (-750.222) (-749.681) (-750.061) -- 0:00:42
      391000 -- [-750.821] (-751.282) (-747.919) (-749.254) * (-749.203) (-750.222) (-750.773) [-749.795] -- 0:00:42
      391500 -- (-751.866) [-750.342] (-753.978) (-750.319) * (-749.968) (-748.024) (-749.963) [-749.701] -- 0:00:41
      392000 -- (-749.372) (-755.421) [-749.093] (-750.591) * (-750.714) (-748.847) (-749.732) [-748.063] -- 0:00:41
      392500 -- (-751.539) [-752.376] (-751.143) (-749.528) * (-750.631) (-753.346) [-749.360] (-749.510) -- 0:00:41
      393000 -- (-751.236) [-750.095] (-750.970) (-752.207) * [-751.625] (-757.115) (-751.469) (-753.180) -- 0:00:41
      393500 -- (-750.342) (-751.918) [-749.976] (-748.643) * (-750.003) [-750.546] (-750.111) (-750.461) -- 0:00:41
      394000 -- (-751.448) (-748.587) (-751.402) [-748.466] * (-752.696) [-749.844] (-751.298) (-748.665) -- 0:00:41
      394500 -- (-750.114) [-750.862] (-751.342) (-748.485) * [-752.024] (-752.035) (-750.114) (-750.208) -- 0:00:41
      395000 -- [-752.538] (-750.727) (-753.280) (-752.433) * (-753.941) (-753.363) (-752.574) [-751.649] -- 0:00:41

      Average standard deviation of split frequencies: 0.014075

      395500 -- (-750.380) [-752.322] (-749.340) (-753.016) * (-749.907) (-752.113) [-751.834] (-750.310) -- 0:00:41
      396000 -- (-752.046) (-750.093) (-750.045) [-753.086] * (-749.498) [-751.174] (-750.648) (-749.970) -- 0:00:41
      396500 -- (-753.512) (-748.283) [-750.303] (-750.179) * (-749.525) (-749.713) (-751.932) [-749.647] -- 0:00:41
      397000 -- (-751.437) (-750.170) [-750.396] (-752.447) * (-749.983) (-748.990) (-754.578) [-750.219] -- 0:00:41
      397500 -- [-750.259] (-750.032) (-752.230) (-750.742) * (-748.613) (-751.695) (-751.168) [-750.962] -- 0:00:40
      398000 -- (-749.896) (-750.663) (-754.098) [-754.039] * (-749.695) [-749.579] (-751.224) (-748.080) -- 0:00:42
      398500 -- (-748.607) (-753.288) [-749.872] (-752.608) * [-748.712] (-750.797) (-751.347) (-749.223) -- 0:00:42
      399000 -- (-751.995) (-749.158) (-751.062) [-750.457] * (-749.864) (-753.252) (-749.175) [-751.267] -- 0:00:42
      399500 -- (-749.365) (-751.260) [-750.830] (-748.989) * (-751.107) [-754.147] (-751.265) (-749.011) -- 0:00:42
      400000 -- (-749.323) (-752.233) (-751.153) [-751.950] * (-749.435) (-749.995) (-752.557) [-749.033] -- 0:00:41

      Average standard deviation of split frequencies: 0.014560

      400500 -- (-748.554) (-751.659) (-749.766) [-749.873] * (-748.121) (-749.971) (-753.753) [-750.573] -- 0:00:41
      401000 -- [-752.058] (-750.221) (-748.866) (-753.633) * (-749.967) (-747.948) (-754.852) [-749.536] -- 0:00:41
      401500 -- (-754.708) (-749.335) (-749.939) [-749.846] * (-753.041) [-749.887] (-749.267) (-748.124) -- 0:00:41
      402000 -- (-749.780) [-749.885] (-749.924) (-749.932) * [-750.040] (-750.643) (-755.501) (-749.777) -- 0:00:41
      402500 -- [-749.846] (-749.676) (-755.135) (-750.273) * (-751.032) (-752.225) (-751.618) [-750.131] -- 0:00:41
      403000 -- (-748.298) [-749.619] (-749.501) (-751.222) * (-749.421) (-752.683) (-751.057) [-749.733] -- 0:00:41
      403500 -- (-748.930) (-749.958) (-750.148) [-748.851] * (-750.752) (-749.030) (-753.058) [-748.039] -- 0:00:41
      404000 -- [-749.721] (-752.890) (-752.431) (-755.286) * (-748.110) (-753.803) (-748.839) [-748.326] -- 0:00:41
      404500 -- (-751.008) [-748.272] (-749.206) (-749.960) * (-753.666) [-748.127] (-754.326) (-748.328) -- 0:00:41
      405000 -- (-750.430) [-747.997] (-749.299) (-749.090) * (-748.965) (-751.498) (-752.132) [-749.525] -- 0:00:41

      Average standard deviation of split frequencies: 0.013592

      405500 -- (-749.906) [-751.448] (-748.409) (-748.730) * (-754.557) (-759.451) [-751.712] (-748.587) -- 0:00:41
      406000 -- (-749.816) (-752.297) [-749.710] (-749.113) * [-748.884] (-751.734) (-751.970) (-750.162) -- 0:00:40
      406500 -- (-749.968) (-748.663) (-750.559) [-749.073] * (-759.237) [-749.622] (-749.675) (-750.208) -- 0:00:40
      407000 -- (-750.199) (-750.576) (-751.527) [-748.468] * [-749.174] (-750.492) (-752.491) (-750.821) -- 0:00:40
      407500 -- (-749.725) (-749.775) (-755.419) [-750.284] * [-749.870] (-748.754) (-752.703) (-748.559) -- 0:00:40
      408000 -- (-749.964) (-751.557) (-752.466) [-752.342] * [-748.545] (-749.832) (-751.489) (-751.011) -- 0:00:40
      408500 -- (-752.023) (-750.965) (-753.428) [-750.750] * (-748.884) (-749.686) (-749.940) [-752.408] -- 0:00:40
      409000 -- (-750.610) (-750.427) [-750.989] (-749.578) * (-749.935) [-752.040] (-748.950) (-748.393) -- 0:00:40
      409500 -- (-748.385) [-750.037] (-750.856) (-753.027) * (-749.330) (-751.950) (-749.495) [-748.203] -- 0:00:40
      410000 -- [-749.695] (-749.412) (-755.219) (-749.919) * (-749.718) (-754.568) [-751.709] (-754.970) -- 0:00:40

      Average standard deviation of split frequencies: 0.014653

      410500 -- (-751.364) [-749.705] (-754.082) (-750.377) * [-749.073] (-756.107) (-751.722) (-754.498) -- 0:00:40
      411000 -- (-750.647) (-749.867) (-750.865) [-748.534] * [-748.730] (-750.926) (-748.084) (-748.698) -- 0:00:40
      411500 -- [-749.131] (-752.840) (-749.584) (-750.528) * (-750.177) (-752.274) (-748.532) [-748.767] -- 0:00:40
      412000 -- (-749.799) (-754.132) (-749.463) [-752.011] * (-758.560) [-748.363] (-749.573) (-748.992) -- 0:00:39
      412500 -- (-748.514) [-749.640] (-748.922) (-749.199) * (-752.642) [-750.305] (-751.031) (-750.522) -- 0:00:39
      413000 -- [-748.282] (-748.340) (-750.350) (-752.486) * (-749.516) [-748.391] (-748.814) (-751.866) -- 0:00:39
      413500 -- (-748.501) [-748.249] (-748.961) (-751.194) * [-749.104] (-748.006) (-752.329) (-749.514) -- 0:00:39
      414000 -- (-749.394) (-752.718) [-752.121] (-748.884) * [-751.261] (-753.505) (-759.831) (-753.678) -- 0:00:39
      414500 -- (-749.984) (-749.822) (-750.512) [-750.624] * (-751.310) (-752.110) [-748.438] (-751.815) -- 0:00:40
      415000 -- [-748.103] (-748.098) (-750.271) (-751.135) * (-750.589) [-750.684] (-751.077) (-750.527) -- 0:00:40

      Average standard deviation of split frequencies: 0.014198

      415500 -- (-748.405) (-750.518) [-749.031] (-752.447) * (-750.810) [-749.684] (-748.646) (-750.129) -- 0:00:40
      416000 -- [-748.326] (-750.056) (-753.709) (-749.125) * (-750.784) [-750.495] (-748.766) (-747.863) -- 0:00:40
      416500 -- [-749.966] (-752.764) (-752.746) (-749.288) * (-752.791) (-749.818) (-754.201) [-751.212] -- 0:00:40
      417000 -- [-748.716] (-749.489) (-748.895) (-751.775) * (-748.898) (-749.086) (-751.524) [-749.786] -- 0:00:40
      417500 -- (-749.769) (-750.835) (-750.632) [-751.819] * [-749.237] (-748.935) (-750.939) (-750.623) -- 0:00:40
      418000 -- (-750.585) (-749.389) [-748.689] (-751.211) * [-752.270] (-748.505) (-752.437) (-750.705) -- 0:00:40
      418500 -- (-751.113) [-748.051] (-748.771) (-749.950) * (-749.267) (-750.313) [-750.940] (-749.179) -- 0:00:40
      419000 -- (-749.460) [-751.669] (-751.123) (-753.021) * (-751.934) (-749.598) (-751.204) [-750.358] -- 0:00:40
      419500 -- [-749.562] (-749.505) (-750.741) (-749.627) * [-749.341] (-749.025) (-751.877) (-749.596) -- 0:00:40
      420000 -- (-748.539) (-748.427) [-750.766] (-748.880) * (-747.997) (-750.719) (-752.405) [-749.434] -- 0:00:40

      Average standard deviation of split frequencies: 0.013307

      420500 -- (-748.392) (-748.304) [-751.565] (-750.351) * (-750.187) (-751.130) (-755.335) [-748.439] -- 0:00:39
      421000 -- (-748.577) (-750.624) (-749.963) [-750.823] * [-749.756] (-749.834) (-758.882) (-752.100) -- 0:00:39
      421500 -- (-748.573) [-750.043] (-753.534) (-756.317) * (-752.044) (-748.991) [-753.881] (-753.664) -- 0:00:39
      422000 -- (-750.854) (-755.301) (-751.853) [-748.306] * (-752.296) (-748.567) [-751.038] (-748.464) -- 0:00:39
      422500 -- (-749.675) (-748.890) (-750.739) [-750.388] * (-749.710) [-748.568] (-749.803) (-751.015) -- 0:00:39
      423000 -- [-749.207] (-749.538) (-748.223) (-749.003) * (-753.015) (-749.112) [-750.426] (-751.556) -- 0:00:39
      423500 -- [-748.224] (-748.692) (-749.116) (-749.320) * (-751.868) (-749.485) (-749.995) [-752.229] -- 0:00:39
      424000 -- (-748.670) (-750.993) (-749.737) [-748.664] * (-755.085) (-749.164) (-749.114) [-752.831] -- 0:00:39
      424500 -- (-748.847) (-748.475) [-748.677] (-752.777) * (-748.949) (-748.431) [-748.819] (-753.833) -- 0:00:39
      425000 -- (-748.441) (-748.616) [-748.532] (-751.652) * (-749.701) (-751.428) (-752.441) [-748.531] -- 0:00:39

      Average standard deviation of split frequencies: 0.012795

      425500 -- (-750.111) [-748.326] (-749.465) (-749.869) * (-752.119) [-748.413] (-748.546) (-750.808) -- 0:00:39
      426000 -- (-752.753) [-752.198] (-749.416) (-752.196) * (-749.457) (-748.414) (-750.274) [-750.666] -- 0:00:39
      426500 -- (-750.662) (-751.648) [-748.465] (-755.079) * (-748.522) (-750.708) [-749.166] (-752.043) -- 0:00:38
      427000 -- (-751.827) [-748.314] (-750.570) (-749.492) * (-749.060) [-751.433] (-748.414) (-753.203) -- 0:00:38
      427500 -- (-752.055) [-749.250] (-752.459) (-753.570) * (-748.991) [-750.035] (-749.993) (-749.470) -- 0:00:38
      428000 -- (-749.789) [-755.709] (-750.430) (-754.503) * [-750.303] (-748.803) (-749.442) (-750.618) -- 0:00:38
      428500 -- (-750.495) [-749.433] (-752.760) (-750.954) * (-749.547) (-748.108) [-750.010] (-754.732) -- 0:00:38
      429000 -- [-748.529] (-751.112) (-749.373) (-750.769) * (-750.711) (-751.335) (-750.393) [-748.009] -- 0:00:38
      429500 -- (-749.160) (-751.170) [-751.698] (-749.382) * (-750.555) (-751.267) [-750.060] (-748.506) -- 0:00:38
      430000 -- (-748.528) (-752.437) [-749.537] (-752.770) * (-752.255) (-753.635) (-749.950) [-748.307] -- 0:00:38

      Average standard deviation of split frequencies: 0.013067

      430500 -- (-750.885) (-755.181) (-749.550) [-749.678] * [-748.455] (-751.444) (-748.802) (-753.008) -- 0:00:39
      431000 -- (-750.543) (-752.819) [-749.451] (-750.306) * (-748.779) (-750.032) [-748.707] (-749.750) -- 0:00:39
      431500 -- [-749.074] (-749.214) (-749.424) (-755.665) * (-749.305) [-748.482] (-749.680) (-752.046) -- 0:00:39
      432000 -- (-751.216) (-748.497) [-756.388] (-752.042) * (-750.053) (-750.440) (-750.420) [-752.159] -- 0:00:39
      432500 -- (-750.666) (-750.487) (-751.945) [-749.250] * [-748.588] (-750.292) (-748.502) (-750.678) -- 0:00:39
      433000 -- [-750.049] (-749.200) (-754.378) (-749.001) * (-749.414) (-751.319) [-752.836] (-749.466) -- 0:00:39
      433500 -- (-751.153) (-750.794) (-749.505) [-748.196] * (-749.359) (-749.118) (-751.444) [-750.392] -- 0:00:39
      434000 -- (-749.555) (-748.496) [-749.913] (-749.898) * (-749.152) [-751.900] (-749.922) (-750.428) -- 0:00:39
      434500 -- (-748.440) (-748.725) (-750.209) [-750.351] * [-750.261] (-748.055) (-751.641) (-754.071) -- 0:00:39
      435000 -- [-752.455] (-754.977) (-749.021) (-748.103) * (-748.105) [-748.953] (-752.014) (-750.788) -- 0:00:38

      Average standard deviation of split frequencies: 0.013102

      435500 -- (-756.655) [-752.908] (-750.511) (-752.477) * [-748.739] (-754.241) (-748.596) (-749.570) -- 0:00:38
      436000 -- (-749.288) (-750.860) (-750.105) [-749.781] * [-749.059] (-749.968) (-750.442) (-748.908) -- 0:00:38
      436500 -- (-752.166) [-750.428] (-750.336) (-749.925) * (-748.201) [-749.350] (-750.274) (-750.551) -- 0:00:38
      437000 -- (-750.911) (-750.107) [-748.967] (-748.690) * (-749.931) [-753.301] (-754.112) (-750.314) -- 0:00:38
      437500 -- (-751.567) (-750.471) [-748.694] (-748.943) * (-749.189) (-752.012) [-752.778] (-750.189) -- 0:00:38
      438000 -- (-748.770) [-749.504] (-748.862) (-749.232) * (-750.903) [-749.592] (-751.997) (-751.810) -- 0:00:38
      438500 -- [-748.946] (-748.521) (-750.269) (-750.288) * (-751.143) [-748.545] (-750.480) (-749.642) -- 0:00:38
      439000 -- (-749.100) (-749.020) [-752.372] (-749.720) * (-753.946) (-749.584) [-755.441] (-749.387) -- 0:00:38
      439500 -- [-750.974] (-750.074) (-755.450) (-749.589) * (-750.981) (-748.910) [-750.223] (-749.386) -- 0:00:38
      440000 -- [-749.434] (-751.797) (-753.265) (-748.982) * (-754.633) (-749.618) (-752.864) [-750.851] -- 0:00:38

      Average standard deviation of split frequencies: 0.012711

      440500 -- [-748.132] (-752.401) (-756.326) (-750.260) * [-752.615] (-750.477) (-749.139) (-749.734) -- 0:00:38
      441000 -- (-751.175) (-753.013) [-749.785] (-751.656) * [-751.357] (-751.273) (-751.621) (-748.270) -- 0:00:38
      441500 -- (-749.106) (-748.556) [-748.187] (-749.475) * (-750.719) (-753.709) (-751.476) [-749.773] -- 0:00:37
      442000 -- (-753.118) [-748.377] (-749.104) (-749.497) * (-749.521) (-753.043) (-748.588) [-748.852] -- 0:00:37
      442500 -- (-755.001) (-749.914) (-748.120) [-748.193] * (-750.638) (-750.458) (-749.299) [-749.710] -- 0:00:37
      443000 -- (-749.317) (-751.592) [-753.279] (-748.575) * (-749.419) [-749.979] (-749.126) (-750.389) -- 0:00:37
      443500 -- [-748.872] (-752.118) (-751.080) (-750.817) * (-752.344) [-748.773] (-749.944) (-752.376) -- 0:00:37
      444000 -- (-750.042) (-749.830) (-751.493) [-749.031] * (-750.092) (-748.212) [-748.060] (-751.607) -- 0:00:37
      444500 -- (-748.002) (-752.411) [-749.765] (-749.562) * (-748.799) (-751.973) (-749.989) [-752.776] -- 0:00:37
      445000 -- (-749.270) (-751.758) [-750.592] (-751.310) * (-751.505) [-749.079] (-751.649) (-753.551) -- 0:00:37

      Average standard deviation of split frequencies: 0.012435

      445500 -- (-750.450) (-751.546) [-750.071] (-750.172) * (-751.183) [-749.449] (-750.420) (-754.049) -- 0:00:37
      446000 -- (-749.760) [-749.975] (-751.912) (-750.150) * (-750.748) (-754.258) (-753.493) [-749.992] -- 0:00:37
      446500 -- [-750.827] (-751.524) (-749.786) (-747.917) * (-749.020) (-748.868) [-749.309] (-750.018) -- 0:00:37
      447000 -- [-749.855] (-751.554) (-748.114) (-752.086) * [-748.969] (-747.951) (-751.177) (-748.156) -- 0:00:38
      447500 -- [-748.962] (-750.909) (-750.724) (-753.000) * (-748.469) (-748.738) [-749.513] (-748.585) -- 0:00:38
      448000 -- [-752.389] (-749.787) (-753.232) (-750.618) * [-748.982] (-748.754) (-749.869) (-748.741) -- 0:00:38
      448500 -- (-752.109) [-749.112] (-752.603) (-750.324) * (-751.365) [-755.779] (-748.621) (-755.543) -- 0:00:38
      449000 -- (-750.235) (-749.112) [-750.552] (-748.295) * (-751.100) (-753.387) [-750.223] (-750.127) -- 0:00:38
      449500 -- (-753.105) [-749.694] (-753.114) (-751.956) * [-753.604] (-751.842) (-749.809) (-749.055) -- 0:00:37
      450000 -- [-748.606] (-748.596) (-750.961) (-752.484) * (-751.851) (-751.146) [-749.819] (-749.265) -- 0:00:37

      Average standard deviation of split frequencies: 0.012356

      450500 -- (-748.374) (-750.916) (-751.832) [-749.279] * [-752.909] (-752.801) (-752.776) (-751.170) -- 0:00:37
      451000 -- (-751.091) [-750.106] (-749.866) (-748.640) * (-749.720) (-751.167) (-748.118) [-750.900] -- 0:00:37
      451500 -- (-753.345) [-749.199] (-751.393) (-750.361) * (-748.274) [-752.598] (-748.100) (-749.936) -- 0:00:37
      452000 -- (-749.384) [-748.669] (-753.311) (-749.642) * (-749.649) (-749.192) (-749.844) [-749.364] -- 0:00:37
      452500 -- (-749.875) (-748.243) [-750.558] (-754.587) * (-752.042) [-754.263] (-748.833) (-751.946) -- 0:00:37
      453000 -- [-748.488] (-749.973) (-748.443) (-748.990) * (-752.090) (-756.185) [-748.828] (-749.103) -- 0:00:37
      453500 -- [-748.922] (-749.496) (-749.385) (-751.846) * (-750.527) [-748.973] (-752.876) (-750.918) -- 0:00:37
      454000 -- [-751.468] (-752.041) (-752.867) (-748.288) * [-748.346] (-751.117) (-748.513) (-749.469) -- 0:00:37
      454500 -- (-752.342) (-751.639) (-748.386) [-749.246] * (-749.491) (-751.758) (-748.447) [-750.784] -- 0:00:37
      455000 -- (-751.863) (-751.588) (-748.702) [-751.767] * (-752.398) (-748.155) (-749.910) [-749.518] -- 0:00:37

      Average standard deviation of split frequencies: 0.013051

      455500 -- (-748.096) (-750.784) (-748.598) [-748.648] * (-749.122) (-748.843) [-750.029] (-748.948) -- 0:00:37
      456000 -- [-748.669] (-750.888) (-749.935) (-751.194) * [-749.228] (-748.462) (-749.550) (-750.168) -- 0:00:36
      456500 -- (-750.077) (-751.350) [-749.262] (-751.037) * (-758.272) (-752.024) [-750.524] (-750.048) -- 0:00:36
      457000 -- (-754.565) (-749.177) [-756.783] (-749.349) * [-749.794] (-749.342) (-749.261) (-749.999) -- 0:00:36
      457500 -- (-752.060) (-749.715) (-755.822) [-750.504] * [-748.583] (-750.602) (-751.725) (-748.795) -- 0:00:36
      458000 -- (-749.214) [-748.480] (-750.926) (-749.662) * (-750.293) (-751.073) (-748.734) [-751.429] -- 0:00:36
      458500 -- (-752.035) (-749.670) (-751.348) [-752.626] * (-751.590) (-748.299) [-752.316] (-749.974) -- 0:00:36
      459000 -- (-748.293) (-749.324) (-751.460) [-750.275] * (-751.336) [-749.677] (-750.825) (-748.826) -- 0:00:36
      459500 -- (-753.205) (-751.977) (-755.282) [-748.702] * [-749.020] (-751.620) (-749.660) (-752.144) -- 0:00:36
      460000 -- (-749.162) (-754.652) (-761.202) [-748.672] * (-750.614) (-752.994) (-753.321) [-749.912] -- 0:00:36

      Average standard deviation of split frequencies: 0.013111

      460500 -- (-748.847) (-748.310) [-752.635] (-749.920) * (-750.501) (-755.369) (-752.438) [-748.301] -- 0:00:36
      461000 -- (-752.156) (-750.802) [-751.562] (-751.359) * (-748.828) (-749.955) (-753.440) [-750.051] -- 0:00:36
      461500 -- (-750.154) (-751.165) (-753.058) [-749.933] * [-749.649] (-749.551) (-749.807) (-751.242) -- 0:00:36
      462000 -- (-750.445) [-749.894] (-752.706) (-749.675) * (-755.135) (-749.644) (-749.976) [-751.302] -- 0:00:36
      462500 -- [-751.979] (-751.511) (-751.662) (-748.982) * [-750.721] (-749.941) (-748.467) (-750.319) -- 0:00:36
      463000 -- (-749.776) [-748.835] (-755.377) (-749.917) * (-751.968) (-750.019) (-749.413) [-750.874] -- 0:00:35
      463500 -- (-753.402) (-750.357) (-751.471) [-749.303] * (-755.619) (-748.387) (-749.449) [-748.875] -- 0:00:37
      464000 -- (-751.362) (-748.713) (-749.471) [-751.571] * (-753.910) [-750.456] (-751.693) (-750.603) -- 0:00:36
      464500 -- [-750.023] (-748.756) (-751.820) (-749.956) * (-751.124) (-753.234) [-748.704] (-748.474) -- 0:00:36
      465000 -- [-749.343] (-749.578) (-753.415) (-749.519) * (-748.487) (-752.945) [-748.057] (-751.668) -- 0:00:36

      Average standard deviation of split frequencies: 0.013404

      465500 -- (-750.873) [-749.324] (-750.695) (-752.123) * (-747.987) (-751.012) [-752.112] (-752.591) -- 0:00:36
      466000 -- (-752.397) [-750.246] (-751.130) (-753.993) * (-748.304) [-752.325] (-750.012) (-749.893) -- 0:00:36
      466500 -- (-747.854) [-748.678] (-754.462) (-751.647) * (-749.066) [-748.766] (-750.574) (-749.278) -- 0:00:36
      467000 -- [-749.796] (-750.416) (-751.038) (-750.593) * (-750.230) [-748.603] (-754.639) (-750.226) -- 0:00:36
      467500 -- (-749.542) (-750.655) [-750.574] (-750.721) * (-750.827) (-750.518) (-749.241) [-752.538] -- 0:00:36
      468000 -- (-749.579) (-754.225) (-750.714) [-749.471] * (-750.229) (-749.802) [-750.393] (-753.265) -- 0:00:36
      468500 -- [-749.573] (-752.624) (-750.869) (-748.151) * (-750.209) [-749.945] (-752.577) (-751.767) -- 0:00:36
      469000 -- [-748.666] (-749.869) (-749.331) (-749.362) * (-751.324) (-749.137) [-748.591] (-751.817) -- 0:00:36
      469500 -- (-749.677) (-750.476) [-749.894] (-752.584) * (-752.277) [-749.602] (-749.832) (-751.023) -- 0:00:36
      470000 -- (-749.961) (-748.428) [-753.094] (-751.654) * (-750.383) (-753.388) (-751.922) [-749.897] -- 0:00:36

      Average standard deviation of split frequencies: 0.013396

      470500 -- (-750.812) (-748.707) [-749.475] (-749.292) * (-750.199) (-754.152) [-748.891] (-750.672) -- 0:00:36
      471000 -- (-751.611) (-751.645) [-749.272] (-751.574) * (-749.745) [-749.280] (-754.135) (-749.067) -- 0:00:35
      471500 -- (-752.495) (-748.908) [-749.867] (-749.698) * (-747.924) (-752.565) [-751.925] (-750.114) -- 0:00:35
      472000 -- (-750.916) [-748.400] (-751.499) (-750.680) * (-752.470) [-751.564] (-753.410) (-750.794) -- 0:00:35
      472500 -- (-756.011) (-751.724) (-756.189) [-751.516] * (-750.565) (-748.819) (-753.076) [-748.824] -- 0:00:35
      473000 -- [-750.543] (-750.654) (-752.693) (-752.542) * (-752.550) (-749.907) (-751.913) [-750.952] -- 0:00:35
      473500 -- (-751.831) [-752.155] (-754.438) (-752.319) * (-751.160) (-750.843) (-749.968) [-750.904] -- 0:00:35
      474000 -- (-748.970) (-752.373) (-751.682) [-750.301] * [-750.217] (-755.877) (-749.908) (-749.667) -- 0:00:35
      474500 -- (-753.942) [-748.690] (-750.712) (-748.238) * (-749.093) [-748.743] (-749.853) (-752.250) -- 0:00:35
      475000 -- (-748.675) [-748.419] (-751.133) (-750.138) * [-748.990] (-750.737) (-749.614) (-748.466) -- 0:00:35

      Average standard deviation of split frequencies: 0.013370

      475500 -- (-749.658) (-749.524) (-748.589) [-750.173] * [-753.646] (-750.832) (-750.855) (-750.022) -- 0:00:35
      476000 -- [-751.746] (-749.262) (-750.546) (-757.852) * (-751.957) (-750.983) (-751.448) [-749.381] -- 0:00:35
      476500 -- (-749.251) (-750.798) (-748.767) [-749.802] * (-750.693) (-748.259) (-752.058) [-750.641] -- 0:00:35
      477000 -- (-749.874) (-750.752) [-751.272] (-750.687) * [-748.859] (-750.755) (-749.810) (-749.488) -- 0:00:35
      477500 -- (-749.699) (-751.262) [-749.456] (-749.487) * (-749.996) (-751.752) (-750.397) [-748.971] -- 0:00:35
      478000 -- (-750.141) (-748.546) [-749.397] (-754.628) * [-750.837] (-749.116) (-749.456) (-750.589) -- 0:00:34
      478500 -- (-749.817) (-748.698) [-748.895] (-753.788) * (-749.286) [-748.742] (-748.660) (-748.909) -- 0:00:34
      479000 -- (-749.093) [-749.069] (-749.225) (-748.655) * [-749.257] (-750.741) (-750.443) (-750.504) -- 0:00:34
      479500 -- (-751.173) (-750.312) [-749.257] (-749.808) * (-750.740) (-749.706) (-751.287) [-749.760] -- 0:00:34
      480000 -- (-753.430) (-757.186) (-751.694) [-749.804] * (-751.358) [-748.185] (-752.112) (-751.594) -- 0:00:35

      Average standard deviation of split frequencies: 0.013853

      480500 -- (-750.728) [-753.303] (-749.922) (-750.369) * (-751.655) (-750.574) (-750.974) [-748.981] -- 0:00:35
      481000 -- [-750.786] (-749.345) (-748.025) (-749.621) * (-749.372) [-749.809] (-750.181) (-748.379) -- 0:00:35
      481500 -- (-748.311) (-750.957) (-748.554) [-749.824] * (-747.983) [-750.452] (-752.600) (-750.551) -- 0:00:35
      482000 -- (-752.845) (-749.452) (-748.865) [-750.087] * (-748.026) (-749.586) (-749.164) [-751.278] -- 0:00:35
      482500 -- (-751.273) (-749.078) (-749.259) [-749.974] * [-753.391] (-748.528) (-749.575) (-752.082) -- 0:00:35
      483000 -- (-751.817) (-751.118) [-749.605] (-750.492) * (-753.573) (-753.414) [-752.321] (-753.555) -- 0:00:35
      483500 -- (-751.100) (-750.214) [-749.756] (-749.983) * (-748.498) (-750.278) (-748.813) [-750.241] -- 0:00:35
      484000 -- (-748.006) (-749.612) (-754.916) [-748.842] * (-748.681) (-749.973) [-749.116] (-749.530) -- 0:00:35
      484500 -- (-750.016) [-749.719] (-750.615) (-750.032) * [-750.420] (-751.093) (-749.350) (-748.412) -- 0:00:35
      485000 -- (-752.605) [-749.317] (-749.621) (-747.769) * (-748.608) (-749.691) (-748.892) [-749.762] -- 0:00:35

      Average standard deviation of split frequencies: 0.012610

      485500 -- (-749.873) (-748.938) [-749.175] (-747.769) * (-749.998) [-752.324] (-751.017) (-750.073) -- 0:00:34
      486000 -- (-748.240) [-748.610] (-748.539) (-750.918) * [-748.062] (-751.566) (-754.017) (-750.229) -- 0:00:34
      486500 -- (-748.780) [-749.535] (-749.852) (-749.905) * (-748.386) (-749.567) (-749.223) [-749.565] -- 0:00:34
      487000 -- (-748.438) [-755.682] (-750.115) (-749.024) * (-748.248) [-750.613] (-748.282) (-749.010) -- 0:00:34
      487500 -- [-749.422] (-757.255) (-751.280) (-748.328) * [-751.673] (-750.483) (-749.422) (-752.014) -- 0:00:34
      488000 -- [-749.498] (-750.009) (-749.608) (-751.953) * (-751.773) (-748.682) (-751.108) [-750.995] -- 0:00:34
      488500 -- (-750.006) (-750.953) [-751.818] (-751.936) * (-749.451) (-751.430) (-749.844) [-752.683] -- 0:00:34
      489000 -- (-750.852) (-749.802) (-751.220) [-749.142] * (-748.021) (-749.400) [-750.916] (-754.023) -- 0:00:34
      489500 -- (-749.406) (-752.386) (-751.906) [-749.094] * (-748.989) [-750.522] (-750.302) (-750.008) -- 0:00:34
      490000 -- (-749.348) [-751.721] (-750.261) (-749.800) * [-748.381] (-754.304) (-748.514) (-756.281) -- 0:00:34

      Average standard deviation of split frequencies: 0.012370

      490500 -- (-755.264) (-751.681) [-748.146] (-750.251) * [-748.546] (-752.610) (-751.215) (-751.213) -- 0:00:34
      491000 -- [-750.852] (-750.597) (-748.369) (-750.868) * (-752.342) (-753.036) (-750.155) [-750.207] -- 0:00:34
      491500 -- (-748.680) (-748.814) [-750.603] (-748.605) * (-751.739) (-751.993) [-748.825] (-748.368) -- 0:00:34
      492000 -- [-749.196] (-749.222) (-749.956) (-749.151) * (-750.306) [-748.289] (-748.688) (-751.301) -- 0:00:34
      492500 -- (-752.025) (-749.138) (-749.403) [-748.795] * [-749.589] (-749.516) (-750.815) (-750.429) -- 0:00:34
      493000 -- [-749.125] (-749.220) (-751.087) (-750.907) * (-749.490) [-750.122] (-751.958) (-752.412) -- 0:00:33
      493500 -- (-752.980) [-748.637] (-750.134) (-749.116) * (-750.621) [-751.177] (-752.850) (-751.272) -- 0:00:33
      494000 -- (-751.157) [-750.093] (-748.934) (-748.122) * (-754.293) (-753.083) [-750.192] (-749.552) -- 0:00:33
      494500 -- (-748.781) (-748.901) [-750.530] (-752.665) * (-754.793) [-751.735] (-748.797) (-751.324) -- 0:00:33
      495000 -- (-752.264) [-749.103] (-750.447) (-751.915) * (-757.236) (-750.833) [-750.370] (-751.590) -- 0:00:33

      Average standard deviation of split frequencies: 0.012292

      495500 -- (-748.482) [-750.529] (-748.385) (-754.222) * (-756.227) (-752.192) [-750.673] (-748.758) -- 0:00:33
      496000 -- (-754.738) (-759.111) [-751.498] (-749.173) * (-750.113) (-754.116) [-749.498] (-749.224) -- 0:00:33
      496500 -- [-750.886] (-757.597) (-750.260) (-751.104) * (-749.447) (-750.285) (-749.768) [-750.994] -- 0:00:33
      497000 -- (-751.378) [-755.184] (-749.925) (-751.648) * (-749.452) (-753.074) [-749.773] (-751.310) -- 0:00:34
      497500 -- [-748.752] (-751.293) (-750.636) (-749.285) * (-749.930) (-751.333) [-750.325] (-749.828) -- 0:00:34
      498000 -- [-748.379] (-750.193) (-755.646) (-750.764) * (-751.909) [-751.173] (-750.972) (-754.701) -- 0:00:34
      498500 -- (-748.470) [-748.431] (-748.623) (-752.878) * (-753.602) [-749.131] (-750.335) (-752.985) -- 0:00:34
      499000 -- (-749.481) (-749.467) [-750.663] (-755.544) * [-750.397] (-748.999) (-752.253) (-750.355) -- 0:00:34
      499500 -- (-749.302) [-750.521] (-748.799) (-751.273) * (-752.586) [-752.631] (-752.417) (-750.929) -- 0:00:34
      500000 -- (-749.362) [-753.887] (-748.474) (-752.091) * (-751.970) [-749.127] (-753.044) (-752.355) -- 0:00:34

      Average standard deviation of split frequencies: 0.011946

      500500 -- [-750.885] (-750.319) (-755.732) (-754.443) * (-751.971) [-748.017] (-752.117) (-750.757) -- 0:00:33
      501000 -- (-750.694) [-750.037] (-752.383) (-749.841) * (-750.919) (-750.173) [-751.015] (-750.631) -- 0:00:33
      501500 -- (-749.445) [-748.722] (-750.610) (-749.430) * [-748.190] (-750.588) (-750.635) (-751.214) -- 0:00:33
      502000 -- (-754.477) [-749.709] (-750.591) (-750.302) * (-750.218) (-750.181) [-751.279] (-748.963) -- 0:00:33
      502500 -- (-752.632) (-749.340) [-751.723] (-749.600) * (-751.396) (-749.850) [-751.186] (-748.590) -- 0:00:33
      503000 -- (-751.021) (-749.933) [-749.391] (-752.023) * (-750.182) [-755.216] (-750.382) (-749.072) -- 0:00:33
      503500 -- (-751.156) (-749.477) [-749.265] (-752.842) * [-749.217] (-748.811) (-748.492) (-749.237) -- 0:00:33
      504000 -- (-751.836) (-748.861) [-749.701] (-750.475) * (-749.360) (-748.807) [-753.173] (-748.888) -- 0:00:33
      504500 -- (-751.544) [-749.645] (-751.161) (-748.930) * (-751.247) (-748.745) (-752.004) [-749.304] -- 0:00:33
      505000 -- (-750.269) [-753.377] (-748.061) (-752.072) * (-748.482) [-749.556] (-748.421) (-749.001) -- 0:00:33

      Average standard deviation of split frequencies: 0.012461

      505500 -- [-749.088] (-750.775) (-748.670) (-750.964) * [-750.425] (-750.344) (-749.335) (-753.749) -- 0:00:33
      506000 -- (-748.198) [-749.219] (-748.550) (-751.954) * [-752.491] (-748.855) (-748.681) (-750.592) -- 0:00:33
      506500 -- [-748.291] (-751.010) (-752.675) (-748.649) * (-750.949) (-751.474) [-749.480] (-749.736) -- 0:00:33
      507000 -- (-750.093) [-751.636] (-750.122) (-749.569) * [-749.784] (-750.723) (-748.362) (-750.913) -- 0:00:33
      507500 -- (-750.909) [-754.583] (-754.462) (-750.012) * (-750.397) (-749.639) [-749.585] (-748.650) -- 0:00:32
      508000 -- (-751.737) [-749.160] (-748.804) (-751.910) * (-749.175) (-750.834) (-751.427) [-751.160] -- 0:00:32
      508500 -- (-752.500) [-748.545] (-749.629) (-749.646) * (-749.612) (-749.514) (-760.809) [-749.652] -- 0:00:32
      509000 -- [-750.837] (-752.258) (-748.354) (-751.206) * (-750.566) [-750.394] (-758.702) (-757.140) -- 0:00:32
      509500 -- (-751.381) (-750.112) (-749.870) [-749.884] * (-753.669) (-748.837) [-750.009] (-750.295) -- 0:00:32
      510000 -- (-748.097) [-749.277] (-752.344) (-748.713) * (-750.703) (-753.280) [-752.797] (-750.221) -- 0:00:32

      Average standard deviation of split frequencies: 0.013170

      510500 -- (-750.935) (-752.414) [-750.635] (-749.170) * (-751.383) (-749.298) (-749.487) [-749.808] -- 0:00:32
      511000 -- (-749.648) [-750.222] (-749.117) (-752.030) * (-748.694) [-750.133] (-752.830) (-748.108) -- 0:00:32
      511500 -- [-751.406] (-750.601) (-749.753) (-752.120) * (-748.676) (-754.690) [-749.885] (-749.259) -- 0:00:32
      512000 -- (-749.885) (-752.234) [-750.527] (-750.203) * (-751.332) (-754.956) [-750.284] (-751.727) -- 0:00:32
      512500 -- (-751.226) [-751.234] (-748.299) (-750.161) * (-748.475) (-752.094) [-749.436] (-748.084) -- 0:00:32
      513000 -- (-751.017) (-751.351) [-750.406] (-749.459) * (-748.835) [-749.489] (-748.511) (-750.120) -- 0:00:32
      513500 -- [-750.583] (-748.339) (-748.716) (-750.390) * (-748.469) (-750.414) [-751.864] (-749.846) -- 0:00:33
      514000 -- [-748.942] (-748.482) (-750.195) (-751.355) * (-748.377) (-750.305) (-748.214) [-752.549] -- 0:00:33
      514500 -- (-751.310) [-750.470] (-750.926) (-749.093) * [-750.231] (-749.957) (-748.689) (-749.118) -- 0:00:33
      515000 -- (-750.501) [-748.897] (-750.156) (-748.871) * (-748.820) (-751.272) [-751.684] (-750.569) -- 0:00:32

      Average standard deviation of split frequencies: 0.013155

      515500 -- (-752.047) [-749.442] (-749.434) (-749.839) * [-750.707] (-749.701) (-750.561) (-748.561) -- 0:00:32
      516000 -- (-750.931) (-749.843) (-750.588) [-749.572] * (-748.109) (-751.306) [-749.334] (-750.250) -- 0:00:32
      516500 -- (-748.980) [-751.686] (-752.346) (-748.035) * (-748.343) (-752.962) (-747.978) [-752.433] -- 0:00:32
      517000 -- (-752.474) (-751.093) (-750.970) [-749.004] * [-748.498] (-752.908) (-750.096) (-756.028) -- 0:00:32
      517500 -- (-748.758) (-749.455) (-751.686) [-748.865] * (-752.529) [-753.280] (-750.602) (-756.970) -- 0:00:32
      518000 -- [-748.900] (-753.170) (-752.711) (-750.486) * (-750.804) (-754.095) (-749.061) [-751.156] -- 0:00:32
      518500 -- (-750.059) (-755.499) (-749.215) [-753.395] * (-750.137) (-748.252) [-749.096] (-748.714) -- 0:00:32
      519000 -- (-750.236) [-751.800] (-751.477) (-753.794) * (-748.577) [-750.679] (-759.932) (-748.506) -- 0:00:32
      519500 -- [-749.259] (-751.865) (-751.339) (-749.490) * (-754.882) (-753.642) (-751.030) [-749.320] -- 0:00:32
      520000 -- (-752.437) (-751.537) [-750.076] (-748.695) * [-750.166] (-749.012) (-750.674) (-749.354) -- 0:00:32

      Average standard deviation of split frequencies: 0.013339

      520500 -- [-749.125] (-750.107) (-748.689) (-752.712) * (-749.405) (-751.861) (-754.755) [-749.095] -- 0:00:32
      521000 -- (-749.578) [-748.523] (-755.153) (-751.581) * [-757.329] (-748.839) (-749.257) (-748.604) -- 0:00:32
      521500 -- [-747.835] (-751.687) (-753.829) (-749.829) * (-748.556) (-748.091) (-750.840) [-750.293] -- 0:00:32
      522000 -- [-749.970] (-750.612) (-752.118) (-751.977) * [-750.143] (-754.576) (-750.117) (-750.006) -- 0:00:32
      522500 -- [-751.954] (-749.524) (-753.340) (-748.200) * (-757.856) [-751.722] (-749.805) (-751.648) -- 0:00:31
      523000 -- (-752.414) (-748.985) (-750.936) [-751.949] * (-754.130) (-753.407) (-749.428) [-747.927] -- 0:00:31
      523500 -- (-750.910) [-752.843] (-752.184) (-752.065) * (-762.135) [-748.713] (-750.259) (-750.363) -- 0:00:31
      524000 -- (-749.128) (-750.952) [-748.100] (-748.897) * (-748.844) [-750.232] (-748.439) (-751.639) -- 0:00:31
      524500 -- (-749.318) (-751.645) [-748.556] (-752.027) * (-748.440) [-749.067] (-749.159) (-753.150) -- 0:00:31
      525000 -- [-751.157] (-750.561) (-751.687) (-750.447) * (-748.767) (-751.511) (-750.545) [-756.293] -- 0:00:31

      Average standard deviation of split frequencies: 0.013025

      525500 -- (-752.031) (-749.717) (-749.238) [-752.490] * (-749.840) (-752.210) [-748.343] (-748.996) -- 0:00:31
      526000 -- (-751.327) (-748.725) (-749.250) [-751.501] * [-748.750] (-752.016) (-748.608) (-751.066) -- 0:00:31
      526500 -- [-748.911] (-751.510) (-750.456) (-751.988) * [-749.132] (-748.573) (-749.906) (-748.957) -- 0:00:31
      527000 -- [-748.717] (-750.509) (-750.652) (-753.517) * (-752.091) [-751.737] (-748.107) (-753.091) -- 0:00:31
      527500 -- (-752.401) [-748.497] (-750.925) (-754.326) * (-751.437) (-753.485) [-748.150] (-749.168) -- 0:00:31
      528000 -- (-750.904) (-750.902) [-748.845] (-753.326) * (-753.331) (-752.546) (-749.394) [-748.641] -- 0:00:31
      528500 -- (-752.268) (-750.536) [-748.702] (-753.342) * (-749.685) (-750.656) [-752.927] (-749.652) -- 0:00:31
      529000 -- (-754.197) (-752.357) [-751.905] (-751.568) * [-748.851] (-751.929) (-749.960) (-756.864) -- 0:00:31
      529500 -- (-748.212) (-749.351) [-750.759] (-756.214) * [-749.693] (-752.671) (-748.787) (-750.043) -- 0:00:31
      530000 -- [-748.887] (-749.240) (-753.793) (-749.510) * [-750.905] (-751.122) (-750.170) (-748.656) -- 0:00:31

      Average standard deviation of split frequencies: 0.012910

      530500 -- (-750.796) (-748.468) [-749.455] (-750.127) * (-749.085) (-749.872) (-754.358) [-749.249] -- 0:00:31
      531000 -- (-749.388) (-749.598) (-749.577) [-754.551] * (-749.535) (-752.318) (-748.380) [-749.408] -- 0:00:31
      531500 -- (-749.866) (-752.638) [-751.693] (-750.244) * (-750.505) (-751.393) (-748.040) [-748.467] -- 0:00:31
      532000 -- (-749.148) [-750.208] (-753.091) (-752.660) * [-751.419] (-749.886) (-755.815) (-751.510) -- 0:00:31
      532500 -- [-751.005] (-754.179) (-749.108) (-751.509) * [-748.057] (-749.064) (-751.123) (-749.144) -- 0:00:31
      533000 -- (-749.452) (-748.683) [-749.150] (-749.311) * [-750.993] (-751.177) (-749.893) (-749.663) -- 0:00:31
      533500 -- (-755.645) (-749.721) (-748.461) [-751.081] * (-750.551) (-749.075) (-748.021) [-750.326] -- 0:00:31
      534000 -- [-748.943] (-751.098) (-750.193) (-749.994) * (-752.898) (-753.585) [-749.953] (-750.820) -- 0:00:31
      534500 -- (-754.007) [-751.694] (-748.492) (-749.367) * (-748.277) (-753.113) (-750.469) [-750.603] -- 0:00:31
      535000 -- [-751.086] (-752.577) (-747.976) (-749.495) * (-751.813) (-751.796) (-751.530) [-749.160] -- 0:00:31

      Average standard deviation of split frequencies: 0.012899

      535500 -- [-750.393] (-750.876) (-760.688) (-748.117) * [-749.535] (-752.489) (-749.589) (-748.534) -- 0:00:31
      536000 -- (-748.730) (-749.535) (-751.614) [-750.962] * (-749.393) [-748.599] (-750.446) (-751.137) -- 0:00:31
      536500 -- (-750.964) (-752.050) [-748.487] (-748.956) * (-751.166) (-754.337) [-750.599] (-750.855) -- 0:00:31
      537000 -- [-750.811] (-749.826) (-752.442) (-749.988) * (-750.252) (-749.672) (-751.076) [-750.389] -- 0:00:31
      537500 -- [-750.326] (-750.448) (-748.660) (-752.942) * (-759.412) (-754.890) [-748.426] (-748.525) -- 0:00:30
      538000 -- (-752.270) (-753.274) (-752.140) [-749.834] * (-761.002) [-749.093] (-748.476) (-751.433) -- 0:00:30
      538500 -- (-751.621) (-748.485) (-750.178) [-752.438] * [-749.781] (-750.744) (-751.327) (-750.027) -- 0:00:30
      539000 -- (-749.034) (-750.036) (-749.220) [-754.175] * (-752.373) (-748.917) [-748.602] (-749.911) -- 0:00:30
      539500 -- (-748.896) [-749.592] (-749.451) (-749.768) * (-749.724) (-748.901) [-749.166] (-752.354) -- 0:00:30
      540000 -- (-749.476) [-748.240] (-749.890) (-748.861) * (-752.060) (-748.312) [-749.345] (-750.170) -- 0:00:30

      Average standard deviation of split frequencies: 0.012730

      540500 -- (-748.941) [-751.792] (-748.425) (-749.272) * (-749.595) (-748.299) (-750.658) [-749.923] -- 0:00:30
      541000 -- (-750.101) (-748.884) (-748.532) [-749.847] * (-750.098) (-748.864) (-752.184) [-749.129] -- 0:00:30
      541500 -- [-747.832] (-751.016) (-753.314) (-748.321) * (-749.641) [-752.478] (-753.946) (-751.691) -- 0:00:30
      542000 -- (-749.430) (-758.246) (-750.927) [-748.431] * [-750.632] (-750.044) (-749.775) (-748.517) -- 0:00:30
      542500 -- (-750.542) (-750.135) [-749.830] (-749.329) * (-750.353) [-749.096] (-750.623) (-748.104) -- 0:00:30
      543000 -- (-749.049) [-748.594] (-753.329) (-748.845) * (-752.097) (-750.029) (-749.656) [-756.131] -- 0:00:30
      543500 -- (-748.988) [-748.891] (-751.451) (-750.812) * [-752.529] (-749.645) (-748.382) (-750.784) -- 0:00:30
      544000 -- [-748.439] (-755.451) (-753.076) (-750.225) * (-750.257) (-752.815) (-749.733) [-752.114] -- 0:00:30
      544500 -- [-754.181] (-753.153) (-749.880) (-749.243) * [-750.850] (-750.162) (-748.699) (-751.186) -- 0:00:30
      545000 -- [-750.264] (-754.816) (-755.526) (-749.781) * [-757.283] (-753.336) (-749.221) (-752.744) -- 0:00:30

      Average standard deviation of split frequencies: 0.012548

      545500 -- (-749.785) [-752.999] (-750.526) (-749.633) * (-755.811) (-750.481) [-751.239] (-755.142) -- 0:00:29
      546000 -- [-749.379] (-749.895) (-749.943) (-750.523) * (-748.712) [-749.581] (-752.155) (-750.560) -- 0:00:29
      546500 -- (-750.596) (-749.854) [-749.714] (-749.773) * (-752.658) [-749.917] (-750.601) (-753.706) -- 0:00:30
      547000 -- [-751.004] (-748.657) (-750.615) (-749.044) * [-752.719] (-749.384) (-749.428) (-749.174) -- 0:00:30
      547500 -- [-749.580] (-749.288) (-749.441) (-748.890) * (-756.700) (-751.757) [-749.091] (-749.600) -- 0:00:30
      548000 -- (-749.106) [-749.237] (-752.007) (-749.916) * (-750.711) (-749.794) (-750.279) [-751.456] -- 0:00:30
      548500 -- (-748.728) (-748.806) (-754.676) [-749.148] * (-750.776) [-750.219] (-751.305) (-749.840) -- 0:00:30
      549000 -- (-752.677) (-751.082) [-755.915] (-748.951) * (-747.959) (-753.581) (-750.314) [-749.080] -- 0:00:30
      549500 -- (-749.876) (-751.393) [-753.738] (-755.914) * (-749.667) (-749.806) (-750.100) [-750.445] -- 0:00:30
      550000 -- (-750.325) (-753.562) (-750.769) [-750.246] * (-749.842) (-755.633) [-749.037] (-751.893) -- 0:00:30

      Average standard deviation of split frequencies: 0.012156

      550500 -- (-757.010) (-748.808) [-754.146] (-750.331) * (-748.673) (-751.182) (-747.975) [-748.981] -- 0:00:30
      551000 -- (-749.156) (-750.867) [-751.659] (-748.167) * (-750.243) [-751.064] (-748.322) (-748.757) -- 0:00:30
      551500 -- (-751.148) (-750.371) [-751.251] (-748.491) * [-752.088] (-751.126) (-748.236) (-755.862) -- 0:00:30
      552000 -- (-749.889) (-750.521) [-749.795] (-751.459) * (-750.003) (-749.929) [-748.144] (-751.794) -- 0:00:30
      552500 -- (-747.950) [-748.509] (-752.773) (-752.698) * (-750.958) [-750.125] (-749.361) (-750.097) -- 0:00:29
      553000 -- (-748.467) [-748.877] (-749.079) (-752.930) * (-747.853) (-750.899) (-749.348) [-748.805] -- 0:00:29
      553500 -- (-751.634) (-752.653) (-752.067) [-752.433] * (-749.686) (-750.673) (-748.977) [-749.322] -- 0:00:29
      554000 -- (-748.041) (-751.337) [-750.373] (-751.192) * (-750.194) (-750.906) (-752.491) [-749.275] -- 0:00:29
      554500 -- (-755.491) (-753.228) (-749.299) [-749.508] * [-749.616] (-749.801) (-749.156) (-751.857) -- 0:00:29
      555000 -- (-750.432) (-752.852) [-749.276] (-750.098) * (-749.729) (-750.578) (-748.778) [-750.168] -- 0:00:29

      Average standard deviation of split frequencies: 0.012266

      555500 -- (-748.951) [-749.978] (-750.033) (-750.458) * (-748.598) (-754.822) (-750.209) [-749.192] -- 0:00:29
      556000 -- (-748.365) (-751.565) [-752.915] (-751.061) * (-750.760) (-753.599) (-751.458) [-751.680] -- 0:00:29
      556500 -- (-749.776) [-751.241] (-750.140) (-750.078) * (-750.058) (-749.855) [-749.562] (-749.263) -- 0:00:29
      557000 -- (-749.024) (-748.719) (-749.023) [-749.513] * [-749.071] (-749.241) (-749.051) (-752.267) -- 0:00:29
      557500 -- [-750.192] (-748.618) (-748.685) (-751.248) * [-748.397] (-749.782) (-748.128) (-749.958) -- 0:00:29
      558000 -- [-748.251] (-750.542) (-750.697) (-751.586) * (-750.972) (-749.301) (-750.130) [-750.534] -- 0:00:29
      558500 -- [-748.285] (-751.247) (-749.728) (-748.050) * (-750.287) (-751.786) (-748.717) [-750.588] -- 0:00:29
      559000 -- (-748.282) (-750.116) [-748.855] (-751.171) * (-749.049) (-749.048) (-749.379) [-749.938] -- 0:00:29
      559500 -- (-750.177) [-748.187] (-748.800) (-752.813) * (-749.312) (-754.114) [-748.385] (-750.572) -- 0:00:29
      560000 -- (-750.211) (-747.726) (-757.834) [-750.884] * (-751.765) [-750.151] (-750.815) (-750.343) -- 0:00:29

      Average standard deviation of split frequencies: 0.011715

      560500 -- (-751.256) [-748.538] (-748.427) (-750.507) * (-750.253) [-751.066] (-753.883) (-749.314) -- 0:00:29
      561000 -- (-749.246) (-751.316) (-752.388) [-750.288] * (-751.081) (-750.405) (-753.717) [-750.661] -- 0:00:28
      561500 -- [-749.373] (-749.646) (-751.165) (-749.333) * (-751.497) (-749.357) [-752.144] (-750.072) -- 0:00:28
      562000 -- (-754.967) (-749.698) [-751.389] (-750.434) * [-753.748] (-750.136) (-748.973) (-751.005) -- 0:00:28
      562500 -- (-750.851) (-751.311) [-751.171] (-749.546) * [-749.557] (-750.188) (-751.281) (-751.448) -- 0:00:28
      563000 -- [-749.579] (-752.784) (-750.793) (-750.159) * (-749.758) (-750.693) [-750.320] (-752.386) -- 0:00:28
      563500 -- (-749.585) (-750.434) [-749.996] (-750.153) * (-751.942) [-750.733] (-753.462) (-749.330) -- 0:00:29
      564000 -- (-749.098) (-749.200) (-749.230) [-749.836] * [-752.771] (-748.408) (-754.042) (-748.385) -- 0:00:29
      564500 -- (-749.321) (-749.594) [-752.159] (-752.209) * (-751.081) (-750.009) (-751.467) [-751.394] -- 0:00:29
      565000 -- [-750.994] (-751.124) (-752.687) (-753.569) * (-750.576) (-757.850) [-750.187] (-750.034) -- 0:00:29

      Average standard deviation of split frequencies: 0.011660

      565500 -- [-751.405] (-749.554) (-753.421) (-749.915) * (-750.086) [-748.363] (-750.158) (-752.531) -- 0:00:29
      566000 -- (-748.654) (-748.248) (-749.930) [-750.063] * (-749.759) (-749.124) [-749.395] (-750.617) -- 0:00:29
      566500 -- [-749.304] (-748.476) (-755.685) (-750.049) * [-752.397] (-748.197) (-748.314) (-749.387) -- 0:00:29
      567000 -- (-749.483) (-750.592) [-749.176] (-749.652) * [-751.914] (-752.008) (-749.059) (-748.933) -- 0:00:29
      567500 -- (-751.244) (-751.202) (-748.058) [-750.821] * (-751.476) [-749.491] (-749.889) (-752.041) -- 0:00:28
      568000 -- (-752.075) [-748.555] (-749.057) (-749.206) * [-748.909] (-748.929) (-748.238) (-751.464) -- 0:00:28
      568500 -- (-750.405) (-748.872) (-748.800) [-748.800] * [-748.386] (-758.305) (-749.789) (-754.854) -- 0:00:28
      569000 -- (-749.212) (-750.080) (-749.166) [-750.450] * (-749.333) (-749.163) [-753.239] (-752.753) -- 0:00:28
      569500 -- [-749.088] (-751.525) (-750.443) (-751.273) * (-751.635) (-749.893) (-751.723) [-751.154] -- 0:00:28
      570000 -- (-752.777) (-752.502) [-750.526] (-753.228) * [-749.388] (-749.896) (-749.690) (-750.704) -- 0:00:28

      Average standard deviation of split frequencies: 0.010794

      570500 -- (-749.944) [-749.715] (-750.786) (-752.058) * (-749.928) (-749.063) (-750.804) [-750.915] -- 0:00:28
      571000 -- (-749.075) [-749.647] (-750.763) (-751.966) * (-755.395) (-752.877) [-749.764] (-750.822) -- 0:00:28
      571500 -- (-750.365) (-749.353) [-749.867] (-753.018) * (-753.552) (-751.066) (-750.080) [-750.259] -- 0:00:28
      572000 -- (-748.341) (-756.342) (-749.514) [-750.532] * (-753.395) [-748.904] (-754.261) (-749.110) -- 0:00:28
      572500 -- (-749.454) [-751.464] (-750.632) (-750.161) * (-749.652) (-749.454) (-752.631) [-748.714] -- 0:00:28
      573000 -- (-750.639) (-750.527) (-751.516) [-749.968] * [-752.233] (-752.842) (-754.439) (-748.471) -- 0:00:28
      573500 -- (-758.717) (-749.582) (-750.266) [-750.695] * (-752.337) [-751.675] (-749.278) (-752.258) -- 0:00:28
      574000 -- (-759.332) (-752.037) [-750.632] (-748.620) * (-751.187) [-750.228] (-755.956) (-751.026) -- 0:00:28
      574500 -- (-750.509) (-749.351) (-753.794) [-750.648] * [-748.934] (-752.781) (-751.551) (-752.060) -- 0:00:28
      575000 -- [-750.054] (-748.715) (-750.781) (-750.890) * (-751.820) [-748.770] (-753.397) (-749.070) -- 0:00:28

      Average standard deviation of split frequencies: 0.011021

      575500 -- (-748.836) (-750.556) [-752.355] (-751.824) * (-753.843) (-749.402) [-749.625] (-753.237) -- 0:00:28
      576000 -- (-748.238) [-751.333] (-751.682) (-750.860) * (-755.859) (-750.156) (-749.433) [-751.485] -- 0:00:27
      576500 -- [-751.118] (-748.141) (-757.623) (-751.222) * [-751.556] (-751.480) (-749.761) (-749.064) -- 0:00:27
      577000 -- (-748.860) [-748.325] (-756.694) (-751.681) * (-750.986) (-747.938) [-749.499] (-749.144) -- 0:00:27
      577500 -- (-750.669) [-748.666] (-752.677) (-750.473) * [-748.768] (-750.906) (-748.687) (-751.672) -- 0:00:27
      578000 -- (-751.046) (-751.379) (-749.935) [-752.414] * (-750.252) (-753.031) [-748.264] (-751.449) -- 0:00:27
      578500 -- (-750.858) (-752.266) (-749.961) [-751.100] * [-748.316] (-759.224) (-748.156) (-749.330) -- 0:00:27
      579000 -- (-748.499) (-754.119) [-749.804] (-748.689) * (-750.396) [-750.226] (-752.285) (-749.864) -- 0:00:27
      579500 -- (-748.848) (-753.569) (-748.628) [-748.919] * (-749.740) (-752.716) [-750.908] (-750.763) -- 0:00:27
      580000 -- (-748.348) (-755.651) (-749.866) [-748.365] * [-750.723] (-748.758) (-749.469) (-749.772) -- 0:00:28

      Average standard deviation of split frequencies: 0.011257

      580500 -- [-756.019] (-751.646) (-749.038) (-751.444) * (-751.633) [-751.170] (-751.198) (-750.855) -- 0:00:28
      581000 -- (-748.348) (-751.062) [-753.736] (-753.964) * (-751.826) [-749.293] (-750.554) (-750.040) -- 0:00:28
      581500 -- (-749.080) (-751.363) [-750.858] (-748.740) * (-753.704) (-751.840) [-750.140] (-749.365) -- 0:00:28
      582000 -- [-750.223] (-749.737) (-752.962) (-750.892) * (-751.174) (-750.276) (-748.724) [-752.221] -- 0:00:28
      582500 -- (-750.678) (-750.381) (-751.722) [-751.408] * (-751.365) [-748.728] (-749.290) (-749.494) -- 0:00:27
      583000 -- (-750.746) (-751.144) (-752.399) [-748.795] * [-751.462] (-750.326) (-756.934) (-751.374) -- 0:00:27
      583500 -- (-753.295) [-748.107] (-750.104) (-750.393) * (-750.250) (-749.002) (-750.718) [-749.040] -- 0:00:27
      584000 -- [-750.015] (-748.662) (-750.603) (-754.636) * [-754.536] (-751.675) (-751.872) (-750.321) -- 0:00:27
      584500 -- (-751.313) (-749.015) [-752.171] (-749.189) * [-749.725] (-751.267) (-750.915) (-748.996) -- 0:00:27
      585000 -- (-751.202) (-748.547) [-751.504] (-751.305) * (-749.981) (-751.466) [-750.041] (-748.926) -- 0:00:27

      Average standard deviation of split frequencies: 0.011423

      585500 -- (-754.583) (-754.078) [-749.605] (-753.357) * (-748.401) (-748.400) [-752.060] (-751.608) -- 0:00:27
      586000 -- (-753.366) (-750.985) (-748.711) [-750.803] * (-749.839) [-749.794] (-752.063) (-749.840) -- 0:00:27
      586500 -- (-750.049) [-750.392] (-749.973) (-748.834) * (-748.747) [-749.655] (-754.010) (-749.558) -- 0:00:27
      587000 -- (-750.525) [-749.419] (-752.274) (-751.929) * (-749.885) [-752.393] (-750.081) (-749.866) -- 0:00:27
      587500 -- (-748.695) (-752.190) [-752.017] (-749.268) * (-752.113) (-749.890) (-749.921) [-748.373] -- 0:00:27
      588000 -- [-754.336] (-748.625) (-751.507) (-751.608) * (-755.509) [-749.906] (-749.906) (-748.948) -- 0:00:27
      588500 -- (-748.855) (-748.852) (-749.827) [-751.924] * (-749.984) (-750.251) [-748.457] (-752.502) -- 0:00:27
      589000 -- (-750.577) (-751.765) (-750.830) [-751.459] * (-749.756) [-750.645] (-748.883) (-751.911) -- 0:00:27
      589500 -- (-749.163) (-752.696) (-749.678) [-749.420] * [-748.191] (-748.460) (-748.875) (-751.395) -- 0:00:27
      590000 -- (-750.809) (-753.679) (-752.455) [-747.779] * [-748.061] (-748.716) (-747.741) (-748.738) -- 0:00:27

      Average standard deviation of split frequencies: 0.011386

      590500 -- (-749.440) (-749.821) (-748.586) [-747.751] * (-748.399) (-750.344) (-752.193) [-751.442] -- 0:00:27
      591000 -- (-753.152) (-749.446) (-753.425) [-748.362] * [-747.949] (-755.759) (-750.503) (-750.572) -- 0:00:26
      591500 -- (-751.810) (-748.912) [-751.358] (-748.187) * (-752.078) (-750.645) (-750.550) [-747.960] -- 0:00:26
      592000 -- (-753.394) (-752.824) (-749.928) [-749.757] * (-748.275) (-752.328) (-749.278) [-749.539] -- 0:00:26
      592500 -- [-749.206] (-750.316) (-750.428) (-749.419) * [-751.185] (-754.884) (-749.341) (-753.191) -- 0:00:26
      593000 -- (-749.277) [-752.532] (-748.409) (-750.263) * (-751.583) (-750.541) [-751.164] (-752.607) -- 0:00:26
      593500 -- (-753.525) (-749.618) (-750.386) [-748.304] * (-751.122) (-752.087) (-750.424) [-750.732] -- 0:00:26
      594000 -- [-749.669] (-748.223) (-749.552) (-750.624) * (-752.264) (-750.579) [-751.456] (-750.137) -- 0:00:26
      594500 -- [-750.599] (-750.955) (-749.777) (-755.301) * (-754.751) (-750.657) [-750.214] (-753.294) -- 0:00:26
      595000 -- (-750.044) [-749.551] (-748.559) (-748.109) * (-750.089) (-750.962) [-749.478] (-751.439) -- 0:00:26

      Average standard deviation of split frequencies: 0.011548

      595500 -- [-751.669] (-749.594) (-752.780) (-748.699) * (-750.738) [-753.650] (-752.357) (-750.717) -- 0:00:26
      596000 -- (-751.370) [-748.583] (-750.038) (-748.333) * (-752.430) (-748.651) (-753.311) [-748.852] -- 0:00:26
      596500 -- (-749.935) (-751.122) (-751.454) [-748.221] * (-750.499) (-749.459) [-749.201] (-750.901) -- 0:00:26
      597000 -- [-752.241] (-748.227) (-751.468) (-752.808) * [-748.407] (-748.956) (-751.572) (-749.820) -- 0:00:27
      597500 -- (-750.815) [-748.074] (-750.784) (-753.331) * (-751.635) (-749.694) [-750.546] (-750.905) -- 0:00:26
      598000 -- [-749.334] (-749.012) (-748.519) (-752.380) * (-751.509) (-752.302) [-753.669] (-750.680) -- 0:00:26
      598500 -- [-751.183] (-748.182) (-753.991) (-753.342) * [-750.216] (-757.717) (-749.317) (-748.922) -- 0:00:26
      599000 -- (-748.989) (-749.937) [-750.296] (-756.730) * (-748.756) (-751.360) (-752.218) [-752.437] -- 0:00:26
      599500 -- (-749.503) (-749.341) [-751.029] (-754.452) * [-750.042] (-749.206) (-751.027) (-748.534) -- 0:00:26
      600000 -- (-750.066) [-748.135] (-748.345) (-752.302) * (-749.506) (-749.207) [-749.911] (-748.331) -- 0:00:26

      Average standard deviation of split frequencies: 0.011353

      600500 -- (-749.572) (-751.094) (-749.085) [-750.214] * [-750.223] (-750.078) (-752.598) (-748.768) -- 0:00:26
      601000 -- [-750.979] (-749.516) (-750.855) (-749.575) * (-749.520) (-749.458) (-750.982) [-750.359] -- 0:00:26
      601500 -- (-749.083) [-748.058] (-750.635) (-748.426) * (-750.798) (-749.603) (-750.684) [-750.965] -- 0:00:26
      602000 -- [-751.746] (-748.430) (-749.485) (-752.693) * (-749.895) [-752.093] (-749.070) (-751.147) -- 0:00:26
      602500 -- [-748.895] (-749.193) (-749.584) (-749.222) * (-750.938) (-750.461) [-750.156] (-749.225) -- 0:00:26
      603000 -- (-749.031) (-749.617) [-752.685] (-748.713) * (-749.050) (-749.021) (-749.785) [-756.376] -- 0:00:26
      603500 -- (-752.171) (-749.053) [-750.736] (-748.930) * (-748.913) [-749.163] (-752.441) (-750.144) -- 0:00:26
      604000 -- [-754.305] (-752.419) (-750.067) (-749.892) * [-753.456] (-748.355) (-751.352) (-751.038) -- 0:00:26
      604500 -- [-750.802] (-749.038) (-750.194) (-748.961) * (-751.569) (-749.394) (-751.524) [-750.348] -- 0:00:26
      605000 -- (-751.340) (-749.515) (-749.879) [-748.502] * (-755.798) (-748.903) [-751.414] (-752.497) -- 0:00:26

      Average standard deviation of split frequencies: 0.011876

      605500 -- (-749.930) (-750.423) [-752.077] (-749.527) * [-748.445] (-750.329) (-749.765) (-750.971) -- 0:00:26
      606000 -- [-748.484] (-752.159) (-749.389) (-749.884) * (-748.879) [-750.321] (-750.644) (-752.901) -- 0:00:26
      606500 -- (-748.301) (-751.482) [-750.229] (-751.264) * (-749.415) [-753.525] (-753.155) (-749.127) -- 0:00:25
      607000 -- [-751.828] (-751.108) (-749.486) (-750.733) * (-748.646) [-750.104] (-748.690) (-748.210) -- 0:00:25
      607500 -- [-752.660] (-750.022) (-749.076) (-749.689) * (-748.644) (-754.600) (-753.866) [-750.732] -- 0:00:25
      608000 -- (-750.517) (-749.510) [-748.557] (-749.236) * [-750.065] (-750.509) (-752.540) (-756.134) -- 0:00:25
      608500 -- (-749.486) [-751.304] (-748.685) (-751.249) * [-749.480] (-751.530) (-753.672) (-750.153) -- 0:00:25
      609000 -- (-753.168) (-748.472) [-749.435] (-753.396) * (-748.370) (-749.078) (-752.498) [-749.987] -- 0:00:25
      609500 -- [-752.826] (-754.106) (-749.366) (-753.644) * (-748.495) (-749.635) [-749.657] (-749.950) -- 0:00:25
      610000 -- (-749.971) (-749.507) (-748.128) [-750.299] * [-748.173] (-750.995) (-749.171) (-749.944) -- 0:00:25

      Average standard deviation of split frequencies: 0.011682

      610500 -- (-757.011) (-749.212) [-750.906] (-754.226) * [-748.342] (-749.944) (-748.871) (-751.387) -- 0:00:25
      611000 -- (-748.439) (-751.314) [-748.857] (-753.916) * (-752.340) [-751.096] (-752.994) (-754.764) -- 0:00:25
      611500 -- (-749.349) [-749.118] (-749.658) (-748.994) * (-748.608) (-747.752) [-749.466] (-754.794) -- 0:00:25
      612000 -- (-750.398) (-748.804) [-749.660] (-751.801) * [-748.227] (-753.402) (-749.269) (-748.852) -- 0:00:25
      612500 -- (-751.112) (-748.752) (-754.141) [-750.638] * (-748.234) (-750.102) (-751.228) [-750.477] -- 0:00:25
      613000 -- (-750.743) (-748.967) [-750.339] (-752.322) * (-749.798) [-750.038] (-760.476) (-750.234) -- 0:00:25
      613500 -- [-751.023] (-749.910) (-751.684) (-750.532) * (-750.397) [-749.442] (-749.097) (-748.239) -- 0:00:25
      614000 -- (-752.803) [-748.107] (-754.676) (-752.468) * (-749.721) [-755.330] (-748.315) (-749.704) -- 0:00:25
      614500 -- (-749.660) (-749.380) (-749.778) [-749.293] * (-751.898) [-751.831] (-748.581) (-750.348) -- 0:00:25
      615000 -- (-751.262) [-749.032] (-749.979) (-750.964) * [-749.897] (-748.189) (-749.077) (-750.443) -- 0:00:25

      Average standard deviation of split frequencies: 0.011836

      615500 -- (-751.311) (-750.108) (-749.936) [-750.096] * (-749.087) (-748.245) (-750.961) [-749.323] -- 0:00:25
      616000 -- [-749.328] (-751.964) (-749.999) (-753.975) * (-753.685) (-748.344) (-751.527) [-750.618] -- 0:00:25
      616500 -- (-752.452) [-749.169] (-749.629) (-751.638) * (-753.813) (-749.861) [-751.217] (-749.811) -- 0:00:25
      617000 -- (-750.883) (-753.193) (-753.243) [-748.741] * (-749.336) [-750.064] (-749.191) (-752.415) -- 0:00:25
      617500 -- (-752.042) (-755.737) [-748.610] (-750.618) * [-749.257] (-748.955) (-750.988) (-751.766) -- 0:00:25
      618000 -- (-752.678) (-752.336) (-750.812) [-752.913] * (-751.909) (-748.906) (-751.345) [-749.774] -- 0:00:25
      618500 -- [-748.105] (-748.664) (-750.726) (-750.173) * (-751.672) [-748.638] (-749.695) (-751.880) -- 0:00:25
      619000 -- (-750.107) [-751.433] (-749.827) (-749.707) * [-748.257] (-750.232) (-748.982) (-749.786) -- 0:00:25
      619500 -- (-749.640) (-750.220) (-749.616) [-749.217] * (-749.351) [-749.101] (-749.170) (-752.523) -- 0:00:25
      620000 -- (-750.014) (-749.130) (-751.668) [-749.710] * (-748.704) [-749.027] (-749.769) (-757.422) -- 0:00:25

      Average standard deviation of split frequencies: 0.012102

      620500 -- (-749.854) (-749.970) [-751.551] (-751.649) * (-750.067) (-749.625) (-750.872) [-749.263] -- 0:00:25
      621000 -- (-751.910) (-748.280) [-749.893] (-749.627) * (-751.589) (-753.461) (-749.930) [-749.443] -- 0:00:25
      621500 -- (-753.585) (-750.457) (-752.674) [-749.445] * (-750.154) (-749.227) (-750.642) [-748.906] -- 0:00:24
      622000 -- (-751.012) [-751.131] (-752.096) (-750.979) * (-750.050) [-751.187] (-749.193) (-750.536) -- 0:00:24
      622500 -- [-751.699] (-753.274) (-748.832) (-749.358) * [-749.004] (-749.321) (-748.456) (-750.055) -- 0:00:24
      623000 -- (-749.220) [-750.701] (-749.496) (-749.130) * (-749.068) [-749.258] (-751.141) (-750.154) -- 0:00:24
      623500 -- [-750.429] (-750.960) (-749.537) (-750.341) * (-752.578) [-750.618] (-749.834) (-754.850) -- 0:00:24
      624000 -- (-748.624) [-750.044] (-748.863) (-749.082) * (-749.025) [-751.389] (-751.754) (-751.316) -- 0:00:24
      624500 -- (-748.461) (-748.152) (-749.511) [-750.654] * [-748.366] (-750.131) (-750.486) (-758.400) -- 0:00:24
      625000 -- (-751.717) [-748.980] (-755.639) (-750.249) * (-751.281) (-749.645) [-751.275] (-750.177) -- 0:00:24

      Average standard deviation of split frequencies: 0.011898

      625500 -- (-752.502) [-752.184] (-749.155) (-748.757) * [-748.474] (-749.211) (-751.509) (-750.660) -- 0:00:24
      626000 -- (-748.469) (-750.998) [-749.307] (-750.718) * (-748.795) [-748.673] (-748.673) (-748.885) -- 0:00:24
      626500 -- [-749.050] (-749.855) (-748.457) (-753.376) * [-751.415] (-750.454) (-752.302) (-749.374) -- 0:00:24
      627000 -- (-751.184) (-751.331) [-749.778] (-752.645) * [-750.581] (-749.599) (-749.396) (-751.340) -- 0:00:24
      627500 -- (-748.247) (-748.928) [-749.743] (-750.201) * (-752.231) (-751.730) [-751.235] (-749.208) -- 0:00:24
      628000 -- (-749.831) (-749.983) (-749.773) [-748.715] * (-749.349) [-749.356] (-749.055) (-751.518) -- 0:00:24
      628500 -- (-748.728) [-749.171] (-751.014) (-749.642) * (-748.608) [-750.075] (-752.108) (-758.466) -- 0:00:24
      629000 -- [-749.649] (-751.725) (-751.397) (-750.747) * [-749.500] (-750.964) (-750.215) (-753.085) -- 0:00:24
      629500 -- [-747.923] (-749.431) (-748.349) (-750.797) * (-750.561) [-749.377] (-749.946) (-753.072) -- 0:00:24
      630000 -- (-748.190) [-749.565] (-747.957) (-749.936) * (-753.759) (-757.085) (-749.883) [-749.331] -- 0:00:24

      Average standard deviation of split frequencies: 0.012159

      630500 -- (-749.269) (-752.930) [-748.729] (-751.792) * (-752.362) [-752.172] (-749.081) (-751.661) -- 0:00:24
      631000 -- (-748.948) (-750.642) [-750.829] (-749.012) * (-752.627) (-748.869) (-750.155) [-748.628] -- 0:00:24
      631500 -- [-748.549] (-750.094) (-753.408) (-750.001) * (-749.881) (-748.565) [-749.608] (-748.568) -- 0:00:24
      632000 -- (-752.350) (-749.214) (-753.796) [-748.337] * [-749.808] (-748.610) (-752.112) (-749.738) -- 0:00:24
      632500 -- (-750.045) (-751.983) (-750.910) [-752.425] * [-752.257] (-748.159) (-750.105) (-750.596) -- 0:00:24
      633000 -- (-750.371) (-756.774) [-749.596] (-749.016) * (-750.038) [-747.755] (-753.689) (-749.456) -- 0:00:24
      633500 -- (-751.827) (-749.569) [-747.866] (-751.414) * (-750.234) (-752.017) (-751.125) [-748.335] -- 0:00:24
      634000 -- (-753.048) (-752.588) (-749.250) [-753.818] * [-749.779] (-749.550) (-752.478) (-749.475) -- 0:00:24
      634500 -- (-753.719) [-751.353] (-750.571) (-755.312) * (-751.564) [-749.093] (-751.901) (-752.950) -- 0:00:24
      635000 -- [-749.341] (-750.790) (-751.321) (-753.576) * (-750.049) (-750.238) (-748.673) [-753.267] -- 0:00:24

      Average standard deviation of split frequencies: 0.011513

      635500 -- (-748.841) (-751.246) [-749.252] (-750.488) * [-750.078] (-750.624) (-750.162) (-752.559) -- 0:00:24
      636000 -- [-748.768] (-750.634) (-752.511) (-750.046) * [-751.477] (-749.683) (-749.182) (-752.026) -- 0:00:24
      636500 -- (-748.495) [-749.567] (-749.267) (-751.672) * (-753.260) [-748.826] (-752.825) (-750.764) -- 0:00:23
      637000 -- [-748.686] (-750.862) (-749.937) (-752.920) * (-750.317) [-750.937] (-759.048) (-748.976) -- 0:00:23
      637500 -- (-751.484) (-750.570) (-749.565) [-751.132] * [-748.983] (-750.004) (-752.780) (-749.715) -- 0:00:23
      638000 -- (-749.637) (-752.686) [-750.825] (-748.900) * (-749.288) (-749.341) [-751.085] (-754.168) -- 0:00:23
      638500 -- [-749.617] (-750.534) (-751.409) (-752.427) * (-749.968) [-749.332] (-749.573) (-754.604) -- 0:00:23
      639000 -- [-750.296] (-749.758) (-751.499) (-750.176) * [-749.190] (-748.210) (-750.360) (-749.461) -- 0:00:23
      639500 -- (-748.040) [-752.645] (-751.879) (-749.523) * (-751.211) [-747.891] (-748.462) (-749.264) -- 0:00:23
      640000 -- (-749.900) (-751.806) [-749.411] (-752.624) * [-749.582] (-750.141) (-749.387) (-751.020) -- 0:00:23

      Average standard deviation of split frequencies: 0.011822

      640500 -- (-753.572) (-749.332) (-749.434) [-754.210] * (-750.186) (-749.820) (-751.378) [-752.557] -- 0:00:23
      641000 -- (-752.958) (-748.640) (-748.822) [-752.308] * (-756.292) (-750.182) [-750.712] (-752.016) -- 0:00:23
      641500 -- (-752.491) (-752.779) [-755.771] (-751.891) * (-751.673) [-748.116] (-750.338) (-752.726) -- 0:00:23
      642000 -- (-749.188) [-750.728] (-751.588) (-751.858) * (-752.226) [-749.414] (-751.153) (-751.853) -- 0:00:23
      642500 -- (-752.478) [-748.351] (-749.109) (-748.798) * (-751.884) (-749.443) [-752.456] (-751.838) -- 0:00:23
      643000 -- [-750.958] (-751.644) (-750.626) (-748.567) * [-750.040] (-750.561) (-751.187) (-751.315) -- 0:00:23
      643500 -- (-749.087) (-751.120) [-757.821] (-749.595) * (-752.124) (-751.814) (-749.306) [-750.474] -- 0:00:23
      644000 -- [-748.540] (-753.015) (-749.129) (-749.039) * (-751.040) (-751.321) (-749.717) [-751.532] -- 0:00:23
      644500 -- [-749.798] (-751.263) (-749.866) (-750.584) * [-748.966] (-750.167) (-749.963) (-752.250) -- 0:00:23
      645000 -- [-749.568] (-749.688) (-750.895) (-750.874) * (-750.168) (-754.575) (-750.843) [-749.375] -- 0:00:23

      Average standard deviation of split frequencies: 0.011286

      645500 -- [-750.095] (-752.871) (-749.792) (-749.731) * (-752.325) [-748.649] (-751.744) (-748.955) -- 0:00:23
      646000 -- [-751.107] (-754.235) (-751.372) (-749.155) * [-750.070] (-748.875) (-749.716) (-748.468) -- 0:00:23
      646500 -- (-749.534) [-754.820] (-754.107) (-751.836) * (-750.382) [-748.775] (-749.755) (-749.638) -- 0:00:22
      647000 -- (-753.421) (-752.686) [-751.637] (-752.434) * (-753.404) [-749.818] (-750.518) (-751.887) -- 0:00:22
      647500 -- [-757.276] (-752.923) (-754.615) (-749.993) * (-755.613) (-751.529) [-751.828] (-751.793) -- 0:00:23
      648000 -- (-751.344) [-753.870] (-752.495) (-748.589) * (-751.341) (-754.230) (-748.510) [-749.029] -- 0:00:23
      648500 -- (-754.751) (-751.980) [-748.375] (-749.082) * (-750.214) [-748.795] (-750.265) (-750.798) -- 0:00:23
      649000 -- (-752.964) (-753.780) (-749.005) [-748.992] * [-748.380] (-748.235) (-750.318) (-750.932) -- 0:00:23
      649500 -- (-754.480) [-750.796] (-750.111) (-748.546) * [-750.251] (-751.762) (-750.500) (-750.955) -- 0:00:23
      650000 -- (-750.417) [-749.750] (-748.213) (-748.659) * (-749.682) [-748.885] (-751.558) (-750.187) -- 0:00:23

      Average standard deviation of split frequencies: 0.011978

      650500 -- (-753.243) [-750.167] (-748.976) (-749.951) * (-748.508) [-749.508] (-751.692) (-753.018) -- 0:00:23
      651000 -- [-751.057] (-749.853) (-749.372) (-748.958) * (-752.107) (-748.901) (-748.056) [-749.329] -- 0:00:23
      651500 -- [-750.825] (-748.913) (-749.866) (-752.528) * (-748.325) [-751.965] (-751.643) (-750.208) -- 0:00:23
      652000 -- (-751.511) (-747.999) [-751.902] (-748.308) * (-749.849) (-751.358) (-750.992) [-750.772] -- 0:00:22
      652500 -- (-749.736) (-748.371) (-751.288) [-749.707] * (-750.868) (-750.282) (-750.520) [-748.598] -- 0:00:22
      653000 -- (-750.327) [-749.187] (-749.294) (-750.163) * (-754.633) (-748.472) (-749.208) [-754.038] -- 0:00:22
      653500 -- [-748.963] (-752.959) (-749.771) (-750.546) * [-750.264] (-751.031) (-750.020) (-749.966) -- 0:00:22
      654000 -- (-753.164) [-751.705] (-749.665) (-753.750) * (-754.399) (-750.018) [-750.305] (-748.460) -- 0:00:22
      654500 -- (-748.477) (-751.415) [-749.601] (-754.711) * (-754.297) (-750.058) [-749.339] (-754.544) -- 0:00:22
      655000 -- (-752.312) (-754.198) [-749.770] (-752.725) * (-752.145) [-751.056] (-752.751) (-753.855) -- 0:00:22

      Average standard deviation of split frequencies: 0.012552

      655500 -- (-749.386) [-749.541] (-749.434) (-747.984) * (-750.895) (-755.626) [-750.609] (-749.377) -- 0:00:22
      656000 -- (-749.745) (-750.571) [-752.803] (-750.098) * [-750.280] (-752.701) (-751.833) (-750.148) -- 0:00:22
      656500 -- (-751.850) (-750.212) (-754.369) [-748.295] * (-750.850) (-754.781) (-755.825) [-750.151] -- 0:00:22
      657000 -- (-751.787) (-748.827) [-749.903] (-751.596) * (-750.855) (-750.209) (-753.102) [-749.938] -- 0:00:22
      657500 -- [-748.016] (-748.354) (-749.186) (-749.585) * (-749.606) (-751.020) (-749.105) [-751.400] -- 0:00:22
      658000 -- (-748.177) (-748.342) (-748.467) [-748.708] * [-748.954] (-750.625) (-749.918) (-749.816) -- 0:00:22
      658500 -- (-748.345) [-749.032] (-749.430) (-749.259) * (-751.435) (-752.426) (-748.313) [-749.406] -- 0:00:22
      659000 -- (-751.433) (-749.074) [-750.213] (-748.932) * [-749.806] (-755.980) (-748.028) (-748.669) -- 0:00:22
      659500 -- [-750.220] (-748.994) (-749.136) (-752.206) * (-750.146) (-750.134) (-748.415) [-751.033] -- 0:00:22
      660000 -- (-748.351) [-750.123] (-750.473) (-751.969) * (-751.203) (-749.625) [-748.806] (-751.047) -- 0:00:22

      Average standard deviation of split frequencies: 0.012844

      660500 -- [-750.519] (-750.038) (-751.536) (-750.685) * (-750.324) [-751.463] (-749.499) (-752.674) -- 0:00:22
      661000 -- [-748.434] (-751.702) (-753.830) (-752.134) * [-748.912] (-757.051) (-751.287) (-754.830) -- 0:00:22
      661500 -- [-750.254] (-751.640) (-749.054) (-752.802) * (-748.511) [-755.024] (-750.784) (-752.221) -- 0:00:22
      662000 -- (-749.919) (-751.179) (-753.149) [-754.596] * [-751.995] (-753.570) (-750.319) (-751.220) -- 0:00:21
      662500 -- (-749.965) (-750.553) [-748.354] (-749.365) * (-751.166) [-751.005] (-751.361) (-749.747) -- 0:00:21
      663000 -- (-750.881) (-750.622) (-752.072) [-749.349] * (-749.852) (-751.480) [-753.413] (-750.886) -- 0:00:21
      663500 -- (-749.807) (-750.546) (-748.318) [-749.414] * (-751.716) (-751.013) (-754.477) [-754.329] -- 0:00:21
      664000 -- (-749.190) (-753.671) [-749.320] (-751.229) * (-749.874) (-750.333) (-752.164) [-749.764] -- 0:00:22
      664500 -- (-749.883) (-753.645) (-754.305) [-749.460] * [-748.469] (-748.631) (-749.294) (-749.714) -- 0:00:22
      665000 -- [-751.775] (-747.924) (-750.630) (-748.476) * (-749.267) [-751.241] (-750.634) (-751.668) -- 0:00:22

      Average standard deviation of split frequencies: 0.012599

      665500 -- [-749.255] (-748.213) (-748.713) (-751.633) * (-749.633) (-753.047) [-752.244] (-749.610) -- 0:00:22
      666000 -- [-752.089] (-750.211) (-749.065) (-752.810) * [-749.194] (-755.949) (-750.008) (-748.320) -- 0:00:22
      666500 -- (-749.105) [-749.847] (-749.697) (-751.910) * (-753.235) [-749.983] (-748.500) (-751.860) -- 0:00:22
      667000 -- (-749.712) (-748.914) [-751.997] (-751.645) * [-748.556] (-750.070) (-749.304) (-749.662) -- 0:00:21
      667500 -- (-750.972) [-748.736] (-750.732) (-749.051) * [-749.396] (-750.712) (-750.054) (-749.042) -- 0:00:21
      668000 -- (-750.550) (-748.344) [-748.621] (-749.135) * (-751.947) (-749.073) (-750.530) [-748.246] -- 0:00:21
      668500 -- (-750.795) [-748.286] (-748.210) (-751.303) * (-751.540) (-749.289) (-750.561) [-751.677] -- 0:00:21
      669000 -- [-752.953] (-752.569) (-749.958) (-750.215) * [-752.761] (-750.427) (-750.753) (-749.780) -- 0:00:21
      669500 -- (-753.563) (-750.787) [-748.557] (-748.146) * (-750.772) (-754.427) [-750.155] (-749.349) -- 0:00:21
      670000 -- (-751.898) (-751.883) [-748.912] (-754.802) * (-749.835) (-748.844) (-750.588) [-751.038] -- 0:00:21

      Average standard deviation of split frequencies: 0.012558

      670500 -- (-754.548) (-749.903) [-749.801] (-751.413) * (-747.793) [-748.155] (-752.835) (-748.414) -- 0:00:21
      671000 -- (-748.192) [-753.759] (-749.639) (-749.044) * (-748.683) (-749.874) (-750.122) [-748.381] -- 0:00:21
      671500 -- (-748.828) [-749.588] (-749.719) (-748.544) * (-751.906) (-748.801) [-748.337] (-748.687) -- 0:00:21
      672000 -- (-748.168) (-750.632) [-751.369] (-749.548) * (-751.543) [-748.327] (-752.920) (-748.247) -- 0:00:21
      672500 -- (-749.883) [-748.774] (-751.105) (-753.302) * (-752.817) [-748.770] (-749.674) (-751.363) -- 0:00:21
      673000 -- (-753.073) (-752.136) (-750.618) [-750.629] * (-748.869) (-752.143) [-749.914] (-750.198) -- 0:00:21
      673500 -- (-750.271) (-749.297) [-749.947] (-750.576) * (-750.304) (-750.609) (-748.986) [-752.649] -- 0:00:21
      674000 -- (-754.051) (-749.913) [-748.707] (-754.586) * (-752.211) (-749.839) [-751.838] (-749.673) -- 0:00:21
      674500 -- (-749.202) [-749.362] (-749.388) (-751.178) * (-752.248) [-751.929] (-752.825) (-749.715) -- 0:00:21
      675000 -- (-749.421) (-750.229) (-749.927) [-754.618] * (-750.648) (-748.753) (-750.688) [-748.885] -- 0:00:21

      Average standard deviation of split frequencies: 0.012645

      675500 -- (-750.454) [-751.168] (-750.748) (-750.604) * (-749.403) (-750.563) [-750.964] (-750.462) -- 0:00:21
      676000 -- (-748.592) (-751.575) (-749.294) [-749.459] * [-751.619] (-751.059) (-749.937) (-748.733) -- 0:00:21
      676500 -- [-751.002] (-753.176) (-747.958) (-748.954) * (-748.811) (-751.748) (-748.928) [-748.656] -- 0:00:21
      677000 -- (-749.536) (-751.324) (-750.965) [-748.395] * (-751.579) (-749.203) (-749.442) [-748.781] -- 0:00:20
      677500 -- [-749.224] (-753.714) (-752.351) (-749.473) * [-748.921] (-748.863) (-751.718) (-750.442) -- 0:00:20
      678000 -- [-749.047] (-749.585) (-749.447) (-748.231) * (-749.894) [-747.866] (-748.317) (-749.497) -- 0:00:20
      678500 -- [-749.468] (-752.460) (-748.493) (-750.259) * (-750.466) [-749.488] (-749.891) (-749.579) -- 0:00:20
      679000 -- (-751.256) (-751.620) (-748.880) [-748.816] * (-749.056) (-749.019) [-751.663] (-748.113) -- 0:00:20
      679500 -- [-751.655] (-752.046) (-751.246) (-749.318) * (-751.028) (-748.379) [-750.958] (-749.483) -- 0:00:20
      680000 -- [-751.737] (-751.868) (-749.292) (-747.899) * [-749.883] (-750.737) (-749.745) (-749.605) -- 0:00:20

      Average standard deviation of split frequencies: 0.011681

      680500 -- (-750.018) (-752.684) [-748.966] (-748.122) * (-748.117) [-749.516] (-756.284) (-750.537) -- 0:00:21
      681000 -- (-751.558) (-750.821) (-751.757) [-752.462] * (-752.769) [-748.614] (-753.002) (-753.886) -- 0:00:21
      681500 -- [-750.597] (-749.624) (-751.579) (-751.948) * (-749.710) (-750.231) [-749.264] (-752.086) -- 0:00:21
      682000 -- (-749.484) (-752.556) (-748.750) [-750.635] * [-749.175] (-750.387) (-750.605) (-750.943) -- 0:00:20
      682500 -- [-748.217] (-754.523) (-748.642) (-749.175) * (-752.188) (-749.024) [-749.365] (-749.653) -- 0:00:20
      683000 -- (-750.795) (-757.454) (-749.518) [-749.232] * (-748.830) [-749.391] (-751.981) (-750.167) -- 0:00:20
      683500 -- (-753.495) (-753.746) (-750.411) [-751.117] * [-750.748] (-750.835) (-752.191) (-751.747) -- 0:00:20
      684000 -- (-751.434) (-750.559) [-749.474] (-750.626) * (-749.521) [-752.150] (-751.815) (-752.075) -- 0:00:20
      684500 -- [-749.261] (-749.604) (-748.740) (-750.309) * (-750.949) (-749.914) (-751.797) [-749.975] -- 0:00:20
      685000 -- (-750.028) (-748.849) (-750.558) [-750.377] * (-749.882) [-748.241] (-749.795) (-750.656) -- 0:00:20

      Average standard deviation of split frequencies: 0.011590

      685500 -- (-749.993) [-748.005] (-752.967) (-751.258) * (-748.408) (-748.902) [-750.032] (-750.033) -- 0:00:20
      686000 -- (-750.171) (-748.427) (-749.415) [-750.477] * (-750.682) (-751.007) (-752.462) [-753.346] -- 0:00:20
      686500 -- (-749.266) (-749.289) (-748.867) [-755.934] * [-749.963] (-751.110) (-752.699) (-751.549) -- 0:00:20
      687000 -- [-749.326] (-750.458) (-749.149) (-749.502) * (-749.364) [-749.324] (-749.090) (-750.124) -- 0:00:20
      687500 -- [-750.218] (-751.042) (-749.594) (-750.064) * [-751.891] (-750.920) (-748.849) (-752.216) -- 0:00:20
      688000 -- (-749.289) (-748.143) [-748.450] (-750.132) * (-748.449) [-750.485] (-749.519) (-751.276) -- 0:00:20
      688500 -- (-750.087) (-748.143) [-749.705] (-749.798) * (-750.105) [-751.273] (-748.231) (-749.425) -- 0:00:20
      689000 -- [-749.383] (-750.343) (-753.061) (-749.981) * (-749.065) (-749.741) [-749.095] (-748.779) -- 0:00:20
      689500 -- [-749.582] (-750.815) (-748.662) (-749.696) * [-755.680] (-750.810) (-749.919) (-749.285) -- 0:00:20
      690000 -- (-750.495) (-751.739) (-750.824) [-755.918] * (-754.116) [-748.439] (-749.262) (-749.920) -- 0:00:20

      Average standard deviation of split frequencies: 0.011831

      690500 -- (-750.123) (-756.824) (-749.953) [-752.170] * (-754.623) (-749.597) [-750.750] (-750.411) -- 0:00:20
      691000 -- (-751.837) (-749.576) (-748.303) [-756.000] * (-753.631) [-748.327] (-752.848) (-749.290) -- 0:00:20
      691500 -- (-749.341) (-748.853) (-748.563) [-756.021] * (-752.050) (-750.885) (-754.396) [-751.568] -- 0:00:20
      692000 -- [-749.580] (-753.392) (-748.271) (-749.466) * (-753.093) (-753.053) (-752.243) [-749.749] -- 0:00:20
      692500 -- [-750.562] (-750.226) (-750.386) (-749.684) * (-749.669) (-749.380) [-752.685] (-749.861) -- 0:00:19
      693000 -- (-749.229) [-750.860] (-750.081) (-750.112) * (-750.276) (-751.175) [-751.304] (-748.517) -- 0:00:19
      693500 -- (-747.942) (-750.954) [-748.971] (-751.017) * (-751.283) (-748.950) (-752.736) [-749.875] -- 0:00:19
      694000 -- (-753.678) (-748.325) (-749.679) [-749.317] * (-752.507) (-749.843) (-751.708) [-747.885] -- 0:00:19
      694500 -- [-753.021] (-752.400) (-748.380) (-749.087) * (-752.079) (-751.052) (-750.744) [-748.531] -- 0:00:19
      695000 -- (-754.125) (-750.511) [-748.863] (-748.956) * (-750.149) [-750.004] (-749.333) (-755.078) -- 0:00:19

      Average standard deviation of split frequencies: 0.011559

      695500 -- [-748.095] (-751.585) (-748.312) (-750.467) * (-755.508) [-755.510] (-748.212) (-750.275) -- 0:00:19
      696000 -- (-751.785) (-749.891) (-750.654) [-755.709] * (-749.161) [-749.590] (-753.926) (-753.098) -- 0:00:19
      696500 -- (-750.393) (-750.417) (-752.042) [-752.632] * [-748.892] (-751.307) (-752.973) (-748.391) -- 0:00:19
      697000 -- [-751.203] (-750.806) (-751.467) (-750.622) * (-