--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:07:59 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lpqT/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.69 -906.26
2 -902.75 -906.48
--------------------------------------
TOTAL -902.72 -906.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882135 0.089117 0.364375 1.508518 0.849445 1458.10 1472.74 1.000
r(A<->C){all} 0.208231 0.026429 0.000053 0.537697 0.170842 188.40 192.04 1.000
r(A<->G){all} 0.169149 0.018651 0.000064 0.439347 0.135059 174.84 178.03 1.000
r(A<->T){all} 0.151132 0.017970 0.000048 0.437361 0.114661 173.36 247.02 1.000
r(C<->G){all} 0.144970 0.017948 0.000104 0.414087 0.105025 268.61 272.99 1.000
r(C<->T){all} 0.161983 0.019203 0.000072 0.438920 0.122400 164.21 187.56 1.000
r(G<->T){all} 0.164535 0.020419 0.000080 0.457434 0.125515 247.30 252.38 1.000
pi(A){all} 0.242824 0.000291 0.210167 0.276506 0.242917 1249.10 1303.95 1.000
pi(C){all} 0.339865 0.000355 0.305563 0.378812 0.339614 1282.35 1304.37 1.000
pi(G){all} 0.243438 0.000284 0.211305 0.276657 0.243317 846.41 1081.69 1.000
pi(T){all} 0.173873 0.000209 0.144553 0.200758 0.173586 1143.96 1184.80 1.000
alpha{1,2} 0.344940 0.164062 0.000904 1.140021 0.215664 1137.52 1231.86 1.000
alpha{3} 0.424980 0.251453 0.000258 1.469676 0.250020 1147.22 1203.99 1.000
pinvar{all} 0.994903 0.000019 0.986545 0.999866 0.996117 1209.44 1318.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -868.171712
Model 2: PositiveSelection -867.951508
Model 0: one-ratio -867.951496
Model 7: beta -868.193735
Model 8: beta&w>1 -868.173017
Model 0 vs 1 0.44043199999987337
Model 2 vs 1 0.44040799999993396
Model 8 vs 7 0.04143599999997605
>C1
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C2
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C3
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C4
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C5
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARIVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C6
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=218
C1 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C2 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C3 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C4 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C5 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C6 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
**************************************************
C1 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C2 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C3 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C4 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C5 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C6 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
**************************************************
C1 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C2 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C3 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C4 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C5 KSGKYPTARIVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C6 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
*********:****************************************
C1 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C2 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C3 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C4 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C5 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C6 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
**************************************************
C1 AQSNDIEAIIRGFVVAPK
C2 AQSNDIEAIIRGFVVAPK
C3 AQSNDIEAIIRGFVVAPK
C4 AQSNDIEAIIRGFVVAPK
C5 AQSNDIEAIIRGFVVAPK
C6 AQSNDIEAIIRGFVVAPK
******************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 218 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 218 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6540]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6540]--->[6540]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.485 Mb, Max= 30.764 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C2 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C3 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C4 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C5 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
C6 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
**************************************************
C1 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C2 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C3 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C4 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C5 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
C6 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
**************************************************
C1 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C2 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C3 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C4 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C5 KSGKYPTARIVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
C6 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
*********:****************************************
C1 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C2 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C3 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C4 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C5 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
C6 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
**************************************************
C1 AQSNDIEAIIRGFVVAPK
C2 AQSNDIEAIIRGFVVAPK
C3 AQSNDIEAIIRGFVVAPK
C4 AQSNDIEAIIRGFVVAPK
C5 AQSNDIEAIIRGFVVAPK
C6 AQSNDIEAIIRGFVVAPK
******************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 99.54 C1 C5 99.54
TOP 4 0 99.54 C5 C1 99.54
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 99.54 C2 C5 99.54
TOP 4 1 99.54 C5 C2 99.54
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.54 C3 C5 99.54
TOP 4 2 99.54 C5 C3 99.54
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 99.54 C4 C5 99.54
TOP 4 3 99.54 C5 C4 99.54
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 99.54 C5 C6 99.54
TOP 5 4 99.54 C6 C5 99.54
AVG 0 C1 * 99.91
AVG 1 C2 * 99.91
AVG 2 C3 * 99.91
AVG 3 C4 * 99.91
AVG 4 C5 * 99.54
AVG 5 C6 * 99.91
TOT TOT * 99.85
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
C2 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
C3 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
C4 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
C5 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
C6 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
**************************************************
C1 GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
C2 GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
C3 GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
C4 GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
C5 GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
C6 GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
**************************************************
C1 TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
C2 TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
C3 TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
C4 TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
C5 TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
C6 TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
**************************************************
C1 CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
C2 CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
C3 CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
C4 CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
C5 CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
C6 CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
**************************************************
C1 GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
C2 GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
C3 GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
C4 GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
C5 GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
C6 GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
**************************************************
C1 GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
C2 GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
C3 GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
C4 GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
C5 GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
C6 GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
**************************************************
C1 AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
C2 AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
C3 AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
C4 AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
C5 AAAAGCGGCAAGTACCCGACGGCAAGGATCGTAGCGTTCAAGCTGCGCGG
C6 AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
***************************.**********************
C1 AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
C2 AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
C3 AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
C4 AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
C5 AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
C6 AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
**************************************************
C1 TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
C2 TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
C3 TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
C4 TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
C5 TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
C6 TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
**************************************************
C1 TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
C2 TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
C3 TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
C4 TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
C5 TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
C6 TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
**************************************************
C1 ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
C2 ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
C3 ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
C4 ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
C5 ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
C6 ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
**************************************************
C1 AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
C2 AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
C3 AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
C4 AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
C5 AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
C6 AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
**************************************************
C1 GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
C2 GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
C3 GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
C4 GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
C5 GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
C6 GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
**************************************************
C1 CAAG
C2 CAAG
C3 CAAG
C4 CAAG
C5 CAAG
C6 CAAG
****
>C1
ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
CAAG
>C2
ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
CAAG
>C3
ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
CAAG
>C4
ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
CAAG
>C5
ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
AAAAGCGGCAAGTACCCGACGGCAAGGATCGTAGCGTTCAAGCTGCGCGG
AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
CAAG
>C6
ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT
GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA
TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC
CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC
GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT
GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC
AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG
AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC
TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT
TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT
ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC
AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC
GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC
CAAG
>C1
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C2
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C3
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C4
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C5
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARIVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
>C6
MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
AQSNDIEAIIRGFVVAPK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 654 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791988
Setting output file names to "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1532912123
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0807127642
Seed = 1412369378
Swapseed = 1579791988
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1467.084591 -- -24.965149
Chain 2 -- -1467.084591 -- -24.965149
Chain 3 -- -1467.086223 -- -24.965149
Chain 4 -- -1467.086223 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1467.085934 -- -24.965149
Chain 2 -- -1467.086223 -- -24.965149
Chain 3 -- -1467.086223 -- -24.965149
Chain 4 -- -1467.086223 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1467.085] (-1467.085) (-1467.086) (-1467.086) * [-1467.086] (-1467.086) (-1467.086) (-1467.086)
500 -- [-905.735] (-913.711) (-907.121) (-928.515) * (-923.913) (-913.841) (-914.572) [-906.197] -- 0:00:00
1000 -- (-909.767) (-912.837) (-910.936) [-907.948] * (-913.862) [-902.894] (-910.451) (-905.832) -- 0:00:00
1500 -- [-905.650] (-905.677) (-910.179) (-912.298) * [-903.143] (-908.086) (-912.057) (-908.585) -- 0:00:00
2000 -- [-911.416] (-906.365) (-902.881) (-909.358) * (-907.320) [-912.859] (-918.423) (-904.976) -- 0:00:00
2500 -- (-908.647) [-903.951] (-907.338) (-906.614) * (-906.864) (-908.318) (-908.537) [-906.829] -- 0:00:00
3000 -- [-907.959] (-908.651) (-914.384) (-915.103) * (-907.664) [-905.826] (-920.964) (-911.460) -- 0:00:00
3500 -- (-905.816) [-905.883] (-908.293) (-912.253) * (-910.306) (-912.239) (-910.557) [-908.112] -- 0:00:00
4000 -- (-909.167) (-906.711) [-906.151] (-913.300) * (-908.267) (-912.609) [-913.850] (-904.512) -- 0:00:00
4500 -- (-902.369) (-904.801) [-905.975] (-905.228) * (-909.686) (-908.787) [-904.976] (-911.293) -- 0:00:00
5000 -- (-913.455) (-906.151) [-907.740] (-909.235) * [-905.352] (-918.996) (-905.753) (-907.155) -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- [-911.053] (-903.456) (-905.973) (-903.312) * [-902.298] (-903.628) (-915.828) (-908.866) -- 0:00:00
6000 -- (-913.265) (-909.627) (-907.590) [-905.985] * (-903.920) (-901.988) [-903.414] (-911.535) -- 0:00:00
6500 -- (-903.314) (-904.815) (-910.748) [-903.458] * (-912.091) (-906.610) [-914.548] (-912.367) -- 0:00:00
7000 -- (-914.052) (-913.242) (-904.046) [-909.113] * [-906.139] (-903.347) (-916.356) (-923.119) -- 0:00:00
7500 -- (-908.555) (-910.317) (-919.902) [-914.076] * [-904.801] (-904.094) (-911.248) (-907.792) -- 0:00:00
8000 -- [-901.073] (-902.739) (-907.310) (-909.312) * (-904.072) (-903.193) (-911.336) [-919.563] -- 0:00:00
8500 -- [-906.853] (-908.948) (-911.302) (-908.511) * [-901.364] (-904.729) (-910.730) (-908.510) -- 0:00:00
9000 -- (-916.501) (-920.006) (-912.873) [-902.663] * (-907.569) [-903.435] (-910.094) (-908.279) -- 0:00:00
9500 -- (-912.939) (-914.207) [-905.787] (-914.097) * [-914.618] (-903.730) (-906.673) (-917.686) -- 0:00:00
10000 -- [-907.863] (-912.014) (-903.978) (-904.864) * [-906.361] (-906.086) (-912.075) (-912.250) -- 0:00:00
Average standard deviation of split frequencies: 0.075761
10500 -- (-905.450) (-908.344) [-912.072] (-912.535) * (-908.279) [-902.719] (-907.938) (-909.238) -- 0:00:00
11000 -- [-905.440] (-906.522) (-912.244) (-904.920) * [-903.635] (-903.938) (-907.412) (-917.445) -- 0:00:00
11500 -- (-910.067) [-903.216] (-919.873) (-903.519) * [-907.104] (-903.837) (-909.351) (-907.561) -- 0:00:00
12000 -- (-922.160) (-901.437) [-911.869] (-913.802) * (-908.860) (-904.269) (-908.956) [-902.980] -- 0:00:00
12500 -- (-907.284) (-902.997) [-908.899] (-916.893) * (-904.664) (-903.677) [-904.897] (-903.817) -- 0:00:00
13000 -- (-905.659) (-906.779) (-908.458) [-911.547] * (-907.576) (-903.280) [-906.763] (-904.139) -- 0:00:00
13500 -- (-905.822) (-907.512) [-911.343] (-912.189) * [-905.593] (-904.974) (-903.544) (-905.655) -- 0:00:00
14000 -- [-905.605] (-906.377) (-911.619) (-904.852) * [-903.226] (-905.438) (-905.668) (-903.676) -- 0:01:10
14500 -- (-904.601) (-903.399) (-909.606) [-905.783] * (-911.009) (-904.894) [-904.380] (-903.247) -- 0:01:07
15000 -- (-903.058) (-906.581) (-910.728) [-904.287] * [-906.440] (-905.303) (-907.888) (-905.234) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-906.106) (-906.694) (-907.632) [-903.195] * [-906.080] (-905.671) (-905.478) (-904.395) -- 0:01:03
16000 -- [-905.986] (-904.305) (-913.604) (-909.070) * [-905.026] (-906.793) (-907.715) (-903.143) -- 0:01:01
16500 -- (-905.654) (-902.939) [-906.032] (-922.748) * (-905.402) (-903.718) (-911.038) [-901.968] -- 0:00:59
17000 -- (-903.708) (-904.531) (-907.774) [-905.330] * [-907.348] (-905.116) (-903.221) (-904.566) -- 0:00:57
17500 -- (-905.302) (-903.542) (-905.984) [-905.103] * (-906.835) (-905.070) (-908.840) [-904.033] -- 0:00:56
18000 -- (-903.979) [-904.459] (-901.726) (-902.322) * [-909.237] (-906.023) (-916.391) (-906.701) -- 0:00:54
18500 -- (-903.380) (-903.004) [-906.604] (-905.419) * [-910.393] (-902.518) (-908.858) (-903.099) -- 0:00:53
19000 -- (-905.082) [-904.240] (-911.840) (-901.374) * [-907.159] (-902.827) (-907.746) (-902.518) -- 0:00:51
19500 -- (-906.353) (-904.094) [-910.828] (-902.380) * [-905.789] (-904.789) (-905.647) (-902.772) -- 0:00:50
20000 -- (-903.847) (-902.754) [-908.871] (-901.734) * [-917.208] (-903.364) (-912.365) (-903.825) -- 0:00:49
Average standard deviation of split frequencies: 0.051322
20500 -- [-902.968] (-903.054) (-909.284) (-904.031) * [-908.794] (-903.784) (-915.271) (-909.599) -- 0:00:47
21000 -- (-903.787) [-903.605] (-910.510) (-903.371) * [-907.898] (-904.994) (-906.510) (-910.515) -- 0:00:46
21500 -- (-903.709) (-902.275) [-907.907] (-906.201) * (-914.757) (-907.936) [-913.379] (-906.847) -- 0:00:45
22000 -- (-904.161) [-902.185] (-906.225) (-901.907) * (-902.998) (-904.073) [-914.639] (-904.258) -- 0:00:44
22500 -- (-903.732) [-904.185] (-918.045) (-904.868) * (-913.585) (-903.891) [-905.960] (-904.229) -- 0:00:43
23000 -- (-902.356) (-900.909) [-909.822] (-909.286) * (-908.400) (-906.160) (-907.211) [-908.963] -- 0:00:42
23500 -- [-901.357] (-902.681) (-919.369) (-908.282) * (-904.797) (-905.830) [-903.595] (-902.686) -- 0:00:41
24000 -- (-906.127) (-901.091) (-911.641) [-905.850] * (-913.182) [-904.182] (-904.325) (-903.442) -- 0:00:40
24500 -- (-910.688) (-904.164) (-910.176) [-903.844] * [-905.817] (-902.019) (-910.251) (-902.272) -- 0:00:39
25000 -- [-906.246] (-902.200) (-908.093) (-903.724) * (-903.394) [-901.443] (-914.657) (-901.599) -- 0:00:39
Average standard deviation of split frequencies: 0.042942
25500 -- (-907.836) (-902.233) (-925.286) [-905.913] * [-905.909] (-902.510) (-916.552) (-902.411) -- 0:00:38
26000 -- [-905.854] (-903.171) (-920.689) (-905.005) * [-903.609] (-905.245) (-905.332) (-904.242) -- 0:00:37
26500 -- (-902.432) [-902.240] (-905.121) (-904.343) * [-912.240] (-902.750) (-906.481) (-911.030) -- 0:00:36
27000 -- [-905.992] (-900.177) (-900.916) (-905.374) * (-908.723) (-902.182) [-906.364] (-902.863) -- 0:00:36
27500 -- (-905.822) [-901.812] (-905.005) (-903.024) * (-909.983) (-903.721) [-909.351] (-902.801) -- 0:00:35
28000 -- (-905.139) (-902.288) [-908.121] (-902.482) * (-916.442) (-902.692) [-904.855] (-902.199) -- 0:00:34
28500 -- (-902.905) (-903.284) (-907.237) [-904.552] * (-912.161) (-904.790) [-908.067] (-902.744) -- 0:00:34
29000 -- (-903.747) (-903.123) [-903.027] (-904.294) * [-910.583] (-902.930) (-907.302) (-903.200) -- 0:01:06
29500 -- (-903.270) (-907.024) (-903.217) [-903.877] * [-910.914] (-904.832) (-908.551) (-907.542) -- 0:01:05
30000 -- (-909.065) [-902.477] (-903.039) (-903.104) * (-907.245) [-902.529] (-906.254) (-908.432) -- 0:01:04
Average standard deviation of split frequencies: 0.032362
30500 -- (-906.302) (-904.791) [-902.307] (-904.051) * [-911.566] (-906.503) (-909.569) (-909.815) -- 0:01:03
31000 -- (-902.666) (-904.393) (-903.845) [-903.112] * (-909.878) (-905.053) [-902.955] (-906.288) -- 0:01:02
31500 -- (-904.302) [-901.934] (-903.626) (-903.813) * [-908.316] (-905.777) (-906.779) (-903.824) -- 0:01:01
32000 -- [-903.327] (-903.325) (-903.270) (-905.611) * (-908.632) (-905.631) [-902.405] (-901.000) -- 0:01:00
32500 -- (-903.297) [-901.879] (-903.998) (-903.579) * [-905.010] (-903.161) (-905.763) (-905.881) -- 0:00:59
33000 -- (-904.475) (-902.383) [-904.263] (-905.410) * (-910.092) (-905.565) [-903.464] (-905.209) -- 0:00:58
33500 -- [-902.363] (-903.940) (-905.098) (-902.692) * [-904.483] (-902.600) (-911.395) (-907.721) -- 0:00:57
34000 -- (-905.581) [-901.959] (-903.186) (-902.326) * (-906.640) [-902.850] (-914.122) (-905.547) -- 0:00:56
34500 -- (-902.974) [-902.807] (-901.373) (-902.690) * (-914.492) (-904.653) [-906.453] (-904.761) -- 0:00:55
35000 -- (-902.632) [-904.328] (-903.263) (-903.422) * (-910.413) (-904.525) [-907.191] (-908.970) -- 0:00:55
Average standard deviation of split frequencies: 0.037101
35500 -- [-902.439] (-903.277) (-903.400) (-905.909) * (-914.147) (-906.230) (-905.643) [-902.573] -- 0:00:54
36000 -- (-902.082) (-901.938) [-902.832] (-908.157) * [-912.730] (-905.418) (-901.844) (-904.118) -- 0:00:53
36500 -- (-902.804) [-901.851] (-903.884) (-903.423) * (-912.049) (-902.812) [-901.742] (-902.461) -- 0:00:52
37000 -- (-903.800) [-902.237] (-904.745) (-905.851) * (-917.256) [-903.984] (-903.815) (-903.438) -- 0:00:52
37500 -- (-903.069) (-905.438) [-901.082] (-903.937) * (-920.164) (-904.248) (-903.622) [-903.856] -- 0:00:51
38000 -- (-907.289) (-905.162) (-903.093) [-903.201] * (-911.147) (-902.996) (-903.238) [-902.478] -- 0:00:50
38500 -- (-904.624) (-901.268) [-904.543] (-906.892) * [-906.311] (-908.247) (-902.285) (-903.517) -- 0:00:49
39000 -- (-901.687) (-903.481) [-903.900] (-902.602) * [-908.014] (-904.291) (-904.739) (-902.253) -- 0:00:49
39500 -- (-902.650) (-904.894) [-903.475] (-901.389) * (-908.361) (-905.670) [-902.695] (-901.872) -- 0:00:48
40000 -- (-901.621) (-902.540) (-906.810) [-903.310] * (-904.229) (-903.647) (-904.581) [-903.583] -- 0:00:48
Average standard deviation of split frequencies: 0.034166
40500 -- (-902.452) (-904.105) (-906.097) [-903.278] * [-909.878] (-903.518) (-902.446) (-905.655) -- 0:00:47
41000 -- (-900.778) (-904.284) [-905.533] (-910.508) * (-916.191) (-903.405) [-901.667] (-902.103) -- 0:00:46
41500 -- [-902.088] (-907.591) (-903.826) (-902.905) * [-903.840] (-905.285) (-904.974) (-904.791) -- 0:00:46
42000 -- (-903.044) (-903.952) (-904.891) [-903.659] * [-907.412] (-902.643) (-903.480) (-903.425) -- 0:00:45
42500 -- (-903.095) (-903.851) (-904.353) [-902.671] * (-913.353) (-904.936) [-906.928] (-903.258) -- 0:00:45
43000 -- (-902.982) (-904.430) (-902.166) [-903.833] * (-905.956) (-904.562) [-902.780] (-903.596) -- 0:00:44
43500 -- (-901.124) (-904.286) (-902.564) [-902.531] * [-907.853] (-903.691) (-901.576) (-904.145) -- 0:01:05
44000 -- [-901.609] (-908.985) (-905.096) (-901.642) * [-906.519] (-906.628) (-902.169) (-901.646) -- 0:01:05
44500 -- [-901.048] (-903.344) (-904.103) (-903.350) * [-905.991] (-909.676) (-903.201) (-902.889) -- 0:01:04
45000 -- [-906.711] (-903.140) (-903.639) (-903.099) * (-904.284) (-905.733) [-902.703] (-902.475) -- 0:01:03
Average standard deviation of split frequencies: 0.034331
45500 -- (-906.448) [-903.385] (-902.868) (-903.585) * [-914.366] (-906.609) (-903.959) (-902.094) -- 0:01:02
46000 -- (-903.285) (-903.158) [-903.362] (-904.534) * (-913.877) (-904.879) (-903.968) [-903.587] -- 0:01:02
46500 -- (-902.478) (-903.412) [-903.668] (-908.255) * [-917.717] (-903.601) (-903.784) (-904.229) -- 0:01:01
47000 -- (-900.787) [-903.186] (-905.107) (-908.725) * (-908.426) (-903.596) (-903.297) [-905.483] -- 0:01:00
47500 -- (-903.717) (-903.992) [-902.671] (-905.748) * (-909.211) (-903.813) (-904.714) [-902.583] -- 0:01:00
48000 -- (-904.167) (-903.354) [-904.977] (-906.832) * [-906.178] (-903.008) (-902.714) (-905.153) -- 0:00:59
48500 -- [-900.985] (-905.143) (-904.576) (-903.628) * (-915.736) (-904.845) (-903.009) [-903.600] -- 0:00:58
49000 -- (-903.692) [-903.098] (-901.776) (-902.729) * (-908.186) (-906.135) [-902.723] (-903.964) -- 0:00:58
49500 -- (-907.375) (-906.760) (-902.601) [-903.987] * (-911.995) (-904.973) (-903.102) [-905.106] -- 0:00:57
50000 -- (-903.380) (-906.709) [-902.917] (-902.194) * [-905.987] (-903.807) (-904.361) (-903.711) -- 0:00:57
Average standard deviation of split frequencies: 0.035001
50500 -- [-903.558] (-903.215) (-903.702) (-903.575) * (-908.550) [-902.692] (-904.931) (-902.032) -- 0:00:56
51000 -- [-906.136] (-904.424) (-903.310) (-900.710) * (-906.255) [-903.835] (-912.049) (-902.700) -- 0:00:55
51500 -- (-903.226) (-904.162) (-902.639) [-902.669] * (-906.669) (-903.956) (-908.230) [-903.416] -- 0:00:55
52000 -- [-901.569] (-903.896) (-902.898) (-904.136) * (-911.741) (-903.826) [-906.019] (-903.890) -- 0:00:54
52500 -- (-903.367) (-902.535) [-901.480] (-902.846) * (-910.151) [-903.618] (-905.456) (-904.283) -- 0:00:54
53000 -- (-903.236) [-904.184] (-904.347) (-903.402) * (-910.259) (-903.129) (-901.777) [-903.066] -- 0:00:53
53500 -- (-902.382) [-903.243] (-902.745) (-901.106) * (-901.584) (-902.676) [-907.041] (-904.819) -- 0:00:53
54000 -- (-904.599) (-903.581) (-907.658) [-903.165] * (-903.193) (-904.327) (-905.513) [-904.189] -- 0:00:52
54500 -- (-901.969) [-905.414] (-903.764) (-901.744) * (-904.176) [-901.973] (-903.794) (-903.778) -- 0:00:52
55000 -- [-903.002] (-903.333) (-904.511) (-900.558) * (-904.753) [-904.470] (-904.454) (-904.565) -- 0:00:51
Average standard deviation of split frequencies: 0.034514
55500 -- [-902.438] (-909.116) (-906.347) (-902.696) * (-903.355) [-903.201] (-902.926) (-904.790) -- 0:00:51
56000 -- [-902.643] (-905.066) (-905.533) (-901.504) * (-903.326) [-905.721] (-900.968) (-902.841) -- 0:00:50
56500 -- [-901.736] (-901.926) (-902.588) (-904.680) * (-907.248) [-904.170] (-908.218) (-909.488) -- 0:00:50
57000 -- [-901.729] (-901.907) (-903.355) (-908.072) * (-905.149) (-904.811) (-906.409) [-902.433] -- 0:00:49
57500 -- (-905.549) (-903.339) [-905.241] (-903.130) * (-904.284) (-904.842) (-907.693) [-903.129] -- 0:00:49
58000 -- (-904.211) (-901.702) [-906.097] (-902.682) * [-902.329] (-903.377) (-905.381) (-902.778) -- 0:01:04
58500 -- (-903.356) (-902.159) [-902.125] (-901.037) * (-902.773) [-903.250] (-902.441) (-902.183) -- 0:01:04
59000 -- (-905.133) (-902.227) [-904.649] (-903.321) * (-903.457) (-905.131) [-902.888] (-902.550) -- 0:01:03
59500 -- (-904.851) (-902.055) [-903.052] (-902.733) * [-904.475] (-903.613) (-904.424) (-903.260) -- 0:01:03
60000 -- (-904.738) (-903.522) [-902.837] (-905.002) * (-903.745) [-903.608] (-905.418) (-903.114) -- 0:01:02
Average standard deviation of split frequencies: 0.032636
60500 -- [-905.863] (-901.473) (-901.191) (-905.308) * (-901.917) (-902.391) (-904.962) [-904.196] -- 0:01:02
61000 -- (-902.316) (-903.425) [-903.513] (-901.383) * (-903.643) (-902.261) (-906.061) [-902.508] -- 0:01:01
61500 -- [-905.751] (-907.233) (-902.814) (-900.717) * [-904.180] (-904.130) (-905.051) (-902.161) -- 0:01:01
62000 -- (-904.599) [-904.593] (-903.435) (-902.543) * (-905.574) (-911.820) [-901.774] (-902.680) -- 0:01:00
62500 -- (-906.929) [-904.868] (-906.596) (-902.013) * (-906.623) (-901.529) (-900.725) [-904.538] -- 0:01:00
63000 -- [-904.474] (-904.303) (-901.895) (-902.975) * (-905.930) (-904.348) [-902.921] (-903.330) -- 0:00:59
63500 -- [-903.101] (-903.055) (-904.632) (-903.939) * (-906.115) (-904.530) [-903.812] (-905.947) -- 0:00:58
64000 -- (-902.160) [-907.651] (-904.372) (-904.081) * (-905.773) (-904.908) [-907.068] (-907.844) -- 0:00:58
64500 -- (-907.245) (-909.537) [-907.328] (-904.258) * (-901.626) [-902.992] (-903.096) (-904.180) -- 0:00:58
65000 -- (-907.033) (-904.258) [-905.387] (-906.185) * (-904.907) [-903.014] (-903.258) (-905.507) -- 0:00:57
Average standard deviation of split frequencies: 0.030193
65500 -- (-904.695) (-905.291) (-902.591) [-904.723] * (-903.454) (-903.846) [-903.577] (-906.693) -- 0:00:57
66000 -- (-903.443) (-903.887) (-904.703) [-906.376] * [-901.596] (-905.200) (-905.819) (-910.139) -- 0:00:56
66500 -- (-907.449) (-903.022) (-905.331) [-900.574] * (-902.655) [-902.661] (-907.028) (-906.573) -- 0:00:56
67000 -- (-905.031) (-902.510) (-902.888) [-903.990] * (-904.617) [-905.711] (-904.125) (-903.670) -- 0:00:55
67500 -- (-903.022) (-903.092) (-904.890) [-904.472] * (-905.013) (-902.680) (-903.367) [-901.560] -- 0:00:55
68000 -- (-904.176) (-902.419) (-901.651) [-903.000] * (-907.533) [-905.431] (-908.375) (-902.591) -- 0:00:54
68500 -- [-902.875] (-901.531) (-904.214) (-906.104) * (-907.943) [-902.680] (-905.183) (-903.002) -- 0:00:54
69000 -- [-904.473] (-901.798) (-905.284) (-902.981) * [-902.733] (-902.954) (-907.667) (-906.631) -- 0:00:53
69500 -- (-902.620) [-903.680] (-904.588) (-903.073) * (-902.341) (-903.334) [-901.749] (-902.724) -- 0:00:53
70000 -- [-903.654] (-905.292) (-903.169) (-904.522) * (-902.664) [-904.003] (-902.838) (-909.828) -- 0:00:53
Average standard deviation of split frequencies: 0.025683
70500 -- (-907.510) (-903.751) [-904.114] (-905.221) * (-902.554) (-903.865) [-902.866] (-904.588) -- 0:00:52
71000 -- (-903.810) [-902.054] (-902.211) (-903.606) * (-903.950) (-904.230) (-903.675) [-901.777] -- 0:00:52
71500 -- (-905.942) [-905.840] (-902.638) (-901.385) * [-902.963] (-903.180) (-905.041) (-906.833) -- 0:00:51
72000 -- (-905.066) (-903.485) [-902.864] (-904.221) * (-904.435) (-901.187) [-902.262] (-906.381) -- 0:00:51
72500 -- (-903.365) (-904.139) (-904.383) [-905.309] * [-904.158] (-902.774) (-905.306) (-905.878) -- 0:00:51
73000 -- (-902.891) (-903.967) [-903.928] (-904.117) * (-905.404) (-903.110) (-904.460) [-904.791] -- 0:01:03
73500 -- (-903.308) (-903.518) [-904.568] (-904.216) * (-904.283) (-902.826) (-902.785) [-905.658] -- 0:01:03
74000 -- [-903.050] (-902.611) (-904.174) (-902.314) * (-903.964) (-908.254) [-903.136] (-903.328) -- 0:01:02
74500 -- (-904.300) [-902.050] (-902.670) (-902.766) * (-904.451) (-906.097) (-903.327) [-901.659] -- 0:01:02
75000 -- (-904.560) (-905.998) (-902.867) [-904.820] * (-904.410) (-904.799) [-902.938] (-902.966) -- 0:01:01
Average standard deviation of split frequencies: 0.021709
75500 -- (-903.234) (-902.970) [-902.011] (-902.791) * [-904.314] (-907.055) (-904.174) (-902.276) -- 0:01:01
76000 -- [-905.081] (-902.886) (-904.788) (-903.705) * (-902.995) (-904.425) [-904.438] (-905.445) -- 0:01:00
76500 -- (-905.975) [-902.398] (-901.704) (-904.386) * (-903.732) (-906.347) [-905.008] (-905.392) -- 0:01:00
77000 -- [-902.720] (-903.521) (-902.252) (-905.318) * (-902.516) (-904.149) [-905.214] (-901.143) -- 0:00:59
77500 -- (-903.383) (-902.868) (-904.147) [-903.108] * (-904.561) (-903.386) (-903.633) [-901.302] -- 0:00:59
78000 -- (-905.407) (-903.510) [-907.482] (-906.218) * (-903.166) (-903.107) (-902.181) [-905.124] -- 0:00:59
78500 -- (-903.315) (-904.011) [-903.568] (-903.998) * [-907.473] (-906.451) (-906.032) (-903.092) -- 0:00:58
79000 -- [-906.673] (-905.172) (-903.502) (-908.427) * [-900.648] (-909.843) (-906.467) (-903.461) -- 0:00:58
79500 -- (-905.914) (-906.446) [-903.252] (-907.467) * (-911.488) (-904.937) (-903.114) [-903.058] -- 0:00:57
80000 -- (-901.199) (-903.271) [-904.048] (-904.098) * (-911.547) (-902.892) (-903.100) [-901.015] -- 0:00:57
Average standard deviation of split frequencies: 0.021622
80500 -- [-903.205] (-906.553) (-903.399) (-903.938) * (-908.526) [-901.416] (-902.491) (-904.149) -- 0:00:57
81000 -- (-905.784) [-902.413] (-905.323) (-905.410) * (-901.640) (-903.353) (-902.933) [-909.356] -- 0:00:56
81500 -- [-905.195] (-903.356) (-903.829) (-904.760) * [-903.486] (-905.391) (-904.145) (-904.652) -- 0:00:56
82000 -- (-906.893) [-904.331] (-903.660) (-906.598) * (-903.138) (-902.554) (-911.466) [-906.601] -- 0:00:55
82500 -- (-901.166) (-902.396) (-904.271) [-904.331] * (-902.771) (-902.564) [-903.149] (-905.144) -- 0:00:55
83000 -- (-902.710) [-903.030] (-902.779) (-904.467) * (-903.167) (-902.342) (-903.747) [-905.853] -- 0:00:55
83500 -- (-901.079) (-906.104) [-902.949] (-904.390) * (-902.726) (-903.549) [-903.802] (-901.622) -- 0:00:54
84000 -- (-906.215) [-903.567] (-902.390) (-907.356) * (-903.592) [-902.601] (-904.334) (-907.887) -- 0:00:54
84500 -- [-904.609] (-901.980) (-904.641) (-904.058) * (-903.413) (-904.184) (-906.939) [-901.899] -- 0:00:54
85000 -- (-901.983) [-906.652] (-905.193) (-903.472) * (-905.362) (-903.689) [-902.599] (-902.019) -- 0:00:53
Average standard deviation of split frequencies: 0.020621
85500 -- [-903.195] (-903.311) (-904.898) (-903.480) * (-907.074) (-907.650) (-905.085) [-902.142] -- 0:00:53
86000 -- (-904.618) (-903.738) (-903.495) [-904.042] * (-906.000) [-903.956] (-907.102) (-903.179) -- 0:00:53
86500 -- (-903.122) (-905.150) [-903.551] (-902.611) * (-904.839) (-905.530) [-904.858] (-904.564) -- 0:00:52
87000 -- (-900.952) (-904.088) [-903.286] (-904.033) * (-905.995) (-909.915) [-903.568] (-907.206) -- 0:00:52
87500 -- (-903.453) (-907.114) [-906.884] (-903.189) * [-903.958] (-902.385) (-903.501) (-906.777) -- 0:01:02
88000 -- (-905.232) (-909.591) [-903.785] (-903.164) * [-904.444] (-903.038) (-903.315) (-903.027) -- 0:01:02
88500 -- (-907.453) (-903.500) (-902.286) [-903.525] * (-905.159) [-903.132] (-904.008) (-904.727) -- 0:01:01
89000 -- (-906.424) (-904.967) [-904.297] (-904.401) * (-902.549) (-906.421) [-905.170] (-905.173) -- 0:01:01
89500 -- (-903.112) (-901.871) [-904.124] (-903.327) * (-902.303) [-903.447] (-905.209) (-912.118) -- 0:01:01
90000 -- (-904.259) [-903.404] (-904.379) (-903.410) * (-903.606) [-903.478] (-904.061) (-905.932) -- 0:01:00
Average standard deviation of split frequencies: 0.022283
90500 -- (-905.263) (-904.323) [-902.150] (-904.705) * (-902.037) (-904.381) (-904.865) [-901.567] -- 0:01:00
91000 -- [-904.351] (-907.714) (-901.262) (-901.647) * (-902.281) [-906.095] (-902.705) (-903.607) -- 0:00:59
91500 -- (-906.808) (-902.649) (-903.978) [-904.112] * (-902.438) (-903.509) (-903.844) [-905.212] -- 0:00:59
92000 -- (-906.247) (-904.342) (-902.991) [-902.628] * (-903.480) (-906.133) (-905.041) [-903.831] -- 0:00:59
92500 -- (-902.814) (-905.194) [-908.126] (-902.705) * (-902.742) [-905.424] (-908.432) (-903.657) -- 0:00:58
93000 -- (-904.041) [-903.066] (-901.991) (-903.411) * (-902.634) (-911.117) (-908.658) [-903.273] -- 0:00:58
93500 -- [-904.011] (-904.513) (-903.292) (-903.763) * (-904.881) [-904.035] (-905.178) (-901.325) -- 0:00:58
94000 -- (-904.990) (-906.953) (-906.417) [-904.151] * (-903.740) (-902.236) (-906.752) [-903.649] -- 0:00:57
94500 -- (-906.310) (-901.706) [-903.430] (-903.258) * (-903.148) [-903.175] (-907.550) (-903.372) -- 0:00:57
95000 -- [-902.654] (-903.102) (-904.561) (-903.025) * (-905.357) [-903.381] (-903.030) (-903.327) -- 0:00:57
Average standard deviation of split frequencies: 0.018707
95500 -- (-902.940) [-903.938] (-902.704) (-904.597) * (-908.756) (-904.436) [-902.833] (-901.833) -- 0:00:56
96000 -- (-905.751) (-904.495) (-903.067) [-907.969] * (-904.165) (-903.774) [-902.827] (-902.252) -- 0:00:56
96500 -- [-903.583] (-902.547) (-906.067) (-904.226) * [-904.134] (-905.296) (-902.411) (-904.720) -- 0:00:56
97000 -- (-903.553) (-900.859) [-907.217] (-905.316) * (-902.049) (-905.343) (-907.443) [-904.484] -- 0:00:55
97500 -- (-904.153) [-902.181] (-905.061) (-904.744) * [-903.523] (-905.533) (-902.322) (-902.885) -- 0:00:55
98000 -- (-904.282) [-901.570] (-903.887) (-908.433) * (-903.960) [-904.070] (-903.752) (-906.111) -- 0:00:55
98500 -- (-903.413) [-902.458] (-902.864) (-907.831) * (-905.767) [-904.305] (-902.753) (-910.184) -- 0:00:54
99000 -- [-903.837] (-902.482) (-905.224) (-906.028) * (-903.143) (-905.863) (-903.413) [-902.854] -- 0:00:54
99500 -- (-903.278) [-902.179] (-902.505) (-905.706) * [-902.549] (-905.470) (-902.647) (-903.270) -- 0:00:54
100000 -- (-905.822) (-904.566) (-902.254) [-903.401] * (-907.403) [-904.587] (-902.758) (-903.755) -- 0:00:54
Average standard deviation of split frequencies: 0.020032
100500 -- (-905.798) (-901.506) (-902.562) [-903.291] * (-903.819) (-904.816) [-902.812] (-905.038) -- 0:00:53
101000 -- [-902.708] (-903.508) (-905.245) (-903.027) * (-903.668) (-904.151) [-905.877] (-900.934) -- 0:00:53
101500 -- (-905.893) [-903.794] (-904.256) (-903.941) * [-903.423] (-906.947) (-903.253) (-902.870) -- 0:00:53
102000 -- (-904.905) [-906.840] (-903.007) (-903.922) * (-902.904) (-903.793) [-902.673] (-902.372) -- 0:00:52
102500 -- [-904.591] (-904.057) (-903.259) (-902.040) * (-903.647) (-906.462) (-903.554) [-902.678] -- 0:00:52
103000 -- (-904.546) (-901.022) (-902.485) [-902.085] * (-904.169) [-904.391] (-904.683) (-904.508) -- 0:01:00
103500 -- (-904.499) (-903.655) (-902.799) [-903.897] * (-902.655) (-906.143) [-902.951] (-902.776) -- 0:01:00
104000 -- (-904.956) [-906.164] (-905.758) (-902.853) * (-907.287) [-901.914] (-903.609) (-901.276) -- 0:01:00
104500 -- (-903.048) (-905.312) (-901.852) [-902.461] * (-904.573) (-902.998) (-904.471) [-901.193] -- 0:00:59
105000 -- [-901.964] (-902.311) (-903.258) (-910.932) * (-904.446) (-904.213) (-904.811) [-901.518] -- 0:00:59
Average standard deviation of split frequencies: 0.018011
105500 -- [-902.587] (-901.682) (-903.007) (-905.377) * (-905.654) (-901.163) (-908.643) [-900.902] -- 0:00:59
106000 -- (-903.557) (-902.380) (-902.711) [-902.843] * (-904.449) (-900.361) (-904.343) [-903.031] -- 0:00:59
106500 -- (-905.829) (-905.255) [-907.964] (-902.140) * (-904.599) (-905.164) (-904.318) [-903.756] -- 0:00:58
107000 -- (-904.886) (-909.184) [-903.139] (-903.233) * (-903.341) (-907.317) (-903.830) [-904.884] -- 0:00:58
107500 -- (-904.015) (-902.239) [-906.517] (-904.233) * [-903.314] (-901.626) (-902.614) (-903.270) -- 0:00:58
108000 -- (-905.852) (-902.592) (-903.497) [-904.275] * [-903.280] (-907.907) (-903.345) (-903.203) -- 0:00:57
108500 -- [-904.384] (-902.686) (-904.308) (-904.960) * (-903.021) [-905.184] (-904.463) (-905.332) -- 0:00:57
109000 -- (-903.234) [-903.085] (-908.034) (-903.464) * (-906.030) (-906.974) (-911.323) [-904.851] -- 0:00:57
109500 -- (-900.936) [-903.983] (-906.260) (-909.499) * [-903.735] (-906.999) (-905.289) (-907.599) -- 0:00:56
110000 -- (-903.621) (-905.494) [-905.848] (-901.891) * (-909.495) (-904.874) [-902.519] (-906.344) -- 0:00:56
Average standard deviation of split frequencies: 0.017711
110500 -- (-903.941) (-903.500) (-903.478) [-902.984] * (-903.441) (-903.471) [-901.600] (-904.842) -- 0:00:56
111000 -- (-903.933) (-903.075) (-902.700) [-904.039] * (-903.110) (-902.721) (-901.702) [-902.371] -- 0:00:56
111500 -- (-911.610) (-905.930) (-905.200) [-902.862] * [-902.603] (-904.234) (-904.022) (-903.357) -- 0:00:55
112000 -- (-907.130) (-908.666) (-904.381) [-902.653] * [-901.007] (-903.320) (-904.896) (-902.203) -- 0:00:55
112500 -- [-901.589] (-903.256) (-906.711) (-907.700) * [-904.497] (-905.994) (-903.215) (-899.992) -- 0:00:55
113000 -- (-903.241) (-904.188) (-902.556) [-903.164] * (-903.257) [-903.532] (-902.742) (-902.214) -- 0:00:54
113500 -- (-903.209) (-907.092) (-902.634) [-902.042] * [-902.526] (-908.160) (-901.545) (-904.483) -- 0:00:54
114000 -- (-905.631) [-907.623] (-901.455) (-902.913) * (-903.491) [-901.891] (-902.482) (-905.182) -- 0:00:54
114500 -- (-906.165) (-902.233) [-902.014] (-901.467) * (-904.561) (-901.009) [-905.341] (-904.858) -- 0:00:54
115000 -- (-904.594) (-901.577) [-902.381] (-901.868) * (-906.535) (-903.223) [-902.603] (-908.606) -- 0:00:53
Average standard deviation of split frequencies: 0.017158
115500 -- (-904.370) (-902.725) (-902.628) [-901.846] * [-905.886] (-904.479) (-905.316) (-910.122) -- 0:00:53
116000 -- (-903.336) (-904.505) [-902.107] (-902.488) * (-905.518) (-903.391) [-903.315] (-903.478) -- 0:00:53
116500 -- [-903.514] (-904.262) (-901.567) (-904.898) * (-903.985) (-906.997) (-908.355) [-905.126] -- 0:00:53
117000 -- (-905.480) (-903.167) (-908.707) [-904.149] * (-907.771) (-902.601) (-909.127) [-903.443] -- 0:00:52
117500 -- [-903.951] (-903.530) (-907.565) (-904.710) * (-906.688) (-902.694) (-904.475) [-902.954] -- 0:00:52
118000 -- [-902.852] (-901.910) (-904.238) (-907.291) * [-902.808] (-903.247) (-905.714) (-906.474) -- 0:00:59
118500 -- (-903.656) (-901.112) [-902.940] (-904.558) * (-904.415) (-904.215) (-908.965) [-909.719] -- 0:00:59
119000 -- (-903.030) [-904.870] (-903.635) (-902.471) * [-902.065] (-904.394) (-909.719) (-903.818) -- 0:00:59
119500 -- (-904.270) (-903.159) [-904.138] (-901.639) * (-904.241) (-904.228) (-905.398) [-905.871] -- 0:00:58
120000 -- (-903.044) [-903.147] (-904.940) (-903.460) * (-903.079) (-906.298) (-902.888) [-904.539] -- 0:00:58
Average standard deviation of split frequencies: 0.016495
120500 -- (-900.409) (-904.116) [-902.389] (-904.116) * (-903.041) (-904.434) [-905.519] (-902.296) -- 0:00:58
121000 -- (-900.789) (-906.489) [-902.688] (-902.847) * (-905.089) (-901.529) (-904.647) [-902.700] -- 0:00:58
121500 -- [-906.007] (-906.078) (-905.705) (-900.116) * (-905.583) [-904.821] (-902.501) (-902.493) -- 0:00:57
122000 -- [-903.252] (-903.902) (-902.066) (-901.382) * [-905.225] (-901.691) (-902.678) (-902.441) -- 0:00:57
122500 -- (-908.012) [-903.822] (-904.135) (-903.465) * (-902.735) [-903.018] (-905.007) (-903.107) -- 0:00:57
123000 -- [-906.857] (-902.841) (-903.377) (-903.754) * (-905.280) [-902.486] (-905.412) (-903.828) -- 0:00:57
123500 -- (-901.832) [-903.127] (-904.465) (-902.889) * [-903.377] (-903.433) (-905.307) (-904.201) -- 0:00:56
124000 -- [-901.501] (-903.305) (-907.007) (-904.654) * [-904.104] (-905.883) (-904.880) (-905.341) -- 0:00:56
124500 -- (-901.053) (-905.260) [-904.125] (-905.333) * (-902.456) (-902.384) [-903.455] (-907.176) -- 0:00:56
125000 -- [-902.716] (-904.224) (-903.593) (-902.916) * (-904.227) (-902.596) (-904.104) [-903.099] -- 0:00:56
Average standard deviation of split frequencies: 0.016212
125500 -- (-907.779) (-904.565) [-903.588] (-902.864) * (-904.136) [-904.433] (-904.903) (-903.382) -- 0:00:55
126000 -- (-904.752) (-903.786) [-904.351] (-906.258) * (-902.653) (-902.768) [-905.551] (-908.109) -- 0:00:55
126500 -- (-903.477) [-906.589] (-904.490) (-902.261) * [-903.355] (-903.636) (-903.546) (-903.859) -- 0:00:55
127000 -- (-903.977) (-905.568) (-904.354) [-901.503] * (-901.692) [-902.427] (-902.076) (-903.980) -- 0:00:54
127500 -- (-902.937) (-903.879) (-908.556) [-901.787] * (-905.074) (-909.232) [-902.951] (-905.267) -- 0:00:54
128000 -- [-903.527] (-903.563) (-905.337) (-902.829) * (-901.503) [-905.466] (-904.656) (-906.938) -- 0:00:54
128500 -- (-907.433) (-902.762) (-904.972) [-903.683] * (-906.639) (-902.697) (-902.808) [-906.981] -- 0:00:54
129000 -- (-904.425) [-905.729] (-903.793) (-906.658) * (-902.378) [-900.739] (-904.999) (-904.305) -- 0:00:54
129500 -- [-905.175] (-903.065) (-903.223) (-906.860) * (-903.165) (-905.971) (-901.494) [-902.949] -- 0:00:53
130000 -- (-906.028) (-904.067) (-901.721) [-903.882] * [-906.828] (-902.939) (-901.908) (-903.948) -- 0:00:53
Average standard deviation of split frequencies: 0.016595
130500 -- (-902.753) [-903.255] (-902.463) (-903.378) * (-905.198) (-902.050) [-903.497] (-905.208) -- 0:00:53
131000 -- (-905.755) (-902.654) (-901.477) [-902.862] * [-903.637] (-908.678) (-905.836) (-902.603) -- 0:00:53
131500 -- (-906.445) (-904.308) [-903.834] (-904.476) * (-904.071) (-903.723) [-904.067] (-905.889) -- 0:00:52
132000 -- [-902.838] (-903.425) (-904.237) (-900.794) * (-901.268) [-902.695] (-905.843) (-906.356) -- 0:00:52
132500 -- (-901.363) [-904.358] (-903.419) (-902.523) * (-901.817) (-903.259) [-905.550] (-904.222) -- 0:00:52
133000 -- (-904.045) [-903.329] (-903.494) (-911.174) * (-905.267) (-902.747) (-904.005) [-908.363] -- 0:00:58
133500 -- (-904.582) (-904.375) [-902.360] (-903.339) * (-902.922) [-904.788] (-904.697) (-905.794) -- 0:00:58
134000 -- (-905.190) (-903.500) [-902.202] (-905.222) * (-905.269) (-902.053) (-903.775) [-902.966] -- 0:00:58
134500 -- (-903.400) (-903.857) (-902.833) [-902.362] * (-905.309) [-906.392] (-904.075) (-904.164) -- 0:00:57
135000 -- [-902.104] (-904.031) (-906.224) (-902.950) * (-904.492) (-906.068) [-903.483] (-903.498) -- 0:00:57
Average standard deviation of split frequencies: 0.017524
135500 -- (-903.958) (-904.171) [-905.297] (-905.260) * [-902.436] (-905.663) (-903.210) (-903.373) -- 0:00:57
136000 -- (-902.602) [-902.908] (-902.973) (-906.716) * [-902.815] (-902.807) (-904.390) (-902.982) -- 0:00:57
136500 -- [-900.637] (-906.267) (-904.352) (-904.231) * [-909.139] (-904.991) (-906.117) (-902.911) -- 0:00:56
137000 -- (-905.652) (-905.452) [-902.490] (-907.391) * (-907.894) (-904.099) [-903.654] (-909.626) -- 0:00:56
137500 -- (-904.942) (-904.737) [-904.449] (-903.363) * (-904.261) (-908.635) [-904.140] (-915.975) -- 0:00:56
138000 -- [-904.426] (-903.680) (-904.419) (-902.704) * [-904.677] (-902.149) (-902.784) (-904.536) -- 0:00:56
138500 -- (-906.050) [-904.108] (-903.176) (-903.491) * [-904.175] (-905.784) (-904.591) (-906.095) -- 0:00:55
139000 -- (-903.468) (-903.178) [-904.455] (-905.771) * (-902.582) (-904.864) [-903.485] (-904.236) -- 0:00:55
139500 -- (-902.454) (-903.588) [-903.900] (-903.410) * (-905.785) [-900.336] (-906.576) (-903.879) -- 0:00:55
140000 -- [-901.052] (-902.654) (-905.688) (-903.366) * (-902.523) [-901.026] (-907.420) (-903.130) -- 0:00:55
Average standard deviation of split frequencies: 0.017742
140500 -- (-904.468) (-905.813) (-905.669) [-902.035] * [-902.327] (-903.724) (-901.253) (-903.861) -- 0:00:55
141000 -- [-901.165] (-909.680) (-902.810) (-905.200) * (-903.792) [-906.473] (-904.090) (-904.101) -- 0:00:54
141500 -- (-904.710) (-908.609) (-901.489) [-903.474] * (-903.074) [-900.441] (-902.489) (-904.974) -- 0:00:54
142000 -- (-902.099) (-908.082) [-903.666] (-905.027) * (-903.972) [-900.715] (-903.543) (-905.488) -- 0:00:54
142500 -- (-900.299) (-910.681) [-905.375] (-900.767) * (-901.649) [-902.511] (-902.580) (-902.481) -- 0:00:54
143000 -- (-902.241) (-902.269) [-901.287] (-904.570) * (-903.447) (-902.151) [-904.107] (-904.178) -- 0:00:53
143500 -- (-906.388) [-902.281] (-910.277) (-904.600) * [-904.925] (-906.639) (-904.083) (-902.662) -- 0:00:53
144000 -- [-905.741] (-902.924) (-911.218) (-902.212) * [-901.825] (-904.904) (-902.112) (-904.220) -- 0:00:53
144500 -- (-904.693) (-905.583) (-911.208) [-901.892] * (-902.229) (-907.136) (-906.049) [-903.746] -- 0:00:53
145000 -- (-902.590) [-901.981] (-904.624) (-903.868) * (-902.373) (-903.714) [-902.474] (-903.886) -- 0:00:53
Average standard deviation of split frequencies: 0.016654
145500 -- [-902.263] (-903.167) (-904.385) (-904.027) * (-904.086) (-903.197) (-903.148) [-900.978] -- 0:00:52
146000 -- (-905.024) (-904.093) [-904.159] (-909.419) * [-903.800] (-902.729) (-904.576) (-905.480) -- 0:00:52
146500 -- (-908.670) (-904.684) (-909.287) [-903.811] * [-904.033] (-902.729) (-906.984) (-915.390) -- 0:00:52
147000 -- (-906.323) (-905.902) (-904.060) [-901.284] * (-906.174) [-902.907] (-907.672) (-907.097) -- 0:00:52
147500 -- (-902.663) (-904.290) (-904.692) [-901.626] * (-906.900) [-903.861] (-904.365) (-903.847) -- 0:00:52
148000 -- (-902.161) (-903.104) [-905.310] (-903.459) * (-905.651) [-905.140] (-904.740) (-906.443) -- 0:00:57
148500 -- (-905.173) [-902.204] (-904.568) (-903.683) * (-906.146) (-904.283) (-903.914) [-903.609] -- 0:00:57
149000 -- (-902.007) (-903.326) (-903.896) [-903.046] * (-904.560) (-903.923) [-903.547] (-903.683) -- 0:00:57
149500 -- (-900.580) (-904.701) [-905.046] (-903.307) * [-902.637] (-905.694) (-902.922) (-903.086) -- 0:00:56
150000 -- (-904.731) (-906.481) [-908.470] (-905.141) * (-907.877) [-902.113] (-902.128) (-904.883) -- 0:00:56
Average standard deviation of split frequencies: 0.015488
150500 -- (-904.894) (-902.852) (-905.111) [-904.169] * [-903.577] (-902.356) (-901.316) (-902.584) -- 0:00:56
151000 -- (-903.416) (-903.005) (-906.348) [-905.314] * (-902.853) (-902.321) [-904.341] (-903.265) -- 0:00:56
151500 -- (-904.216) [-902.693] (-904.817) (-904.552) * (-904.463) (-902.318) (-902.916) [-901.937] -- 0:00:56
152000 -- (-903.127) (-901.946) (-906.912) [-904.390] * (-903.526) [-902.391] (-904.157) (-907.099) -- 0:00:55
152500 -- [-902.623] (-900.657) (-905.207) (-908.281) * (-903.289) [-901.389] (-906.555) (-903.316) -- 0:00:55
153000 -- (-905.086) [-906.023] (-903.233) (-903.110) * (-905.449) [-904.987] (-903.702) (-903.622) -- 0:00:55
153500 -- (-904.264) (-903.149) [-903.369] (-903.289) * (-905.691) (-903.345) [-901.941] (-904.673) -- 0:00:55
154000 -- (-906.472) [-902.942] (-904.141) (-903.013) * (-906.108) (-903.154) [-905.244] (-903.025) -- 0:00:54
154500 -- (-903.589) [-900.513] (-906.469) (-902.556) * (-908.001) [-900.498] (-901.771) (-901.226) -- 0:00:54
155000 -- (-903.486) (-902.634) (-907.218) [-903.013] * [-902.120] (-901.887) (-905.997) (-903.772) -- 0:00:54
Average standard deviation of split frequencies: 0.015411
155500 -- [-904.491] (-905.413) (-903.888) (-902.831) * (-904.163) (-907.859) [-902.506] (-904.420) -- 0:00:54
156000 -- [-903.951] (-901.286) (-903.621) (-903.119) * [-903.733] (-908.342) (-901.997) (-903.434) -- 0:00:54
156500 -- (-904.860) (-903.345) (-903.460) [-904.873] * (-901.468) [-902.870] (-902.505) (-902.737) -- 0:00:53
157000 -- [-902.545] (-903.559) (-905.837) (-904.115) * (-901.939) [-904.204] (-903.219) (-903.826) -- 0:00:53
157500 -- (-901.952) (-904.896) [-904.047] (-908.669) * [-905.022] (-902.286) (-903.605) (-904.826) -- 0:00:53
158000 -- (-902.997) (-905.973) [-904.162] (-905.072) * (-905.799) (-901.667) [-902.738] (-902.803) -- 0:00:53
158500 -- [-902.522] (-905.221) (-901.244) (-905.644) * (-904.775) (-900.712) [-907.131] (-902.859) -- 0:00:53
159000 -- (-904.456) (-906.595) [-903.847] (-903.173) * (-905.693) [-904.608] (-902.095) (-902.755) -- 0:00:52
159500 -- [-903.564] (-903.202) (-901.045) (-906.829) * (-904.587) [-901.684] (-904.328) (-904.668) -- 0:00:52
160000 -- (-907.828) (-903.499) (-904.695) [-903.489] * (-903.489) (-905.671) (-904.762) [-903.653] -- 0:00:52
Average standard deviation of split frequencies: 0.017295
160500 -- [-902.847] (-907.750) (-902.794) (-902.964) * (-901.495) (-901.653) [-903.600] (-903.445) -- 0:00:52
161000 -- (-904.733) (-906.067) [-902.474] (-904.692) * [-904.680] (-904.781) (-905.124) (-906.929) -- 0:00:52
161500 -- (-904.193) (-903.505) [-902.627] (-904.902) * [-903.503] (-903.826) (-905.073) (-904.834) -- 0:00:51
162000 -- (-906.110) [-904.800] (-903.990) (-904.133) * (-901.636) [-901.882] (-902.643) (-904.218) -- 0:00:51
162500 -- (-906.925) (-903.748) [-901.278] (-902.714) * (-903.514) (-905.657) (-904.997) [-902.967] -- 0:00:51
163000 -- [-903.662] (-904.420) (-901.869) (-903.666) * (-903.753) [-902.975] (-902.519) (-902.962) -- 0:00:51
163500 -- [-905.205] (-906.838) (-905.363) (-904.983) * (-903.091) [-904.759] (-903.174) (-904.422) -- 0:00:56
164000 -- (-904.247) (-902.623) (-904.046) [-904.096] * (-904.470) [-905.427] (-900.975) (-904.575) -- 0:00:56
164500 -- (-904.651) (-902.790) [-900.717] (-903.659) * (-903.634) (-904.001) (-904.230) [-909.339] -- 0:00:55
165000 -- (-903.769) (-903.026) [-903.367] (-902.896) * [-905.109] (-906.963) (-904.454) (-905.740) -- 0:00:55
Average standard deviation of split frequencies: 0.017039
165500 -- [-904.683] (-905.108) (-900.885) (-907.994) * (-904.156) [-903.301] (-908.313) (-903.048) -- 0:00:55
166000 -- (-904.765) [-902.499] (-905.288) (-903.749) * [-901.703] (-903.889) (-903.623) (-903.547) -- 0:00:55
166500 -- (-903.476) (-902.786) [-902.420] (-902.972) * (-904.652) [-905.021] (-905.958) (-906.696) -- 0:00:55
167000 -- [-907.346] (-905.134) (-904.239) (-902.413) * (-903.973) (-906.385) (-905.051) [-903.588] -- 0:00:54
167500 -- [-904.516] (-903.303) (-905.757) (-900.693) * (-905.114) [-904.865] (-903.779) (-905.086) -- 0:00:54
168000 -- [-904.073] (-903.900) (-909.951) (-906.228) * (-908.595) [-904.972] (-903.450) (-903.316) -- 0:00:54
168500 -- (-906.322) (-902.898) [-901.399] (-901.547) * (-903.067) (-906.894) [-904.757] (-902.285) -- 0:00:54
169000 -- (-905.055) (-903.686) (-901.356) [-901.074] * (-903.041) [-904.014] (-903.950) (-908.247) -- 0:00:54
169500 -- (-904.031) (-903.139) [-902.765] (-903.622) * (-903.367) (-902.913) (-904.227) [-904.143] -- 0:00:53
170000 -- (-908.999) [-903.813] (-904.705) (-904.850) * (-903.745) [-902.829] (-902.470) (-908.071) -- 0:00:53
Average standard deviation of split frequencies: 0.017881
170500 -- (-906.877) [-902.430] (-904.837) (-903.229) * [-906.277] (-902.184) (-904.003) (-905.927) -- 0:00:53
171000 -- [-911.771] (-903.831) (-903.351) (-903.390) * (-904.811) (-903.841) (-904.193) [-903.880] -- 0:00:53
171500 -- (-900.501) (-904.643) (-902.403) [-902.598] * (-906.253) (-902.839) [-904.902] (-902.836) -- 0:00:53
172000 -- [-903.214] (-907.581) (-901.270) (-902.988) * (-906.751) (-904.132) (-904.208) [-902.841] -- 0:00:52
172500 -- (-901.241) (-903.774) (-903.848) [-904.675] * (-905.545) (-902.909) [-903.294] (-903.722) -- 0:00:52
173000 -- (-904.014) (-904.648) [-902.449] (-901.982) * (-905.119) [-903.766] (-905.416) (-904.314) -- 0:00:52
173500 -- (-902.700) [-905.198] (-902.703) (-901.151) * [-903.629] (-906.424) (-905.678) (-905.843) -- 0:00:52
174000 -- (-903.133) (-904.494) (-902.789) [-904.875] * (-907.891) [-904.291] (-903.913) (-905.343) -- 0:00:52
174500 -- (-903.242) (-904.693) (-902.514) [-904.286] * [-904.218] (-905.638) (-902.479) (-903.902) -- 0:00:52
175000 -- [-901.970] (-904.973) (-903.226) (-903.513) * (-906.658) (-903.424) [-901.435] (-902.717) -- 0:00:51
Average standard deviation of split frequencies: 0.017707
175500 -- [-905.218] (-904.661) (-903.776) (-902.162) * (-904.686) (-902.982) (-905.445) [-903.082] -- 0:00:51
176000 -- [-902.345] (-902.548) (-903.009) (-905.804) * (-901.148) (-902.361) [-904.095] (-903.139) -- 0:00:51
176500 -- (-905.462) (-902.079) [-901.088] (-907.614) * (-907.205) (-902.483) [-903.609] (-903.660) -- 0:00:51
177000 -- [-902.515] (-902.182) (-902.668) (-901.719) * (-908.120) [-903.299] (-902.933) (-903.814) -- 0:00:51
177500 -- (-902.482) (-908.437) (-903.821) [-901.275] * [-906.600] (-902.702) (-909.114) (-902.902) -- 0:00:50
178000 -- (-907.807) (-910.934) (-903.649) [-903.207] * (-902.940) (-901.934) [-903.856] (-902.273) -- 0:00:50
178500 -- (-908.118) [-904.184] (-904.061) (-905.313) * (-908.046) [-902.635] (-903.817) (-902.618) -- 0:00:50
179000 -- (-902.915) (-907.169) (-904.881) [-903.247] * (-907.202) (-906.578) (-903.011) [-904.979] -- 0:00:55
179500 -- (-903.293) (-906.974) (-903.176) [-902.613] * (-904.102) [-903.990] (-903.531) (-905.425) -- 0:00:54
180000 -- (-902.932) (-903.246) (-901.281) [-904.926] * [-904.555] (-905.289) (-905.648) (-905.016) -- 0:00:54
Average standard deviation of split frequencies: 0.015962
180500 -- (-906.000) (-901.917) [-900.847] (-904.436) * (-906.737) (-904.760) (-905.979) [-902.949] -- 0:00:54
181000 -- (-906.871) [-903.835] (-905.435) (-912.217) * [-904.982] (-904.732) (-906.511) (-901.889) -- 0:00:54
181500 -- [-907.171] (-903.954) (-902.697) (-905.068) * (-906.093) (-905.958) [-904.404] (-901.828) -- 0:00:54
182000 -- [-904.044] (-903.381) (-903.337) (-903.190) * (-902.509) [-905.485] (-902.980) (-904.456) -- 0:00:53
182500 -- (-902.957) (-903.437) [-903.174] (-906.243) * (-902.610) (-902.302) (-903.588) [-904.154] -- 0:00:53
183000 -- (-903.738) (-904.468) [-902.086] (-905.959) * [-903.129] (-903.995) (-904.677) (-903.881) -- 0:00:53
183500 -- (-902.936) (-907.903) [-902.113] (-903.164) * (-903.225) [-903.189] (-904.819) (-904.208) -- 0:00:53
184000 -- (-904.898) (-902.614) (-908.998) [-903.258] * (-904.713) [-903.892] (-909.097) (-903.278) -- 0:00:53
184500 -- [-905.602] (-904.403) (-906.133) (-904.956) * [-901.237] (-905.374) (-903.262) (-906.052) -- 0:00:53
185000 -- (-903.902) [-902.798] (-903.705) (-904.677) * (-906.100) [-902.796] (-902.706) (-902.985) -- 0:00:52
Average standard deviation of split frequencies: 0.017294
185500 -- (-908.526) [-902.736] (-903.563) (-902.994) * [-903.974] (-902.859) (-904.617) (-903.489) -- 0:00:52
186000 -- (-906.100) (-905.988) [-905.489] (-907.274) * (-904.038) (-903.561) [-905.902] (-905.402) -- 0:00:52
186500 -- [-901.167] (-904.784) (-905.857) (-904.034) * (-903.449) [-904.880] (-905.889) (-901.982) -- 0:00:52
187000 -- (-902.568) [-902.783] (-904.177) (-906.220) * (-901.777) [-902.093] (-905.695) (-903.036) -- 0:00:52
187500 -- (-903.590) [-902.961] (-903.701) (-905.268) * (-903.621) (-903.178) [-903.154] (-901.938) -- 0:00:52
188000 -- (-903.669) (-906.336) (-902.649) [-901.013] * (-902.116) (-903.086) [-903.845] (-902.719) -- 0:00:51
188500 -- (-904.629) [-904.591] (-905.779) (-902.839) * [-900.559] (-904.410) (-905.089) (-902.855) -- 0:00:51
189000 -- (-901.399) (-905.192) [-907.082] (-903.045) * [-901.908] (-902.500) (-903.649) (-902.820) -- 0:00:51
189500 -- (-903.340) (-902.678) [-904.484] (-904.485) * (-905.053) (-905.068) (-902.862) [-903.509] -- 0:00:51
190000 -- (-902.463) (-904.905) [-905.053] (-901.561) * (-906.587) [-906.378] (-902.959) (-903.542) -- 0:00:51
Average standard deviation of split frequencies: 0.016580
190500 -- (-905.788) (-904.725) (-910.864) [-902.931] * (-905.852) (-904.334) [-902.756] (-902.769) -- 0:00:50
191000 -- (-903.071) (-907.097) (-905.166) [-902.194] * (-903.347) [-904.166] (-901.813) (-902.565) -- 0:00:50
191500 -- (-904.181) [-906.354] (-903.582) (-905.101) * [-902.719] (-908.403) (-908.152) (-903.704) -- 0:00:50
192000 -- [-903.258] (-905.159) (-906.433) (-904.005) * [-901.302] (-905.047) (-902.755) (-904.521) -- 0:00:50
192500 -- (-902.208) (-903.609) [-902.206] (-904.979) * (-904.829) (-902.544) (-902.806) [-903.532] -- 0:00:50
193000 -- (-904.863) [-904.114] (-900.408) (-903.131) * [-905.804] (-903.888) (-903.396) (-904.040) -- 0:00:50
193500 -- (-905.074) (-901.650) [-903.523] (-908.777) * (-908.399) (-906.772) [-904.221] (-903.010) -- 0:00:50
194000 -- (-903.661) (-904.452) (-903.645) [-903.935] * [-903.522] (-902.752) (-902.916) (-904.855) -- 0:00:49
194500 -- (-904.267) (-904.442) (-902.876) [-903.850] * [-901.101] (-902.822) (-904.070) (-901.275) -- 0:00:53
195000 -- [-902.539] (-903.327) (-904.318) (-905.845) * (-904.781) (-902.266) [-904.418] (-903.705) -- 0:00:53
Average standard deviation of split frequencies: 0.015704
195500 -- [-904.653] (-902.787) (-908.111) (-906.556) * (-901.970) (-902.739) (-902.620) [-907.803] -- 0:00:53
196000 -- (-906.312) (-905.284) (-903.762) [-904.450] * (-901.509) [-902.740] (-901.775) (-901.999) -- 0:00:53
196500 -- (-908.037) (-902.394) [-904.910] (-902.493) * (-903.751) (-902.943) (-901.328) [-903.053] -- 0:00:53
197000 -- (-905.721) [-902.322] (-907.486) (-900.552) * [-904.789] (-902.568) (-903.972) (-902.102) -- 0:00:52
197500 -- (-903.628) (-904.034) (-902.352) [-902.677] * (-904.355) (-906.714) [-902.709] (-908.372) -- 0:00:52
198000 -- (-905.095) (-902.305) (-908.096) [-904.894] * [-902.995] (-906.414) (-901.777) (-902.715) -- 0:00:52
198500 -- [-903.949] (-906.553) (-903.995) (-903.536) * (-904.758) [-902.784] (-901.311) (-905.628) -- 0:00:52
199000 -- (-906.325) [-905.469] (-904.237) (-906.121) * (-903.110) (-905.401) [-901.947] (-904.905) -- 0:00:52
199500 -- (-905.215) (-903.920) (-907.350) [-901.965] * (-901.713) (-905.443) (-903.022) [-902.325] -- 0:00:52
200000 -- (-903.626) [-904.817] (-903.760) (-903.054) * (-902.172) (-904.508) [-903.555] (-902.694) -- 0:00:51
Average standard deviation of split frequencies: 0.016444
200500 -- [-906.781] (-903.496) (-906.770) (-903.954) * [-902.354] (-903.510) (-903.770) (-903.230) -- 0:00:51
201000 -- (-907.149) (-906.452) [-908.293] (-903.792) * (-901.523) (-903.446) [-903.496] (-902.756) -- 0:00:51
201500 -- (-903.643) (-905.792) (-905.421) [-903.544] * (-902.710) (-902.669) (-902.532) [-906.023] -- 0:00:51
202000 -- [-904.154] (-903.761) (-904.502) (-902.263) * (-902.839) (-906.069) (-902.638) [-903.992] -- 0:00:51
202500 -- (-904.818) (-903.416) [-905.491] (-901.631) * [-902.630] (-904.463) (-904.395) (-903.244) -- 0:00:51
203000 -- [-908.332] (-903.934) (-903.260) (-901.634) * (-903.008) (-902.722) (-905.197) [-905.179] -- 0:00:51
203500 -- (-905.518) [-904.335] (-902.178) (-903.448) * (-903.091) [-903.385] (-904.652) (-905.346) -- 0:00:50
204000 -- (-903.073) (-904.361) (-904.084) [-904.662] * (-903.479) (-904.354) (-903.325) [-901.734] -- 0:00:50
204500 -- (-903.441) [-902.999] (-903.473) (-916.150) * (-902.833) (-904.709) (-904.256) [-903.959] -- 0:00:50
205000 -- [-904.129] (-902.814) (-901.802) (-903.841) * [-903.719] (-902.738) (-903.101) (-904.430) -- 0:00:50
Average standard deviation of split frequencies: 0.014942
205500 -- (-906.017) (-902.077) [-901.066] (-903.079) * (-907.320) (-902.204) (-903.145) [-903.810] -- 0:00:50
206000 -- (-903.226) (-903.429) [-904.389] (-903.018) * (-907.024) [-904.211] (-903.123) (-904.170) -- 0:00:50
206500 -- (-901.589) [-901.542] (-910.132) (-903.592) * (-902.696) (-902.299) (-904.409) [-903.799] -- 0:00:49
207000 -- (-902.473) (-902.178) (-901.819) [-902.204] * (-903.904) (-904.552) (-902.946) [-904.150] -- 0:00:49
207500 -- (-902.447) (-902.640) (-903.837) [-902.243] * (-903.544) (-902.640) [-902.291] (-904.053) -- 0:00:49
208000 -- (-903.042) (-906.985) [-908.411] (-902.201) * (-904.290) (-910.069) (-905.404) [-903.427] -- 0:00:49
208500 -- (-904.825) [-904.970] (-909.242) (-903.710) * (-905.656) [-902.490] (-903.140) (-902.817) -- 0:00:49
209000 -- [-903.751] (-905.801) (-907.271) (-906.698) * [-904.296] (-902.800) (-903.117) (-904.989) -- 0:00:49
209500 -- (-901.661) [-904.324] (-904.084) (-907.790) * (-906.463) (-906.279) [-903.557] (-905.591) -- 0:00:49
210000 -- (-906.956) [-901.492] (-906.448) (-903.741) * (-903.277) [-909.317] (-902.854) (-907.103) -- 0:00:52
Average standard deviation of split frequencies: 0.014794
210500 -- (-902.990) (-903.319) (-907.880) [-908.329] * (-904.635) (-904.628) [-902.947] (-904.981) -- 0:00:52
211000 -- (-902.964) (-902.881) [-902.969] (-903.598) * (-903.431) (-903.706) [-904.244] (-904.057) -- 0:00:52
211500 -- [-902.759] (-902.771) (-904.587) (-903.588) * [-903.397] (-907.364) (-902.275) (-903.366) -- 0:00:52
212000 -- (-903.975) (-902.982) [-905.165] (-902.563) * (-903.353) [-903.041] (-903.865) (-902.596) -- 0:00:52
212500 -- [-905.140] (-904.301) (-903.775) (-903.760) * (-902.645) (-906.806) [-902.730] (-906.718) -- 0:00:51
213000 -- (-911.023) [-904.056] (-905.031) (-903.829) * (-906.416) (-904.637) [-902.986] (-903.099) -- 0:00:51
213500 -- (-905.139) [-903.566] (-906.973) (-902.826) * (-903.387) [-903.738] (-903.031) (-903.474) -- 0:00:51
214000 -- (-904.673) (-903.221) [-907.137] (-902.321) * (-903.799) (-901.397) (-903.407) [-903.022] -- 0:00:51
214500 -- (-906.744) (-903.094) [-905.030] (-905.086) * (-908.424) (-902.639) (-903.131) [-901.916] -- 0:00:51
215000 -- [-900.307] (-902.639) (-901.334) (-905.031) * (-905.804) [-903.019] (-910.257) (-903.400) -- 0:00:51
Average standard deviation of split frequencies: 0.016489
215500 -- (-907.468) (-906.723) [-904.598] (-902.539) * [-904.056] (-907.691) (-904.834) (-906.496) -- 0:00:50
216000 -- (-905.629) [-900.697] (-904.240) (-906.905) * (-901.855) (-902.661) (-901.780) [-905.672] -- 0:00:50
216500 -- (-902.913) (-903.139) (-903.515) [-908.169] * (-902.957) (-902.967) (-903.371) [-905.720] -- 0:00:50
217000 -- (-903.470) [-910.706] (-905.944) (-907.861) * (-910.003) [-902.869] (-902.228) (-906.529) -- 0:00:50
217500 -- (-903.552) (-900.988) [-905.726] (-903.223) * [-902.708] (-903.818) (-902.750) (-907.959) -- 0:00:50
218000 -- [-903.863] (-904.874) (-906.283) (-906.663) * (-902.517) (-906.338) (-902.659) [-906.059] -- 0:00:50
218500 -- [-902.710] (-902.929) (-902.991) (-905.068) * [-903.938] (-907.247) (-902.393) (-903.574) -- 0:00:50
219000 -- (-904.118) [-903.792] (-903.758) (-906.026) * [-904.110] (-902.440) (-906.012) (-904.342) -- 0:00:49
219500 -- (-907.613) (-902.318) [-904.829] (-904.606) * (-901.759) (-903.228) (-909.388) [-904.024] -- 0:00:49
220000 -- [-903.990] (-905.483) (-906.555) (-904.648) * (-902.065) (-902.890) [-910.575] (-903.577) -- 0:00:49
Average standard deviation of split frequencies: 0.015457
220500 -- [-902.179] (-905.451) (-902.147) (-902.315) * (-905.636) (-903.295) [-906.384] (-904.767) -- 0:00:49
221000 -- [-901.962] (-904.998) (-907.228) (-906.264) * [-902.245] (-904.141) (-903.940) (-905.041) -- 0:00:49
221500 -- [-902.226] (-904.134) (-904.267) (-906.243) * (-903.331) (-903.362) (-903.891) [-903.568] -- 0:00:49
222000 -- (-902.616) (-902.731) [-904.830] (-903.053) * (-904.288) (-900.917) [-901.654] (-903.322) -- 0:00:49
222500 -- [-902.854] (-903.652) (-904.938) (-904.922) * (-905.620) [-901.878] (-906.082) (-905.054) -- 0:00:48
223000 -- (-906.999) (-902.627) (-905.502) [-901.986] * (-902.660) [-904.004] (-902.869) (-902.091) -- 0:00:48
223500 -- (-907.536) (-904.074) (-904.094) [-903.417] * (-903.148) [-903.730] (-906.626) (-904.273) -- 0:00:48
224000 -- (-904.623) [-903.872] (-904.841) (-909.793) * (-905.244) [-903.232] (-904.015) (-904.018) -- 0:00:48
224500 -- (-903.696) (-902.835) (-901.791) [-902.647] * (-902.483) (-901.585) [-902.791] (-903.609) -- 0:00:48
225000 -- (-909.002) (-902.083) (-903.498) [-901.092] * (-903.692) (-902.453) [-903.701] (-903.022) -- 0:00:48
Average standard deviation of split frequencies: 0.014846
225500 -- (-906.322) [-901.158] (-901.816) (-901.335) * (-902.947) [-901.297] (-904.213) (-903.895) -- 0:00:51
226000 -- (-902.895) (-901.923) (-902.697) [-903.568] * (-902.053) [-902.507] (-901.833) (-903.991) -- 0:00:51
226500 -- [-904.202] (-902.794) (-903.678) (-903.065) * [-903.007] (-910.104) (-903.171) (-903.758) -- 0:00:51
227000 -- (-902.093) (-903.617) [-901.290] (-903.713) * (-902.577) [-905.667] (-904.390) (-907.620) -- 0:00:51
227500 -- (-905.816) (-903.772) [-901.112] (-902.459) * (-903.368) [-902.710] (-902.024) (-903.786) -- 0:00:50
228000 -- (-910.145) (-905.555) [-902.424] (-909.436) * (-902.606) (-902.000) [-901.237] (-903.136) -- 0:00:50
228500 -- [-903.456] (-902.803) (-901.956) (-907.693) * (-902.080) [-900.436] (-901.535) (-902.105) -- 0:00:50
229000 -- [-902.046] (-903.789) (-902.678) (-902.682) * (-904.113) [-901.974] (-907.277) (-904.458) -- 0:00:50
229500 -- [-903.475] (-903.396) (-901.831) (-903.003) * (-909.028) [-903.310] (-904.236) (-904.645) -- 0:00:50
230000 -- [-904.023] (-905.427) (-902.377) (-903.506) * [-902.480] (-902.932) (-904.507) (-905.707) -- 0:00:50
Average standard deviation of split frequencies: 0.014419
230500 -- [-906.535] (-905.296) (-903.071) (-902.650) * (-900.972) [-904.593] (-903.647) (-904.539) -- 0:00:50
231000 -- [-904.744] (-903.408) (-907.766) (-902.158) * [-903.878] (-906.100) (-905.450) (-910.527) -- 0:00:49
231500 -- (-905.411) (-905.317) (-906.322) [-904.281] * [-903.032] (-903.472) (-906.442) (-907.189) -- 0:00:49
232000 -- (-903.210) (-905.792) (-907.269) [-908.291] * (-902.277) (-906.277) [-903.910] (-904.107) -- 0:00:49
232500 -- [-904.480] (-903.441) (-903.314) (-903.439) * (-903.402) (-905.212) [-904.895] (-902.633) -- 0:00:49
233000 -- (-902.579) [-904.008] (-904.668) (-903.998) * (-905.153) [-902.252] (-903.999) (-904.479) -- 0:00:49
233500 -- [-902.979] (-905.834) (-903.519) (-902.756) * (-904.369) (-903.860) [-905.917] (-908.863) -- 0:00:49
234000 -- (-905.094) (-903.594) (-906.425) [-904.539] * (-904.841) (-902.686) (-902.636) [-903.054] -- 0:00:49
234500 -- (-903.459) [-903.756] (-902.970) (-903.744) * (-905.128) (-904.828) [-903.160] (-904.321) -- 0:00:48
235000 -- (-904.633) [-901.991] (-901.716) (-906.508) * (-901.978) (-905.085) [-904.429] (-905.411) -- 0:00:48
Average standard deviation of split frequencies: 0.014087
235500 -- (-904.456) [-903.601] (-905.829) (-901.953) * (-903.005) [-904.303] (-905.375) (-904.504) -- 0:00:48
236000 -- [-903.504] (-902.877) (-901.682) (-904.829) * [-902.021] (-903.015) (-908.325) (-904.644) -- 0:00:48
236500 -- (-907.152) (-905.566) [-903.371] (-901.817) * (-902.416) (-902.305) [-903.474] (-909.345) -- 0:00:48
237000 -- (-908.690) (-905.485) (-905.398) [-903.743] * [-906.504] (-901.750) (-902.779) (-911.570) -- 0:00:48
237500 -- (-911.190) (-907.657) [-902.368] (-903.488) * (-904.253) (-901.097) (-903.803) [-902.458] -- 0:00:48
238000 -- [-906.779] (-904.686) (-901.966) (-906.958) * (-909.627) (-904.048) [-902.634] (-901.534) -- 0:00:48
238500 -- [-902.882] (-906.124) (-902.036) (-904.222) * (-906.992) [-904.057] (-903.258) (-902.080) -- 0:00:47
239000 -- (-902.830) (-902.733) (-903.998) [-904.744] * (-909.857) (-908.372) [-909.085] (-903.305) -- 0:00:47
239500 -- (-904.245) [-901.432] (-902.878) (-904.373) * [-905.293] (-904.483) (-904.539) (-903.172) -- 0:00:47
240000 -- (-904.677) [-902.607] (-902.351) (-905.811) * (-903.381) (-902.719) (-902.652) [-903.285] -- 0:00:47
Average standard deviation of split frequencies: 0.014172
240500 -- [-904.109] (-906.338) (-902.750) (-902.942) * [-904.048] (-902.927) (-903.271) (-906.903) -- 0:00:50
241000 -- (-915.477) (-903.838) [-904.643] (-902.255) * (-903.018) [-904.020] (-906.552) (-906.471) -- 0:00:50
241500 -- (-906.869) [-901.547] (-905.995) (-904.419) * (-908.376) (-906.404) (-905.469) [-905.327] -- 0:00:50
242000 -- (-905.144) (-903.633) [-902.516] (-904.563) * (-901.655) (-905.794) [-901.300] (-903.302) -- 0:00:50
242500 -- (-904.187) (-902.111) [-903.220] (-903.210) * [-903.358] (-907.114) (-908.972) (-902.799) -- 0:00:49
243000 -- (-903.654) (-902.872) (-904.909) [-904.248] * (-903.845) [-903.967] (-904.079) (-906.434) -- 0:00:49
243500 -- (-900.893) (-902.421) [-904.040] (-902.031) * (-902.103) [-905.506] (-902.031) (-903.657) -- 0:00:49
244000 -- [-900.968] (-903.458) (-901.473) (-903.865) * [-901.600] (-902.828) (-904.970) (-902.391) -- 0:00:49
244500 -- (-902.009) [-906.614] (-904.218) (-904.431) * (-907.407) [-903.162] (-905.754) (-903.596) -- 0:00:49
245000 -- (-903.282) (-902.698) (-904.461) [-903.497] * (-902.019) [-902.829] (-906.524) (-905.575) -- 0:00:49
Average standard deviation of split frequencies: 0.013733
245500 -- (-902.583) [-903.872] (-902.588) (-904.672) * [-905.036] (-901.735) (-905.319) (-906.211) -- 0:00:49
246000 -- [-901.453] (-903.454) (-901.513) (-905.835) * (-904.071) (-905.879) [-903.855] (-906.155) -- 0:00:49
246500 -- (-901.462) (-904.255) (-907.819) [-905.252] * (-904.577) (-903.046) [-903.428] (-905.100) -- 0:00:48
247000 -- (-903.260) (-907.640) [-905.492] (-903.740) * (-901.838) (-902.924) [-905.163] (-906.185) -- 0:00:48
247500 -- (-903.011) [-904.978] (-903.040) (-908.012) * [-902.030] (-903.904) (-904.034) (-906.636) -- 0:00:48
248000 -- (-900.531) [-903.927] (-902.487) (-906.741) * (-902.518) (-907.023) [-902.102] (-904.520) -- 0:00:48
248500 -- (-903.752) (-903.078) (-902.952) [-905.575] * (-903.356) (-906.138) (-904.327) [-903.553] -- 0:00:48
249000 -- (-902.255) (-904.021) [-903.602] (-903.269) * (-902.505) (-904.905) (-902.332) [-905.537] -- 0:00:48
249500 -- [-903.494] (-902.448) (-904.637) (-903.892) * (-903.695) (-903.162) (-903.013) [-902.518] -- 0:00:48
250000 -- [-902.126] (-901.998) (-905.513) (-905.623) * (-909.443) [-903.999] (-906.026) (-902.702) -- 0:00:48
Average standard deviation of split frequencies: 0.013939
250500 -- (-901.127) [-905.711] (-903.973) (-902.846) * [-903.432] (-907.758) (-904.799) (-902.692) -- 0:00:47
251000 -- [-903.035] (-903.535) (-903.473) (-904.034) * (-901.850) (-903.638) [-904.437] (-906.914) -- 0:00:47
251500 -- (-907.599) (-903.199) (-903.686) [-908.231] * [-906.311] (-903.373) (-904.818) (-906.257) -- 0:00:47
252000 -- (-906.730) (-905.474) [-903.456] (-907.075) * (-904.542) [-904.174] (-905.931) (-902.702) -- 0:00:47
252500 -- [-901.947] (-903.537) (-902.809) (-906.917) * (-904.356) (-905.417) [-904.656] (-902.212) -- 0:00:47
253000 -- [-901.788] (-904.283) (-905.713) (-908.183) * (-905.975) (-904.198) (-905.381) [-902.025] -- 0:00:47
253500 -- [-904.455] (-906.034) (-904.081) (-908.481) * (-903.622) (-903.214) [-903.409] (-903.338) -- 0:00:47
254000 -- [-903.360] (-909.521) (-908.643) (-906.873) * (-904.006) [-902.615] (-903.685) (-903.407) -- 0:00:46
254500 -- (-906.229) [-905.419] (-906.107) (-904.141) * [-903.357] (-902.930) (-903.425) (-904.189) -- 0:00:46
255000 -- (-905.957) [-902.506] (-902.446) (-907.563) * (-905.340) [-902.827] (-903.746) (-903.570) -- 0:00:46
Average standard deviation of split frequencies: 0.013432
255500 -- (-901.242) [-908.551] (-906.124) (-904.452) * (-904.093) (-905.878) [-904.569] (-903.137) -- 0:00:46
256000 -- (-902.640) (-902.507) [-905.401] (-905.960) * [-904.198] (-903.153) (-903.737) (-906.739) -- 0:00:49
256500 -- (-903.478) [-902.315] (-904.694) (-903.745) * (-904.906) (-908.388) [-902.847] (-905.689) -- 0:00:49
257000 -- (-902.097) [-901.688] (-906.448) (-903.137) * (-902.145) (-904.892) (-902.680) [-902.495] -- 0:00:49
257500 -- (-904.497) (-902.630) (-903.308) [-903.915] * (-904.686) (-903.738) [-903.107] (-902.789) -- 0:00:49
258000 -- (-901.745) (-903.600) [-902.797] (-902.345) * [-904.283] (-903.163) (-901.881) (-904.533) -- 0:00:48
258500 -- (-903.254) (-903.783) [-902.603] (-907.356) * [-902.751] (-904.771) (-903.675) (-903.924) -- 0:00:48
259000 -- (-903.808) (-902.826) [-902.391] (-902.635) * [-903.177] (-903.014) (-903.142) (-902.527) -- 0:00:48
259500 -- (-903.477) (-901.545) (-905.467) [-902.265] * (-904.694) (-903.412) [-906.854] (-903.222) -- 0:00:48
260000 -- (-901.830) (-902.718) (-907.838) [-901.886] * (-905.108) (-905.937) [-902.718] (-902.965) -- 0:00:48
Average standard deviation of split frequencies: 0.012978
260500 -- (-904.246) [-902.176] (-902.402) (-909.198) * (-910.295) (-903.115) (-903.830) [-902.430] -- 0:00:48
261000 -- (-901.702) (-905.021) (-904.292) [-903.829] * (-910.734) (-902.870) (-902.302) [-901.740] -- 0:00:48
261500 -- [-901.711] (-902.918) (-902.845) (-905.909) * [-902.394] (-905.102) (-902.780) (-903.566) -- 0:00:48
262000 -- (-903.924) (-907.074) [-903.041] (-902.824) * [-903.985] (-903.443) (-902.582) (-901.824) -- 0:00:47
262500 -- (-902.907) [-901.914] (-906.030) (-902.907) * (-901.285) (-907.034) [-902.194] (-904.150) -- 0:00:47
263000 -- (-904.695) [-902.800] (-906.173) (-905.002) * (-903.620) (-904.439) [-902.937] (-905.955) -- 0:00:47
263500 -- [-904.441] (-900.667) (-903.406) (-901.036) * (-902.514) (-902.581) (-905.609) [-903.535] -- 0:00:47
264000 -- [-903.189] (-905.407) (-904.331) (-906.314) * (-904.297) [-905.103] (-903.453) (-903.865) -- 0:00:47
264500 -- (-905.257) (-904.556) [-903.461] (-905.133) * (-906.040) (-905.714) (-902.663) [-902.512] -- 0:00:47
265000 -- (-903.084) [-903.515] (-903.050) (-901.115) * (-901.923) (-905.284) (-904.479) [-901.903] -- 0:00:47
Average standard deviation of split frequencies: 0.013656
265500 -- (-903.601) [-904.506] (-903.328) (-906.013) * (-902.468) (-904.817) (-904.286) [-901.960] -- 0:00:47
266000 -- (-903.914) (-901.116) (-905.182) [-902.852] * (-904.368) [-904.629] (-903.362) (-904.481) -- 0:00:46
266500 -- (-902.774) (-902.041) (-906.374) [-904.888] * (-902.124) (-906.261) [-903.681] (-903.631) -- 0:00:46
267000 -- (-905.061) [-900.842] (-905.826) (-906.394) * (-901.516) [-903.965] (-905.235) (-905.265) -- 0:00:46
267500 -- (-903.038) (-903.215) [-904.096] (-905.031) * [-901.168] (-910.695) (-903.346) (-905.840) -- 0:00:46
268000 -- [-903.032] (-902.074) (-902.162) (-904.516) * (-905.312) [-906.384] (-903.620) (-902.696) -- 0:00:46
268500 -- (-903.132) (-900.673) [-903.568] (-903.741) * (-904.069) (-903.818) [-902.738] (-904.390) -- 0:00:46
269000 -- (-903.610) [-903.464] (-902.658) (-903.981) * (-902.800) [-904.147] (-905.463) (-904.297) -- 0:00:46
269500 -- (-905.804) (-902.497) (-902.853) [-905.594] * (-904.340) (-910.330) [-905.991] (-903.877) -- 0:00:46
270000 -- (-906.353) (-905.164) [-902.461] (-905.299) * (-905.019) [-905.011] (-904.684) (-904.533) -- 0:00:45
Average standard deviation of split frequencies: 0.013933
270500 -- (-907.247) (-905.333) [-903.977] (-905.622) * (-908.363) (-902.789) [-905.356] (-904.667) -- 0:00:45
271000 -- (-907.775) (-903.989) [-903.571] (-900.782) * (-906.559) (-904.023) [-906.025] (-905.159) -- 0:00:45
271500 -- (-909.242) (-902.053) (-903.006) [-901.187] * (-901.938) [-903.141] (-904.104) (-905.308) -- 0:00:48
272000 -- [-901.982] (-903.749) (-904.724) (-901.543) * (-903.194) [-903.487] (-903.758) (-903.065) -- 0:00:48
272500 -- (-903.848) [-903.209] (-906.927) (-902.794) * [-901.867] (-903.633) (-903.585) (-904.344) -- 0:00:48
273000 -- [-903.602] (-906.589) (-903.095) (-905.957) * (-900.854) [-902.258] (-903.701) (-903.732) -- 0:00:47
273500 -- (-903.678) (-904.526) [-904.092] (-905.512) * (-903.903) (-902.505) (-905.564) [-902.681] -- 0:00:47
274000 -- (-903.734) (-901.116) [-905.212] (-905.827) * [-902.663] (-905.634) (-906.039) (-903.511) -- 0:00:47
274500 -- (-902.819) [-901.925] (-903.515) (-903.388) * (-902.377) (-903.729) (-906.554) [-903.538] -- 0:00:47
275000 -- [-904.676] (-903.170) (-903.762) (-902.193) * [-902.228] (-905.739) (-904.300) (-901.424) -- 0:00:47
Average standard deviation of split frequencies: 0.013664
275500 -- (-905.858) [-903.609] (-907.770) (-901.855) * [-901.749] (-904.213) (-904.129) (-907.225) -- 0:00:47
276000 -- (-903.041) [-901.224] (-904.200) (-907.830) * [-902.657] (-903.268) (-906.476) (-902.430) -- 0:00:47
276500 -- (-903.088) (-905.281) (-906.628) [-903.276] * [-901.085] (-905.491) (-908.053) (-905.612) -- 0:00:47
277000 -- (-902.431) (-900.167) [-905.547] (-901.933) * [-900.048] (-906.437) (-905.155) (-900.981) -- 0:00:46
277500 -- (-902.839) (-901.556) [-901.792] (-902.459) * (-904.340) [-903.435] (-902.742) (-902.315) -- 0:00:46
278000 -- (-902.797) [-903.430] (-912.284) (-903.859) * [-902.082] (-905.525) (-903.671) (-902.628) -- 0:00:46
278500 -- (-905.036) (-905.958) [-907.864] (-904.290) * [-905.047] (-904.464) (-902.902) (-902.480) -- 0:00:46
279000 -- (-904.747) (-905.227) [-903.507] (-901.779) * (-903.939) (-905.808) [-903.993] (-904.538) -- 0:00:46
279500 -- (-910.603) [-903.112] (-905.064) (-907.210) * (-905.910) [-902.520] (-901.159) (-906.467) -- 0:00:46
280000 -- (-906.136) [-900.843] (-905.198) (-903.666) * (-908.406) (-903.391) (-904.326) [-901.778] -- 0:00:46
Average standard deviation of split frequencies: 0.013931
280500 -- (-902.497) [-902.586] (-901.455) (-902.336) * (-905.543) (-904.746) [-903.524] (-902.915) -- 0:00:46
281000 -- (-902.432) (-901.663) (-901.936) [-902.932] * (-905.162) (-903.957) [-901.193] (-902.778) -- 0:00:46
281500 -- (-907.180) [-902.437] (-903.920) (-903.979) * (-906.378) (-905.506) (-903.418) [-904.140] -- 0:00:45
282000 -- (-901.855) [-901.882] (-907.696) (-902.146) * [-902.701] (-905.847) (-903.095) (-904.607) -- 0:00:45
282500 -- (-902.807) (-901.939) (-906.553) [-905.989] * (-903.029) (-903.361) (-901.470) [-903.088] -- 0:00:45
283000 -- (-906.646) (-905.799) [-903.225] (-902.666) * [-904.097] (-902.245) (-904.022) (-904.103) -- 0:00:45
283500 -- [-903.592] (-911.203) (-903.236) (-902.069) * (-902.868) (-903.995) (-906.177) [-907.018] -- 0:00:45
284000 -- (-902.757) [-902.314] (-900.466) (-903.936) * [-903.457] (-902.972) (-902.085) (-902.368) -- 0:00:45
284500 -- (-902.774) (-903.514) (-902.880) [-906.051] * (-903.174) (-902.877) [-901.300] (-903.152) -- 0:00:45
285000 -- [-902.572] (-903.710) (-903.714) (-903.365) * [-906.085] (-903.107) (-902.392) (-901.716) -- 0:00:45
Average standard deviation of split frequencies: 0.013003
285500 -- (-904.082) [-904.371] (-904.877) (-912.236) * (-903.217) (-904.933) (-902.270) [-901.554] -- 0:00:45
286000 -- (-910.144) (-906.824) (-905.244) [-905.827] * (-905.368) [-902.820] (-901.583) (-903.192) -- 0:00:44
286500 -- (-904.392) (-903.615) (-904.438) [-904.006] * (-905.744) (-904.820) (-903.347) [-902.835] -- 0:00:47
287000 -- [-905.616] (-903.212) (-904.634) (-904.447) * (-903.619) (-903.520) [-902.873] (-902.214) -- 0:00:47
287500 -- (-903.820) [-903.201] (-903.618) (-902.790) * (-904.668) (-904.796) [-903.394] (-901.991) -- 0:00:47
288000 -- [-903.174] (-903.945) (-903.323) (-904.118) * (-909.714) [-907.583] (-904.324) (-903.065) -- 0:00:46
288500 -- (-903.489) [-903.679] (-903.203) (-907.342) * (-906.944) (-904.269) (-901.574) [-903.659] -- 0:00:46
289000 -- [-902.929] (-903.227) (-905.881) (-905.820) * [-906.795] (-901.676) (-902.765) (-904.840) -- 0:00:46
289500 -- [-905.031] (-904.782) (-901.896) (-902.702) * (-903.560) (-904.654) [-902.041] (-902.575) -- 0:00:46
290000 -- (-905.039) (-905.953) [-903.896] (-905.444) * (-905.344) (-904.094) [-907.517] (-905.278) -- 0:00:46
Average standard deviation of split frequencies: 0.013738
290500 -- [-903.713] (-907.404) (-903.350) (-907.987) * (-904.209) (-901.240) (-904.397) [-907.047] -- 0:00:46
291000 -- (-902.146) (-904.590) (-902.908) [-902.416] * (-906.441) [-901.567] (-902.970) (-902.282) -- 0:00:46
291500 -- (-904.757) [-904.273] (-903.063) (-902.616) * (-906.728) (-901.777) (-903.410) [-903.128] -- 0:00:46
292000 -- (-902.195) (-901.598) (-903.352) [-904.960] * (-905.077) [-903.943] (-903.170) (-905.103) -- 0:00:46
292500 -- (-907.526) (-905.580) (-902.198) [-904.128] * (-904.379) (-903.826) (-902.360) [-907.241] -- 0:00:45
293000 -- (-904.531) (-902.281) [-903.956] (-905.732) * (-904.131) (-903.712) (-902.750) [-903.476] -- 0:00:45
293500 -- (-904.012) [-903.326] (-903.249) (-901.572) * (-903.332) (-904.311) (-902.851) [-906.872] -- 0:00:45
294000 -- (-903.818) [-904.292] (-903.606) (-902.450) * (-904.888) (-903.963) (-902.781) [-902.665] -- 0:00:45
294500 -- (-905.942) (-903.915) [-903.222] (-903.032) * [-906.399] (-907.993) (-907.753) (-905.055) -- 0:00:45
295000 -- (-901.325) [-901.007] (-901.821) (-902.151) * [-903.412] (-902.609) (-904.192) (-906.501) -- 0:00:45
Average standard deviation of split frequencies: 0.013677
295500 -- (-903.888) (-902.021) [-903.513] (-903.212) * [-905.382] (-903.158) (-903.263) (-905.431) -- 0:00:45
296000 -- [-905.670] (-901.246) (-903.777) (-903.697) * (-903.725) [-901.144] (-901.412) (-906.199) -- 0:00:45
296500 -- (-905.606) (-903.899) [-906.068] (-908.678) * [-905.420] (-903.493) (-902.411) (-903.559) -- 0:00:45
297000 -- [-903.306] (-907.181) (-905.216) (-902.455) * (-904.503) (-904.036) [-903.572] (-903.877) -- 0:00:44
297500 -- [-904.778] (-903.888) (-905.245) (-903.672) * (-904.830) (-904.791) [-901.963] (-904.044) -- 0:00:44
298000 -- [-906.065] (-900.679) (-905.500) (-908.057) * (-904.072) (-904.451) [-902.817] (-907.904) -- 0:00:44
298500 -- [-904.132] (-904.109) (-904.113) (-903.167) * (-904.691) (-902.971) [-902.630] (-904.335) -- 0:00:44
299000 -- [-903.699] (-902.722) (-908.170) (-903.830) * [-907.498] (-904.906) (-902.554) (-901.918) -- 0:00:44
299500 -- (-902.286) (-902.994) [-905.481] (-901.977) * (-907.622) (-906.802) [-904.413] (-901.996) -- 0:00:44
300000 -- [-903.406] (-904.604) (-903.807) (-903.804) * (-905.492) (-908.335) [-902.873] (-902.990) -- 0:00:44
Average standard deviation of split frequencies: 0.013281
300500 -- (-901.791) [-904.629] (-905.197) (-903.139) * (-903.604) (-903.512) (-903.510) [-903.437] -- 0:00:44
301000 -- [-903.298] (-906.978) (-904.938) (-904.385) * (-903.805) (-903.895) [-904.361] (-903.032) -- 0:00:44
301500 -- [-902.445] (-909.076) (-906.374) (-905.147) * (-903.620) (-906.989) (-904.636) [-901.812] -- 0:00:46
302000 -- [-904.101] (-906.311) (-901.773) (-904.461) * [-901.128] (-909.089) (-904.527) (-905.375) -- 0:00:46
302500 -- (-903.774) (-903.020) (-904.426) [-905.810] * (-903.592) (-905.773) (-901.648) [-905.524] -- 0:00:46
303000 -- (-902.949) (-906.078) [-903.731] (-905.287) * (-905.368) (-902.990) [-903.982] (-903.631) -- 0:00:46
303500 -- (-902.831) (-906.401) (-904.119) [-903.140] * (-901.826) (-906.758) (-904.299) [-904.720] -- 0:00:45
304000 -- (-903.135) (-907.598) (-903.491) [-903.554] * (-901.362) (-901.806) (-902.254) [-901.616] -- 0:00:45
304500 -- (-903.650) [-905.949] (-903.561) (-907.306) * [-902.673] (-902.591) (-903.693) (-902.601) -- 0:00:45
305000 -- [-908.161] (-902.041) (-903.788) (-902.034) * (-902.585) (-907.547) [-901.989] (-902.236) -- 0:00:45
Average standard deviation of split frequencies: 0.011690
305500 -- (-909.675) [-902.486] (-904.559) (-906.910) * (-901.766) (-905.579) (-903.299) [-904.147] -- 0:00:45
306000 -- (-902.106) (-902.575) (-904.559) [-901.492] * [-904.256] (-906.231) (-903.238) (-909.123) -- 0:00:45
306500 -- (-903.218) (-902.327) (-906.342) [-904.222] * (-907.562) (-902.787) (-904.258) [-903.187] -- 0:00:45
307000 -- (-903.144) [-902.498] (-903.143) (-903.591) * [-902.624] (-902.864) (-903.305) (-906.328) -- 0:00:45
307500 -- (-906.531) (-902.790) [-901.965] (-904.615) * [-904.454] (-905.848) (-908.716) (-906.138) -- 0:00:45
308000 -- (-902.095) (-903.513) (-902.501) [-901.488] * (-903.589) (-905.101) (-904.516) [-901.140] -- 0:00:44
308500 -- (-906.834) (-903.659) [-905.852] (-901.993) * (-904.169) [-902.108] (-903.535) (-901.264) -- 0:00:44
309000 -- (-903.929) [-901.932] (-902.450) (-903.146) * (-903.985) (-900.891) (-905.283) [-902.864] -- 0:00:44
309500 -- (-905.485) (-905.524) (-901.805) [-902.716] * (-902.542) [-902.204] (-902.764) (-902.901) -- 0:00:44
310000 -- [-903.195] (-903.033) (-904.606) (-901.027) * (-902.788) (-904.577) [-902.363] (-902.640) -- 0:00:44
Average standard deviation of split frequencies: 0.012942
310500 -- (-903.660) (-907.314) (-904.247) [-904.958] * (-903.838) [-904.054] (-905.128) (-904.056) -- 0:00:44
311000 -- (-903.096) (-901.431) (-903.666) [-905.886] * [-905.087] (-902.886) (-910.089) (-904.374) -- 0:00:44
311500 -- (-904.391) (-902.538) (-903.747) [-903.772] * [-904.758] (-901.129) (-906.252) (-901.291) -- 0:00:44
312000 -- [-902.675] (-902.638) (-904.725) (-905.420) * (-901.870) [-902.902] (-902.317) (-901.982) -- 0:00:44
312500 -- (-901.467) (-906.403) [-904.428] (-901.594) * (-904.235) (-903.085) [-903.526] (-905.509) -- 0:00:44
313000 -- (-904.354) (-904.146) (-904.299) [-903.394] * (-902.895) [-902.775] (-903.549) (-902.478) -- 0:00:43
313500 -- (-903.555) (-902.558) [-903.914] (-902.847) * (-902.450) (-908.367) (-903.061) [-901.547] -- 0:00:43
314000 -- (-902.845) (-903.639) (-901.343) [-902.838] * (-904.871) [-901.284] (-904.269) (-904.689) -- 0:00:43
314500 -- (-904.508) (-903.525) [-902.226] (-905.489) * (-904.948) (-907.695) [-907.975] (-902.603) -- 0:00:43
315000 -- (-906.891) (-903.198) [-903.150] (-903.070) * (-902.759) [-903.038] (-905.251) (-904.165) -- 0:00:43
Average standard deviation of split frequencies: 0.013338
315500 -- (-904.853) [-901.715] (-902.445) (-903.392) * (-903.227) (-902.819) [-903.353] (-903.643) -- 0:00:43
316000 -- (-903.530) [-903.283] (-902.599) (-902.381) * (-905.030) [-903.219] (-903.134) (-906.233) -- 0:00:43
316500 -- (-902.698) (-901.099) (-904.104) [-901.100] * (-903.787) (-902.912) [-903.465] (-906.364) -- 0:00:43
317000 -- [-904.937] (-906.148) (-902.182) (-908.083) * (-903.291) (-902.921) [-903.231] (-903.079) -- 0:00:45
317500 -- [-903.760] (-904.974) (-903.282) (-903.094) * [-900.425] (-902.503) (-906.724) (-904.703) -- 0:00:45
318000 -- (-901.601) [-902.924] (-903.179) (-905.402) * [-902.616] (-901.605) (-902.081) (-909.174) -- 0:00:45
318500 -- [-904.165] (-908.366) (-904.025) (-905.044) * (-901.640) (-905.015) (-903.467) [-907.182] -- 0:00:44
319000 -- [-902.348] (-903.419) (-902.828) (-904.912) * (-901.964) (-903.954) [-900.879] (-903.868) -- 0:00:44
319500 -- (-903.696) (-907.357) [-902.647] (-903.319) * (-903.850) (-902.434) (-901.884) [-903.856] -- 0:00:44
320000 -- (-902.825) (-905.170) (-904.191) [-902.147] * [-904.305] (-904.098) (-902.937) (-902.733) -- 0:00:44
Average standard deviation of split frequencies: 0.013231
320500 -- (-904.034) (-907.144) [-901.527] (-900.541) * [-901.365] (-906.061) (-908.538) (-905.176) -- 0:00:44
321000 -- (-903.607) [-902.786] (-902.815) (-902.404) * (-902.666) (-904.114) (-904.082) [-903.171] -- 0:00:44
321500 -- (-902.478) [-902.001] (-906.992) (-903.635) * [-902.919] (-906.519) (-903.978) (-903.929) -- 0:00:44
322000 -- (-902.413) [-901.966] (-902.400) (-903.105) * (-905.053) [-902.378] (-905.537) (-905.807) -- 0:00:44
322500 -- (-904.546) [-901.884] (-904.444) (-906.043) * [-901.781] (-905.486) (-906.813) (-902.609) -- 0:00:44
323000 -- [-902.073] (-905.730) (-903.156) (-905.424) * (-902.104) (-908.756) [-903.391] (-903.013) -- 0:00:44
323500 -- (-901.908) (-903.597) (-905.360) [-904.329] * [-903.421] (-905.156) (-902.130) (-905.133) -- 0:00:43
324000 -- [-901.095] (-903.311) (-904.610) (-905.317) * (-910.729) (-903.293) (-904.276) [-907.380] -- 0:00:43
324500 -- (-904.662) [-904.669] (-905.716) (-904.015) * (-902.492) [-904.583] (-906.514) (-907.400) -- 0:00:43
325000 -- (-904.611) [-902.334] (-904.662) (-906.764) * [-902.794] (-907.859) (-903.213) (-903.277) -- 0:00:43
Average standard deviation of split frequencies: 0.013184
325500 -- [-904.552] (-903.147) (-905.408) (-904.947) * (-906.067) (-906.072) [-902.158] (-903.820) -- 0:00:43
326000 -- (-904.275) (-905.346) [-902.501] (-904.887) * (-905.324) (-914.066) [-901.929] (-903.833) -- 0:00:43
326500 -- (-903.395) (-906.763) [-902.381] (-903.740) * (-901.092) (-905.458) [-903.497] (-904.122) -- 0:00:43
327000 -- [-903.522] (-902.088) (-906.401) (-904.383) * (-902.156) (-908.751) (-904.922) [-905.208] -- 0:00:43
327500 -- (-903.176) [-901.844] (-902.355) (-904.885) * (-901.850) (-907.608) (-905.756) [-904.366] -- 0:00:43
328000 -- [-902.085] (-903.165) (-905.280) (-904.587) * (-901.318) (-907.026) (-904.417) [-904.641] -- 0:00:43
328500 -- (-904.255) [-903.809] (-903.613) (-910.595) * (-905.359) [-903.374] (-903.933) (-906.211) -- 0:00:42
329000 -- (-903.052) (-901.929) [-902.865] (-903.025) * [-901.756] (-903.167) (-903.406) (-904.469) -- 0:00:42
329500 -- (-903.194) (-905.146) [-903.151] (-902.315) * (-904.920) (-903.196) [-902.295] (-906.229) -- 0:00:42
330000 -- (-902.714) [-901.938] (-904.718) (-905.009) * (-908.524) [-902.979] (-904.711) (-903.736) -- 0:00:42
Average standard deviation of split frequencies: 0.012831
330500 -- (-903.691) (-902.602) [-904.979] (-901.477) * (-908.918) (-905.263) (-901.133) [-902.753] -- 0:00:42
331000 -- (-904.025) (-902.424) [-903.375] (-904.675) * [-901.598] (-903.136) (-902.005) (-904.451) -- 0:00:42
331500 -- (-903.393) (-903.572) (-902.315) [-905.679] * (-902.035) (-903.616) [-902.665] (-902.350) -- 0:00:42
332000 -- (-901.474) [-905.204] (-902.677) (-909.045) * (-906.388) (-906.715) (-909.099) [-902.630] -- 0:00:44
332500 -- (-903.532) [-903.152] (-902.718) (-904.535) * [-903.833] (-904.444) (-907.361) (-909.354) -- 0:00:44
333000 -- (-902.790) (-904.432) [-903.068] (-903.092) * [-904.169] (-909.374) (-903.750) (-903.275) -- 0:00:44
333500 -- (-901.463) (-905.079) [-903.710] (-903.606) * (-903.253) (-905.184) [-901.266] (-903.136) -- 0:00:43
334000 -- (-902.820) (-903.275) [-903.588] (-903.473) * (-905.659) [-903.939] (-905.183) (-903.457) -- 0:00:43
334500 -- (-903.394) (-906.431) [-903.540] (-903.993) * (-904.888) [-904.518] (-903.943) (-903.529) -- 0:00:43
335000 -- [-905.400] (-904.166) (-904.712) (-906.084) * (-905.953) [-903.386] (-902.412) (-902.551) -- 0:00:43
Average standard deviation of split frequencies: 0.013065
335500 -- (-906.418) [-905.110] (-903.252) (-904.175) * (-904.283) (-902.672) [-904.631] (-900.999) -- 0:00:43
336000 -- [-905.136] (-904.908) (-914.950) (-903.348) * (-903.205) (-903.019) [-905.253] (-904.694) -- 0:00:43
336500 -- [-904.734] (-906.471) (-908.354) (-901.538) * (-905.089) (-904.023) [-906.003] (-904.172) -- 0:00:43
337000 -- (-905.796) (-906.616) [-902.771] (-904.424) * (-901.672) (-904.224) (-905.286) [-903.339] -- 0:00:43
337500 -- (-909.454) (-902.799) [-900.994] (-903.497) * (-903.071) [-906.910] (-902.309) (-905.066) -- 0:00:43
338000 -- (-904.214) (-901.389) (-901.767) [-901.548] * (-903.674) (-904.777) [-902.551] (-910.169) -- 0:00:43
338500 -- (-902.338) [-903.767] (-904.923) (-906.418) * (-903.496) [-905.439] (-902.380) (-905.541) -- 0:00:42
339000 -- (-902.678) [-901.283] (-904.820) (-901.800) * (-906.676) [-903.009] (-905.242) (-906.378) -- 0:00:42
339500 -- (-902.313) [-902.661] (-908.961) (-902.631) * [-903.660] (-903.740) (-905.052) (-906.586) -- 0:00:42
340000 -- (-903.234) [-903.173] (-904.755) (-901.590) * (-904.649) [-905.047] (-903.702) (-907.430) -- 0:00:42
Average standard deviation of split frequencies: 0.013578
340500 -- [-904.919] (-903.920) (-904.561) (-901.761) * (-907.709) [-903.010] (-901.758) (-904.442) -- 0:00:42
341000 -- (-904.375) [-908.225] (-904.434) (-902.193) * (-902.417) [-903.203] (-902.064) (-903.400) -- 0:00:42
341500 -- (-902.859) (-904.719) (-900.367) [-905.435] * (-904.612) (-905.836) [-904.328] (-904.445) -- 0:00:42
342000 -- (-903.630) (-903.743) (-901.874) [-909.304] * (-908.175) (-903.461) (-904.987) [-903.461] -- 0:00:42
342500 -- (-902.974) (-905.063) [-903.143] (-906.200) * (-903.491) (-903.922) (-903.438) [-903.972] -- 0:00:42
343000 -- [-902.632] (-903.622) (-901.817) (-904.159) * (-907.846) [-903.951] (-904.775) (-903.614) -- 0:00:42
343500 -- (-903.740) [-902.475] (-903.718) (-901.782) * (-903.969) [-901.830] (-904.755) (-905.002) -- 0:00:42
344000 -- (-903.172) (-902.753) [-903.095] (-903.235) * [-904.404] (-902.302) (-902.906) (-905.039) -- 0:00:41
344500 -- (-904.295) [-904.862] (-900.886) (-903.273) * [-905.738] (-903.118) (-902.458) (-907.856) -- 0:00:41
345000 -- (-904.414) (-903.768) (-902.064) [-906.048] * (-905.014) (-902.923) [-903.757] (-903.580) -- 0:00:41
Average standard deviation of split frequencies: 0.014220
345500 -- (-906.270) (-903.518) (-907.306) [-906.816] * [-900.779] (-901.366) (-902.490) (-903.483) -- 0:00:41
346000 -- (-904.047) (-903.203) (-903.279) [-902.199] * [-903.113] (-904.651) (-904.188) (-902.652) -- 0:00:41
346500 -- (-903.464) [-903.719] (-902.752) (-902.417) * (-902.867) (-903.889) (-905.153) [-906.999] -- 0:00:41
347000 -- (-903.530) (-904.428) [-903.576] (-904.797) * (-902.038) (-905.198) [-905.894] (-904.855) -- 0:00:41
347500 -- (-903.092) (-906.684) [-902.651] (-905.539) * (-903.902) [-905.999] (-905.169) (-904.358) -- 0:00:43
348000 -- (-903.163) (-908.817) (-903.510) [-905.285] * [-903.260] (-904.485) (-903.976) (-906.516) -- 0:00:43
348500 -- (-903.258) [-902.364] (-904.401) (-907.680) * [-902.469] (-905.259) (-909.832) (-906.885) -- 0:00:42
349000 -- (-903.354) (-904.236) [-904.169] (-903.888) * [-904.803] (-901.958) (-903.860) (-906.377) -- 0:00:42
349500 -- (-901.994) [-903.143] (-901.092) (-904.722) * [-902.625] (-902.516) (-902.549) (-903.665) -- 0:00:42
350000 -- (-902.070) (-904.351) (-904.831) [-903.157] * [-903.051] (-903.883) (-901.594) (-906.039) -- 0:00:42
Average standard deviation of split frequencies: 0.014638
350500 -- [-901.418] (-903.950) (-902.355) (-905.359) * (-907.435) [-908.753] (-905.070) (-905.160) -- 0:00:42
351000 -- (-903.103) (-903.551) (-902.269) [-902.492] * (-908.104) (-902.099) (-903.338) [-906.336] -- 0:00:42
351500 -- (-902.763) (-901.503) (-902.166) [-909.205] * (-907.163) (-903.146) [-903.525] (-905.408) -- 0:00:42
352000 -- [-907.330] (-904.035) (-902.907) (-904.862) * (-907.203) (-902.481) [-901.814] (-907.328) -- 0:00:42
352500 -- [-905.248] (-906.482) (-905.994) (-905.229) * [-903.045] (-903.392) (-904.190) (-904.732) -- 0:00:42
353000 -- (-903.216) (-903.037) (-902.458) [-901.105] * [-906.453] (-905.320) (-902.961) (-904.198) -- 0:00:42
353500 -- (-904.164) (-903.018) [-903.829] (-903.658) * (-904.211) (-904.943) (-902.363) [-903.483] -- 0:00:42
354000 -- (-903.898) (-903.804) (-904.275) [-902.905] * [-905.100] (-903.503) (-907.082) (-904.909) -- 0:00:41
354500 -- (-902.802) [-903.164] (-902.293) (-902.606) * (-903.118) (-905.524) (-903.697) [-904.930] -- 0:00:41
355000 -- (-905.682) [-905.260] (-903.296) (-902.415) * (-903.287) [-903.625] (-904.951) (-902.607) -- 0:00:41
Average standard deviation of split frequencies: 0.013939
355500 -- (-904.430) (-902.461) (-902.315) [-904.008] * [-904.295] (-903.717) (-904.126) (-906.212) -- 0:00:41
356000 -- [-909.237] (-902.750) (-904.857) (-903.301) * (-904.003) (-902.665) (-902.928) [-906.788] -- 0:00:41
356500 -- (-907.532) [-902.880] (-906.522) (-904.338) * (-904.749) [-901.751] (-903.825) (-904.076) -- 0:00:41
357000 -- (-903.098) [-906.082] (-907.727) (-903.485) * (-902.534) (-901.812) [-903.323] (-903.804) -- 0:00:41
357500 -- (-902.790) [-907.584] (-902.137) (-904.625) * [-902.357] (-902.743) (-906.648) (-907.661) -- 0:00:41
358000 -- (-902.942) (-904.905) [-901.263] (-904.059) * (-904.883) [-903.203] (-901.958) (-905.917) -- 0:00:41
358500 -- [-902.497] (-903.928) (-902.685) (-902.901) * [-903.016] (-903.739) (-906.177) (-905.587) -- 0:00:41
359000 -- (-903.342) (-906.810) [-902.717] (-904.659) * (-903.060) [-902.056] (-903.892) (-904.161) -- 0:00:41
359500 -- (-902.677) (-903.956) [-903.133] (-908.140) * (-905.305) (-902.620) [-907.074] (-904.919) -- 0:00:40
360000 -- (-901.916) (-902.924) [-902.044] (-901.866) * (-904.460) [-902.496] (-907.654) (-903.390) -- 0:00:40
Average standard deviation of split frequencies: 0.013479
360500 -- (-904.395) (-902.874) [-905.529] (-904.334) * (-903.695) (-902.799) (-907.815) [-905.359] -- 0:00:40
361000 -- (-905.011) (-905.079) (-905.879) [-904.962] * [-904.051] (-902.232) (-904.113) (-903.152) -- 0:00:40
361500 -- [-904.625] (-905.215) (-905.097) (-903.020) * (-906.180) [-901.044] (-904.653) (-904.629) -- 0:00:40
362000 -- (-903.379) (-905.156) (-902.158) [-904.098] * (-904.517) (-910.974) (-902.752) [-903.987] -- 0:00:40
362500 -- (-903.800) (-902.570) (-903.936) [-902.326] * (-902.988) (-902.630) [-902.868] (-902.479) -- 0:00:40
363000 -- (-903.262) [-904.727] (-903.485) (-903.812) * [-901.631] (-907.588) (-902.866) (-905.608) -- 0:00:42
363500 -- (-904.239) (-902.039) (-905.661) [-903.519] * (-906.817) (-907.820) [-902.420] (-904.298) -- 0:00:42
364000 -- (-904.621) [-903.872] (-905.552) (-908.336) * (-904.037) (-905.579) (-904.562) [-904.880] -- 0:00:41
364500 -- (-900.790) (-902.196) (-904.346) [-901.442] * (-904.463) [-905.182] (-903.817) (-904.672) -- 0:00:41
365000 -- [-902.171] (-903.165) (-902.814) (-902.323) * [-901.602] (-905.146) (-907.076) (-903.184) -- 0:00:41
Average standard deviation of split frequencies: 0.012501
365500 -- [-902.274] (-903.659) (-904.679) (-901.582) * [-903.891] (-902.882) (-904.203) (-906.827) -- 0:00:41
366000 -- (-900.882) (-904.093) [-904.500] (-901.734) * (-902.516) [-904.109] (-905.739) (-904.855) -- 0:00:41
366500 -- (-904.398) (-904.944) (-903.176) [-905.173] * (-903.179) [-904.255] (-904.390) (-901.557) -- 0:00:41
367000 -- (-902.886) [-903.728] (-904.008) (-904.418) * (-901.711) [-902.857] (-902.982) (-901.609) -- 0:00:41
367500 -- [-902.777] (-903.453) (-906.268) (-900.691) * (-903.126) (-903.137) (-903.852) [-904.850] -- 0:00:41
368000 -- (-902.445) (-903.726) (-906.365) [-902.967] * (-904.548) (-904.893) [-903.870] (-904.313) -- 0:00:41
368500 -- [-901.015] (-903.791) (-907.995) (-902.575) * (-905.298) [-904.064] (-905.170) (-904.647) -- 0:00:41
369000 -- (-904.312) [-902.760] (-903.904) (-904.570) * (-903.422) [-903.826] (-906.263) (-909.089) -- 0:00:41
369500 -- (-904.660) [-902.981] (-904.108) (-902.626) * [-905.561] (-902.796) (-905.923) (-903.310) -- 0:00:40
370000 -- (-905.534) (-903.703) [-903.729] (-903.619) * (-908.627) (-906.034) [-903.178] (-902.586) -- 0:00:40
Average standard deviation of split frequencies: 0.012044
370500 -- (-912.253) [-902.961] (-905.024) (-905.105) * (-905.783) (-904.634) (-902.645) [-902.839] -- 0:00:40
371000 -- (-902.651) (-902.649) [-905.106] (-904.570) * (-905.035) (-901.327) [-904.280] (-902.423) -- 0:00:40
371500 -- [-902.660] (-904.262) (-906.755) (-906.332) * (-904.114) [-902.132] (-907.236) (-904.425) -- 0:00:40
372000 -- (-905.114) (-902.506) [-905.199] (-907.367) * (-905.574) (-910.047) [-903.245] (-903.809) -- 0:00:40
372500 -- [-906.465] (-903.715) (-905.378) (-904.228) * (-904.018) (-906.174) [-904.323] (-908.181) -- 0:00:40
373000 -- (-903.570) (-903.836) [-904.938] (-902.479) * (-904.073) (-904.172) (-902.572) [-906.548] -- 0:00:40
373500 -- (-906.355) (-902.743) [-902.457] (-906.138) * (-903.488) (-902.656) [-902.850] (-907.465) -- 0:00:40
374000 -- [-903.644] (-903.316) (-906.440) (-903.152) * (-902.178) (-901.351) (-904.561) [-905.039] -- 0:00:40
374500 -- (-905.071) (-903.661) (-903.411) [-902.801] * (-904.807) (-906.424) [-902.457] (-901.239) -- 0:00:40
375000 -- (-906.761) (-900.590) (-905.701) [-903.851] * (-905.320) (-902.503) [-903.694] (-901.907) -- 0:00:40
Average standard deviation of split frequencies: 0.011431
375500 -- [-904.862] (-900.581) (-902.422) (-901.989) * (-902.066) (-904.457) [-903.277] (-903.785) -- 0:00:39
376000 -- [-904.396] (-903.547) (-903.302) (-902.067) * (-902.916) (-904.975) (-901.884) [-905.437] -- 0:00:39
376500 -- (-904.143) (-902.215) (-904.557) [-902.122] * (-905.085) (-902.756) (-907.467) [-903.220] -- 0:00:39
377000 -- (-905.550) (-905.585) [-901.627] (-903.009) * (-902.385) (-905.279) [-907.198] (-903.399) -- 0:00:39
377500 -- (-903.137) [-902.009] (-902.413) (-903.869) * [-901.953] (-906.939) (-904.350) (-904.437) -- 0:00:39
378000 -- [-907.070] (-904.229) (-902.498) (-903.418) * (-903.092) [-900.845] (-907.837) (-902.060) -- 0:00:39
378500 -- (-903.326) (-900.964) [-904.545] (-903.447) * [-902.898] (-901.822) (-904.887) (-903.134) -- 0:00:41
379000 -- (-906.620) (-906.536) (-905.277) [-902.976] * (-902.878) (-908.788) [-901.775] (-901.496) -- 0:00:40
379500 -- (-907.903) (-910.162) (-905.769) [-901.072] * (-904.020) [-904.843] (-903.100) (-902.438) -- 0:00:40
380000 -- [-906.217] (-904.783) (-902.801) (-903.384) * (-903.551) (-906.715) (-907.996) [-905.335] -- 0:00:40
Average standard deviation of split frequencies: 0.012602
380500 -- (-902.335) (-902.532) (-903.343) [-903.884] * (-903.972) (-910.197) [-904.094] (-902.564) -- 0:00:40
381000 -- (-902.502) (-907.375) [-903.882] (-903.933) * (-902.267) (-912.211) [-905.539] (-903.852) -- 0:00:40
381500 -- (-903.122) (-907.249) (-905.540) [-901.116] * [-904.141] (-904.741) (-905.412) (-903.262) -- 0:00:40
382000 -- (-903.801) (-906.435) (-906.239) [-906.252] * (-904.687) (-910.688) (-904.442) [-902.454] -- 0:00:40
382500 -- (-905.332) [-901.795] (-906.734) (-903.581) * [-903.804] (-911.532) (-907.515) (-903.474) -- 0:00:40
383000 -- (-905.411) [-901.710] (-904.250) (-906.535) * (-902.084) (-908.708) (-902.480) [-901.477] -- 0:00:40
383500 -- (-904.832) (-902.385) (-903.424) [-904.465] * (-904.840) (-902.885) [-902.522] (-903.394) -- 0:00:40
384000 -- [-905.867] (-903.565) (-905.064) (-905.924) * (-902.610) (-903.495) [-903.071] (-902.818) -- 0:00:40
384500 -- [-903.798] (-903.878) (-903.214) (-903.691) * [-903.226] (-905.348) (-903.177) (-904.724) -- 0:00:40
385000 -- (-901.934) (-905.018) (-905.534) [-900.839] * [-903.103] (-903.662) (-902.211) (-905.165) -- 0:00:39
Average standard deviation of split frequencies: 0.012213
385500 -- (-903.771) [-908.529] (-904.117) (-905.972) * [-903.201] (-902.611) (-906.693) (-902.535) -- 0:00:39
386000 -- (-902.465) (-906.851) [-904.735] (-903.222) * [-907.001] (-904.553) (-902.816) (-903.636) -- 0:00:39
386500 -- (-904.286) (-907.839) [-908.558] (-905.190) * (-905.856) (-903.193) [-903.637] (-903.755) -- 0:00:39
387000 -- (-902.765) (-903.953) (-904.606) [-902.948] * (-906.955) (-904.072) [-902.257] (-905.328) -- 0:00:39
387500 -- (-904.522) (-905.515) [-904.409] (-902.867) * (-906.531) (-904.327) (-904.166) [-904.441] -- 0:00:39
388000 -- (-905.416) (-904.047) [-902.976] (-904.020) * (-906.518) (-903.813) [-900.712] (-902.309) -- 0:00:39
388500 -- (-902.763) (-903.203) [-904.440] (-906.437) * [-902.741] (-903.099) (-904.430) (-907.267) -- 0:00:39
389000 -- (-903.616) [-902.820] (-904.006) (-902.891) * (-907.836) (-903.132) (-905.595) [-904.008] -- 0:00:39
389500 -- (-909.158) [-902.352] (-906.739) (-904.783) * [-903.926] (-903.900) (-903.880) (-904.085) -- 0:00:39
390000 -- (-904.983) (-906.497) [-904.547] (-903.611) * (-903.850) (-903.225) (-904.136) [-904.125] -- 0:00:39
Average standard deviation of split frequencies: 0.011925
390500 -- (-902.848) (-903.159) [-909.127] (-902.461) * (-902.462) [-901.369] (-902.932) (-901.727) -- 0:00:39
391000 -- [-903.423] (-905.713) (-907.199) (-904.191) * (-904.453) (-903.587) (-902.395) [-906.889] -- 0:00:38
391500 -- (-903.247) (-903.881) (-907.682) [-904.233] * (-904.885) (-902.067) (-902.944) [-905.811] -- 0:00:38
392000 -- (-901.994) (-906.724) [-904.447] (-907.828) * (-901.740) [-903.914] (-902.604) (-904.935) -- 0:00:38
392500 -- [-901.949] (-904.783) (-902.851) (-901.894) * [-902.865] (-903.264) (-904.351) (-904.592) -- 0:00:38
393000 -- (-903.987) [-903.207] (-904.625) (-903.330) * (-905.592) (-904.331) [-906.574] (-906.143) -- 0:00:38
393500 -- (-907.315) (-904.238) (-903.275) [-902.217] * [-901.978] (-904.306) (-902.970) (-904.718) -- 0:00:38
394000 -- (-908.956) (-904.117) (-903.677) [-902.022] * (-904.467) [-903.629] (-904.411) (-904.553) -- 0:00:39
394500 -- (-908.385) (-902.048) [-902.217] (-902.692) * [-905.041] (-906.861) (-903.714) (-904.558) -- 0:00:39
395000 -- (-905.591) (-904.541) (-904.220) [-901.198] * (-903.660) (-903.741) [-903.339] (-904.343) -- 0:00:39
Average standard deviation of split frequencies: 0.012797
395500 -- (-903.039) [-905.589] (-906.553) (-906.749) * [-904.055] (-905.890) (-903.892) (-901.710) -- 0:00:39
396000 -- (-904.294) (-903.803) (-905.805) [-905.952] * [-902.355] (-906.681) (-904.221) (-901.471) -- 0:00:39
396500 -- (-907.754) [-903.890] (-904.398) (-905.031) * (-904.210) (-904.655) (-902.840) [-901.398] -- 0:00:39
397000 -- [-908.732] (-907.042) (-905.364) (-906.303) * [-904.868] (-903.544) (-904.136) (-904.506) -- 0:00:39
397500 -- (-903.073) (-904.253) (-902.887) [-903.522] * (-902.414) [-902.044] (-901.947) (-904.813) -- 0:00:39
398000 -- (-905.573) (-905.596) [-902.849] (-904.389) * (-904.376) (-902.587) (-903.391) [-903.826] -- 0:00:39
398500 -- (-908.060) (-901.705) (-907.505) [-901.681] * [-905.902] (-901.861) (-902.417) (-903.679) -- 0:00:39
399000 -- (-905.823) (-901.493) (-904.108) [-900.647] * (-903.871) [-905.073] (-904.745) (-903.733) -- 0:00:39
399500 -- [-904.518] (-905.192) (-903.456) (-900.317) * [-902.369] (-905.808) (-903.905) (-905.809) -- 0:00:39
400000 -- (-904.438) (-902.164) (-904.205) [-903.200] * (-903.197) (-907.401) (-903.226) [-905.489] -- 0:00:39
Average standard deviation of split frequencies: 0.011618
400500 -- [-905.544] (-904.138) (-909.455) (-904.237) * (-902.815) [-907.582] (-905.579) (-902.846) -- 0:00:38
401000 -- (-906.120) [-906.408] (-911.296) (-905.708) * (-903.857) (-904.140) [-903.531] (-903.282) -- 0:00:38
401500 -- (-903.262) (-902.925) (-907.361) [-902.360] * [-902.804] (-903.340) (-903.227) (-904.748) -- 0:00:38
402000 -- (-903.947) [-902.944] (-906.836) (-903.601) * (-908.670) (-902.856) [-905.045] (-902.708) -- 0:00:38
402500 -- (-902.892) [-901.812] (-907.524) (-902.788) * [-904.752] (-900.981) (-905.771) (-904.083) -- 0:00:38
403000 -- (-904.100) (-903.069) (-906.002) [-901.880] * [-904.424] (-902.130) (-902.285) (-914.329) -- 0:00:38
403500 -- (-902.791) (-901.314) (-904.395) [-906.376] * [-903.360] (-908.933) (-902.620) (-903.532) -- 0:00:38
404000 -- (-903.334) [-900.843] (-904.909) (-902.776) * [-903.251] (-902.715) (-903.074) (-903.183) -- 0:00:38
404500 -- (-902.738) (-903.932) (-903.406) [-902.217] * (-902.974) (-904.498) [-905.586] (-904.040) -- 0:00:38
405000 -- (-903.276) (-904.630) [-902.699] (-904.518) * [-904.910] (-905.130) (-903.363) (-904.399) -- 0:00:38
Average standard deviation of split frequencies: 0.011901
405500 -- (-903.433) (-904.766) (-907.714) [-904.310] * (-904.785) [-903.442] (-901.742) (-905.224) -- 0:00:38
406000 -- (-903.013) [-902.839] (-903.511) (-903.547) * [-907.420] (-902.705) (-903.975) (-905.917) -- 0:00:38
406500 -- [-902.525] (-902.319) (-904.379) (-901.240) * (-904.199) (-903.297) (-905.723) [-902.835] -- 0:00:37
407000 -- (-903.701) (-902.015) [-903.943] (-902.022) * (-904.381) [-903.689] (-909.352) (-905.229) -- 0:00:37
407500 -- (-904.777) (-902.146) [-902.103] (-902.004) * (-905.173) (-903.741) (-904.407) [-904.319] -- 0:00:37
408000 -- (-901.687) [-901.578] (-902.348) (-905.013) * (-907.140) [-902.335] (-904.531) (-904.983) -- 0:00:37
408500 -- [-901.941] (-904.085) (-904.842) (-902.123) * [-902.799] (-904.401) (-902.749) (-908.409) -- 0:00:37
409000 -- (-905.006) (-904.866) [-904.056] (-903.269) * (-903.393) [-901.563] (-902.966) (-904.341) -- 0:00:37
409500 -- [-905.307] (-901.926) (-908.005) (-902.981) * (-903.790) (-902.382) [-902.803] (-903.172) -- 0:00:38
410000 -- (-904.681) (-904.182) [-903.001] (-902.957) * (-901.874) (-907.959) [-904.548] (-902.273) -- 0:00:38
Average standard deviation of split frequencies: 0.012053
410500 -- (-906.256) (-904.091) [-903.520] (-902.380) * (-902.816) [-907.627] (-905.419) (-903.906) -- 0:00:38
411000 -- (-904.686) [-902.918] (-903.760) (-906.173) * [-909.114] (-906.227) (-902.586) (-904.855) -- 0:00:38
411500 -- [-902.867] (-902.600) (-903.911) (-902.761) * (-904.995) [-902.426] (-905.019) (-909.355) -- 0:00:38
412000 -- [-902.658] (-905.671) (-903.983) (-905.057) * (-902.931) [-901.414] (-903.517) (-905.498) -- 0:00:38
412500 -- [-906.742] (-902.597) (-905.977) (-903.104) * (-903.933) (-903.357) [-901.539] (-906.482) -- 0:00:38
413000 -- [-904.613] (-905.198) (-905.172) (-904.069) * (-904.308) [-901.746] (-902.243) (-902.966) -- 0:00:38
413500 -- [-905.261] (-906.974) (-903.590) (-906.400) * (-903.136) (-904.393) (-904.875) [-905.629] -- 0:00:38
414000 -- (-902.555) [-902.172] (-902.802) (-905.532) * (-902.888) (-906.297) [-901.785] (-904.871) -- 0:00:38
414500 -- (-903.838) (-901.831) [-904.682] (-905.687) * (-902.330) (-905.729) (-907.333) [-903.617] -- 0:00:38
415000 -- (-908.645) (-903.634) [-904.351] (-911.505) * (-904.700) [-905.136] (-903.425) (-902.311) -- 0:00:38
Average standard deviation of split frequencies: 0.010907
415500 -- (-904.784) [-902.536] (-903.970) (-900.461) * (-904.352) (-905.172) [-904.432] (-902.703) -- 0:00:37
416000 -- (-903.116) [-906.466] (-904.618) (-903.271) * [-901.047] (-904.505) (-901.390) (-904.192) -- 0:00:37
416500 -- (-904.043) [-903.012] (-904.523) (-901.495) * (-907.463) (-903.749) (-902.923) [-904.529] -- 0:00:37
417000 -- (-908.240) (-903.368) [-905.259] (-904.109) * (-903.435) [-907.106] (-903.365) (-905.193) -- 0:00:37
417500 -- (-903.632) (-902.675) (-903.286) [-901.149] * (-903.098) (-906.798) (-909.088) [-902.975] -- 0:00:37
418000 -- [-904.723] (-903.673) (-905.090) (-903.447) * (-903.695) (-905.322) (-903.201) [-903.305] -- 0:00:37
418500 -- (-903.668) [-903.749] (-902.776) (-903.688) * (-903.817) (-902.315) (-905.199) [-903.301] -- 0:00:37
419000 -- (-903.540) (-904.996) (-902.965) [-901.791] * [-901.766] (-904.892) (-903.152) (-904.658) -- 0:00:37
419500 -- (-902.152) (-903.516) [-902.994] (-901.963) * (-902.917) [-902.330] (-906.322) (-904.903) -- 0:00:37
420000 -- [-903.524] (-903.880) (-903.652) (-902.650) * (-904.468) (-903.134) [-905.363] (-905.574) -- 0:00:37
Average standard deviation of split frequencies: 0.010926
420500 -- (-904.324) [-902.799] (-903.802) (-902.155) * (-904.677) [-903.567] (-903.497) (-904.662) -- 0:00:37
421000 -- (-903.347) (-902.241) (-906.677) [-901.874] * [-904.554] (-901.522) (-903.320) (-904.555) -- 0:00:37
421500 -- (-904.194) (-903.398) [-906.935] (-906.832) * (-903.921) (-904.296) [-903.151] (-906.786) -- 0:00:37
422000 -- [-902.842] (-901.827) (-905.401) (-903.120) * (-901.890) [-903.823] (-902.703) (-904.077) -- 0:00:36
422500 -- (-902.279) (-904.032) (-903.020) [-902.536] * [-902.630] (-903.143) (-903.841) (-904.924) -- 0:00:36
423000 -- (-906.600) (-902.675) [-903.071] (-903.279) * (-903.473) (-901.948) [-903.130] (-906.888) -- 0:00:36
423500 -- [-902.526] (-902.389) (-903.932) (-902.367) * (-904.120) [-901.706] (-903.123) (-904.281) -- 0:00:36
424000 -- [-906.587] (-905.228) (-903.033) (-904.091) * (-906.520) (-903.880) [-901.861] (-909.171) -- 0:00:36
424500 -- (-903.636) (-903.307) [-902.586] (-901.883) * [-903.760] (-904.183) (-904.797) (-902.976) -- 0:00:37
425000 -- (-904.226) [-905.071] (-902.660) (-905.119) * (-904.156) (-905.620) [-905.706] (-903.865) -- 0:00:37
Average standard deviation of split frequencies: 0.011204
425500 -- [-902.735] (-906.349) (-903.493) (-903.681) * (-905.595) [-904.913] (-905.525) (-905.215) -- 0:00:37
426000 -- (-903.389) (-905.244) (-902.227) [-902.214] * (-910.073) [-901.895] (-903.386) (-906.346) -- 0:00:37
426500 -- (-904.097) [-905.694] (-903.683) (-904.102) * [-910.543] (-902.200) (-905.762) (-903.754) -- 0:00:37
427000 -- (-905.071) (-903.196) (-903.498) [-903.704] * (-902.484) (-903.827) [-904.217] (-904.404) -- 0:00:37
427500 -- (-904.084) [-903.109] (-905.551) (-902.701) * (-901.640) (-903.708) (-904.411) [-904.708] -- 0:00:37
428000 -- (-903.138) (-903.587) [-904.916] (-902.239) * (-904.600) (-905.450) [-905.745] (-903.668) -- 0:00:37
428500 -- (-902.376) (-903.324) (-904.873) [-903.510] * (-904.193) (-902.736) (-900.317) [-901.785] -- 0:00:37
429000 -- (-902.588) (-902.765) (-902.773) [-904.518] * [-904.044] (-904.702) (-901.760) (-902.790) -- 0:00:37
429500 -- (-903.319) [-903.287] (-903.229) (-906.147) * (-902.694) (-904.915) [-906.590] (-902.787) -- 0:00:37
430000 -- (-903.619) (-901.665) (-907.948) [-905.268] * (-905.677) [-907.485] (-905.793) (-903.192) -- 0:00:37
Average standard deviation of split frequencies: 0.010467
430500 -- [-904.293] (-903.171) (-906.504) (-903.717) * (-903.770) [-902.390] (-908.792) (-902.861) -- 0:00:37
431000 -- (-904.513) (-904.253) [-905.613] (-903.551) * (-905.498) [-902.195] (-902.423) (-903.055) -- 0:00:36
431500 -- (-906.333) [-905.255] (-907.098) (-903.776) * (-902.256) (-902.616) (-904.683) [-905.397] -- 0:00:36
432000 -- (-905.829) [-903.110] (-907.033) (-904.269) * (-903.363) [-903.944] (-903.209) (-903.097) -- 0:00:36
432500 -- (-903.293) (-908.145) [-902.631] (-902.457) * (-905.886) [-905.675] (-904.561) (-902.485) -- 0:00:36
433000 -- (-904.283) (-900.804) [-903.861] (-903.073) * (-904.089) (-904.736) (-904.088) [-902.232] -- 0:00:36
433500 -- (-905.481) (-904.186) [-902.880] (-908.718) * [-902.395] (-900.724) (-902.512) (-903.454) -- 0:00:36
434000 -- (-904.566) (-904.458) (-902.689) [-902.744] * (-903.419) (-902.302) [-904.505] (-903.592) -- 0:00:36
434500 -- (-911.246) [-904.020] (-903.385) (-904.327) * (-902.748) [-904.540] (-904.893) (-902.639) -- 0:00:36
435000 -- (-908.069) (-904.241) (-903.572) [-901.582] * (-902.888) (-904.996) [-903.554] (-902.472) -- 0:00:36
Average standard deviation of split frequencies: 0.011285
435500 -- (-904.251) (-902.109) [-904.087] (-902.084) * [-901.573] (-904.944) (-901.687) (-902.555) -- 0:00:36
436000 -- (-903.178) (-902.518) (-903.466) [-903.634] * [-901.580] (-902.757) (-902.270) (-903.960) -- 0:00:36
436500 -- (-908.002) [-902.274] (-904.551) (-903.817) * (-902.077) (-903.710) [-902.497] (-903.715) -- 0:00:36
437000 -- (-904.439) (-903.727) (-906.119) [-903.303] * (-904.373) [-904.328] (-902.921) (-905.574) -- 0:00:36
437500 -- (-903.044) (-901.902) (-904.843) [-902.402] * [-901.395] (-903.829) (-902.707) (-903.421) -- 0:00:36
438000 -- [-903.485] (-904.722) (-904.274) (-903.789) * (-902.770) (-907.319) [-903.526] (-903.584) -- 0:00:35
438500 -- (-904.247) [-904.049] (-905.498) (-910.236) * (-900.399) (-903.146) (-902.723) [-902.838] -- 0:00:35
439000 -- (-903.563) (-904.448) [-906.697] (-905.009) * [-902.121] (-902.746) (-903.181) (-902.719) -- 0:00:35
439500 -- (-903.401) (-908.284) (-903.505) [-904.008] * (-903.262) [-905.087] (-902.511) (-902.618) -- 0:00:35
440000 -- (-903.135) [-905.428] (-902.597) (-904.403) * (-900.836) (-906.217) [-901.683] (-902.309) -- 0:00:36
Average standard deviation of split frequencies: 0.010631
440500 -- (-902.518) (-905.376) (-903.952) [-901.534] * (-905.545) (-905.112) [-908.784] (-905.010) -- 0:00:36
441000 -- (-903.766) (-902.217) (-902.908) [-902.681] * (-904.248) (-904.840) [-905.811] (-905.795) -- 0:00:36
441500 -- (-906.988) (-902.719) (-902.748) [-902.069] * (-902.822) (-904.540) (-907.709) [-904.614] -- 0:00:36
442000 -- (-902.378) (-903.180) [-905.770] (-903.821) * (-905.619) (-903.861) [-904.418] (-904.825) -- 0:00:36
442500 -- [-906.543] (-903.103) (-905.492) (-902.487) * [-904.661] (-905.996) (-903.519) (-902.614) -- 0:00:36
443000 -- (-906.778) (-904.019) (-903.430) [-902.892] * (-904.851) (-904.128) (-903.757) [-904.873] -- 0:00:36
443500 -- (-905.310) (-905.651) [-903.583] (-905.544) * (-907.001) (-903.509) [-902.773] (-907.748) -- 0:00:36
444000 -- (-904.103) (-904.222) [-902.821] (-905.015) * (-902.097) [-903.993] (-903.356) (-909.488) -- 0:00:36
444500 -- [-902.611] (-904.926) (-908.929) (-903.283) * [-903.543] (-903.884) (-903.510) (-903.408) -- 0:00:36
445000 -- (-903.959) (-902.107) (-904.570) [-902.392] * (-903.716) (-903.242) [-905.093] (-901.835) -- 0:00:36
Average standard deviation of split frequencies: 0.010259
445500 -- (-904.469) (-902.022) (-904.140) [-903.199] * (-901.615) [-902.379] (-909.224) (-902.098) -- 0:00:36
446000 -- (-904.639) [-901.955] (-904.786) (-904.463) * (-903.381) (-903.734) (-909.339) [-902.978] -- 0:00:36
446500 -- (-903.214) (-902.666) [-903.382] (-903.969) * (-901.870) (-904.364) (-902.803) [-903.183] -- 0:00:35
447000 -- (-904.132) [-901.064] (-904.852) (-905.048) * [-904.310] (-904.342) (-905.198) (-904.576) -- 0:00:35
447500 -- [-903.344] (-902.794) (-905.179) (-902.893) * [-905.215] (-904.911) (-904.086) (-902.235) -- 0:00:35
448000 -- (-905.758) (-901.080) [-904.396] (-902.530) * (-900.602) (-907.391) (-904.920) [-902.474] -- 0:00:35
448500 -- (-903.411) [-907.538] (-903.217) (-903.786) * [-904.349] (-904.568) (-908.307) (-908.094) -- 0:00:35
449000 -- [-902.117] (-906.450) (-904.483) (-901.667) * [-902.168] (-903.147) (-907.772) (-908.161) -- 0:00:35
449500 -- (-904.613) [-905.340] (-903.948) (-902.100) * (-903.989) (-902.784) (-905.995) [-903.890] -- 0:00:35
450000 -- (-905.314) [-902.360] (-908.024) (-903.377) * (-903.862) (-912.443) (-901.321) [-903.043] -- 0:00:35
Average standard deviation of split frequencies: 0.009545
450500 -- (-902.117) [-901.968] (-904.198) (-901.691) * [-901.543] (-907.332) (-902.926) (-904.292) -- 0:00:35
451000 -- (-906.588) (-900.479) (-903.873) [-902.745] * (-904.825) (-905.471) [-903.306] (-903.652) -- 0:00:35
451500 -- (-903.651) (-903.031) (-905.232) [-903.842] * [-905.761] (-901.884) (-903.759) (-902.734) -- 0:00:35
452000 -- (-903.703) (-902.269) (-905.979) [-904.525] * (-906.042) (-903.866) [-903.139] (-901.282) -- 0:00:35
452500 -- (-905.612) (-907.770) (-903.436) [-905.449] * (-902.633) [-904.032] (-903.626) (-902.640) -- 0:00:35
453000 -- (-902.738) (-903.613) (-905.878) [-903.538] * [-903.346] (-908.453) (-910.752) (-904.316) -- 0:00:35
453500 -- (-907.255) [-905.109] (-906.074) (-902.602) * (-905.776) (-904.063) [-904.613] (-905.948) -- 0:00:34
454000 -- [-904.102] (-905.467) (-911.610) (-904.523) * [-902.350] (-908.097) (-903.803) (-902.158) -- 0:00:34
454500 -- (-903.235) [-901.982] (-905.318) (-902.381) * [-903.115] (-906.690) (-908.657) (-903.884) -- 0:00:34
455000 -- [-902.334] (-902.642) (-904.459) (-901.271) * [-903.756] (-904.958) (-902.858) (-902.185) -- 0:00:34
Average standard deviation of split frequencies: 0.010015
455500 -- (-906.757) (-901.638) [-903.486] (-903.282) * (-904.115) [-902.959] (-903.659) (-905.922) -- 0:00:35
456000 -- (-906.014) (-902.219) (-903.300) [-902.970] * (-903.116) (-906.209) (-904.382) [-909.614] -- 0:00:35
456500 -- (-904.096) (-903.168) (-902.489) [-903.188] * [-902.150] (-902.895) (-902.888) (-906.919) -- 0:00:35
457000 -- (-910.492) [-902.479] (-905.291) (-902.984) * [-904.514] (-903.554) (-903.058) (-905.421) -- 0:00:35
457500 -- [-904.362] (-905.207) (-903.180) (-904.098) * (-904.368) (-903.620) [-905.279] (-901.888) -- 0:00:35
458000 -- (-905.732) [-904.547] (-903.015) (-907.947) * [-903.126] (-902.283) (-904.288) (-903.506) -- 0:00:35
458500 -- (-904.081) (-902.735) [-903.064] (-902.765) * (-905.612) (-902.253) (-903.235) [-903.669] -- 0:00:35
459000 -- [-904.221] (-903.721) (-904.012) (-907.041) * [-904.232] (-902.842) (-903.405) (-901.947) -- 0:00:35
459500 -- [-902.813] (-905.621) (-906.650) (-902.456) * [-902.660] (-902.350) (-903.588) (-906.797) -- 0:00:35
460000 -- (-902.984) (-905.807) (-903.060) [-902.305] * [-903.762] (-904.351) (-905.371) (-901.914) -- 0:00:35
Average standard deviation of split frequencies: 0.010169
460500 -- (-905.149) (-906.398) (-908.297) [-901.803] * [-907.119] (-904.394) (-904.397) (-906.536) -- 0:00:35
461000 -- (-904.596) (-902.576) (-910.609) [-902.632] * [-902.373] (-904.602) (-904.869) (-902.328) -- 0:00:35
461500 -- [-904.583] (-905.472) (-905.330) (-902.289) * (-905.118) (-904.293) (-907.007) [-902.038] -- 0:00:35
462000 -- [-902.261] (-903.833) (-904.558) (-902.800) * (-910.075) [-902.064] (-918.863) (-908.042) -- 0:00:34
462500 -- (-902.014) [-901.689] (-906.020) (-901.976) * (-902.377) (-902.199) [-903.520] (-906.304) -- 0:00:34
463000 -- (-902.529) [-904.065] (-904.624) (-902.977) * (-904.207) (-903.162) [-903.838] (-902.793) -- 0:00:34
463500 -- (-903.341) [-903.891] (-904.423) (-902.464) * (-905.473) (-904.640) (-904.538) [-904.969] -- 0:00:34
464000 -- (-903.626) [-901.746] (-902.566) (-901.589) * (-903.333) (-904.344) (-903.504) [-903.284] -- 0:00:34
464500 -- (-907.854) [-902.719] (-903.564) (-905.127) * (-905.373) [-903.709] (-902.078) (-903.346) -- 0:00:34
465000 -- (-904.258) (-904.155) (-901.555) [-903.759] * (-903.187) (-903.764) (-903.435) [-902.379] -- 0:00:34
Average standard deviation of split frequencies: 0.011187
465500 -- [-902.570] (-903.952) (-905.649) (-905.629) * [-905.817] (-904.297) (-904.440) (-903.136) -- 0:00:34
466000 -- (-904.878) [-903.390] (-901.104) (-905.055) * (-905.105) (-908.333) (-907.371) [-900.719] -- 0:00:34
466500 -- (-909.355) [-902.020] (-902.286) (-903.079) * [-903.039] (-901.942) (-904.247) (-905.533) -- 0:00:34
467000 -- [-903.954] (-902.278) (-903.396) (-905.461) * (-905.072) (-902.603) [-903.947] (-903.984) -- 0:00:34
467500 -- (-904.031) (-902.238) [-905.241] (-901.139) * (-903.407) [-902.795] (-903.027) (-905.563) -- 0:00:34
468000 -- (-905.665) (-901.200) (-904.029) [-901.841] * (-902.500) [-904.263] (-902.585) (-903.343) -- 0:00:34
468500 -- [-907.524] (-903.438) (-903.094) (-902.300) * (-901.569) (-904.665) (-902.832) [-902.694] -- 0:00:34
469000 -- [-904.242] (-902.362) (-903.240) (-904.094) * (-902.713) (-903.625) [-901.190] (-901.571) -- 0:00:33
469500 -- [-902.818] (-901.082) (-903.008) (-904.297) * [-904.345] (-905.742) (-902.674) (-906.013) -- 0:00:33
470000 -- [-902.830] (-902.504) (-904.597) (-905.582) * (-903.177) (-903.366) [-900.867] (-903.661) -- 0:00:33
Average standard deviation of split frequencies: 0.011076
470500 -- [-902.369] (-907.197) (-905.181) (-902.826) * (-905.859) (-902.051) [-902.439] (-901.628) -- 0:00:34
471000 -- (-905.297) [-905.013] (-903.359) (-903.719) * (-901.712) (-902.343) [-903.946] (-901.502) -- 0:00:34
471500 -- (-903.979) (-905.641) [-905.554] (-905.413) * (-905.216) (-904.262) (-906.935) [-907.022] -- 0:00:34
472000 -- [-904.068] (-906.594) (-904.197) (-906.289) * (-906.172) [-903.284] (-907.388) (-905.345) -- 0:00:34
472500 -- (-902.917) (-902.958) (-902.325) [-902.140] * (-903.677) (-905.229) (-904.839) [-903.501] -- 0:00:34
473000 -- (-904.790) (-904.715) [-902.511] (-903.561) * (-902.953) (-905.153) (-905.177) [-904.756] -- 0:00:34
473500 -- (-902.497) (-904.382) [-903.379] (-905.982) * [-901.966] (-904.667) (-903.172) (-902.293) -- 0:00:34
474000 -- [-902.528] (-904.994) (-905.537) (-903.717) * [-902.632] (-914.728) (-903.859) (-904.933) -- 0:00:34
474500 -- (-902.716) (-902.076) [-903.358] (-902.555) * (-904.279) [-903.664] (-906.888) (-904.150) -- 0:00:34
475000 -- (-902.486) (-903.327) (-903.773) [-903.139] * (-904.431) (-902.906) [-904.921] (-905.399) -- 0:00:34
Average standard deviation of split frequencies: 0.010461
475500 -- (-902.923) (-903.254) (-902.390) [-903.795] * (-903.130) [-902.460] (-902.876) (-904.333) -- 0:00:34
476000 -- (-904.591) (-904.637) [-901.215] (-902.995) * (-904.558) (-903.031) (-904.157) [-902.212] -- 0:00:34
476500 -- (-907.091) (-904.265) (-903.064) [-902.581] * (-903.703) (-902.252) [-904.827] (-905.536) -- 0:00:34
477000 -- (-905.425) (-904.165) [-903.059] (-906.021) * (-904.478) (-902.486) [-903.509] (-903.024) -- 0:00:33
477500 -- (-904.139) [-904.449] (-903.111) (-903.290) * (-903.575) (-903.401) [-900.409] (-901.570) -- 0:00:33
478000 -- (-905.887) (-903.295) (-903.002) [-905.929] * (-903.244) (-903.739) (-901.556) [-904.088] -- 0:00:33
478500 -- [-905.791] (-903.840) (-904.683) (-905.393) * [-903.675] (-906.054) (-908.780) (-901.399) -- 0:00:33
479000 -- [-902.171] (-902.330) (-903.938) (-902.291) * [-902.071] (-904.559) (-906.481) (-901.297) -- 0:00:33
479500 -- (-901.551) (-905.570) [-904.741] (-901.656) * [-903.158] (-903.409) (-904.160) (-901.735) -- 0:00:33
480000 -- (-907.495) (-905.122) (-904.984) [-903.254] * (-902.163) (-904.431) (-906.537) [-903.563] -- 0:00:33
Average standard deviation of split frequencies: 0.011307
480500 -- (-904.184) [-904.770] (-903.987) (-901.531) * (-903.958) (-909.449) [-904.902] (-903.506) -- 0:00:33
481000 -- (-901.976) [-902.517] (-903.790) (-902.947) * [-905.144] (-908.783) (-902.175) (-903.206) -- 0:00:33
481500 -- (-903.919) (-903.244) [-904.073] (-905.076) * (-904.946) (-905.479) (-902.614) [-903.437] -- 0:00:33
482000 -- (-903.488) [-904.443] (-902.524) (-905.045) * (-902.756) [-905.616] (-904.273) (-903.162) -- 0:00:33
482500 -- [-905.873] (-904.670) (-903.416) (-905.954) * (-904.361) (-901.637) (-906.064) [-902.591] -- 0:00:33
483000 -- (-903.425) (-905.756) (-904.547) [-904.027] * (-903.347) [-902.595] (-902.530) (-907.157) -- 0:00:33
483500 -- (-905.228) [-904.115] (-903.894) (-903.406) * (-903.249) (-904.005) (-904.311) [-905.047] -- 0:00:33
484000 -- (-906.558) (-903.237) (-905.055) [-903.489] * (-904.470) (-905.412) [-909.561] (-906.410) -- 0:00:33
484500 -- (-903.043) [-904.996] (-909.342) (-902.955) * [-902.751] (-906.901) (-909.505) (-902.650) -- 0:00:32
485000 -- (-904.223) [-903.482] (-901.793) (-902.878) * (-901.428) (-904.679) [-903.591] (-905.385) -- 0:00:32
Average standard deviation of split frequencies: 0.010841
485500 -- (-905.564) (-907.074) [-909.988] (-904.601) * [-902.677] (-905.301) (-904.612) (-904.795) -- 0:00:32
486000 -- [-903.954] (-903.839) (-906.503) (-903.366) * [-902.211] (-902.920) (-902.328) (-904.425) -- 0:00:33
486500 -- [-905.272] (-905.887) (-903.785) (-902.084) * [-901.583] (-904.114) (-906.486) (-905.511) -- 0:00:33
487000 -- [-903.442] (-902.701) (-908.466) (-903.546) * [-902.750] (-906.379) (-901.988) (-901.892) -- 0:00:33
487500 -- (-902.735) [-902.592] (-907.795) (-904.471) * (-905.588) (-903.938) (-909.550) [-900.533] -- 0:00:33
488000 -- (-902.233) [-905.302] (-907.410) (-903.500) * (-903.289) (-904.949) (-901.888) [-903.924] -- 0:00:33
488500 -- (-903.377) (-908.391) (-904.107) [-902.470] * [-903.133] (-906.485) (-903.063) (-903.988) -- 0:00:33
489000 -- (-902.895) (-904.073) [-902.871] (-902.649) * (-905.553) (-902.517) [-911.455] (-905.263) -- 0:00:33
489500 -- (-902.814) (-907.799) [-903.384] (-901.593) * (-904.524) (-905.200) (-901.964) [-902.541] -- 0:00:33
490000 -- (-904.948) (-903.893) (-904.593) [-906.054] * (-904.639) (-903.898) (-904.908) [-904.415] -- 0:00:33
Average standard deviation of split frequencies: 0.011049
490500 -- (-908.571) (-904.544) (-904.486) [-903.738] * (-902.770) (-905.311) [-905.606] (-906.745) -- 0:00:33
491000 -- (-904.446) (-904.814) [-902.823] (-903.431) * [-903.168] (-904.854) (-910.142) (-905.455) -- 0:00:33
491500 -- [-903.151] (-903.710) (-904.096) (-904.385) * [-903.809] (-903.626) (-909.688) (-902.724) -- 0:00:33
492000 -- [-902.366] (-906.328) (-903.099) (-911.531) * (-906.056) (-904.110) [-905.780] (-902.022) -- 0:00:33
492500 -- (-904.904) [-904.941] (-904.303) (-902.828) * (-904.851) (-903.637) [-903.155] (-902.856) -- 0:00:32
493000 -- (-906.610) (-902.470) (-905.664) [-903.857] * (-902.225) (-904.053) (-903.090) [-904.559] -- 0:00:32
493500 -- (-906.726) (-902.872) [-906.182] (-902.760) * (-902.795) (-901.883) [-904.445] (-903.553) -- 0:00:32
494000 -- (-904.211) [-903.028] (-904.585) (-902.973) * (-908.547) (-902.069) (-903.957) [-902.846] -- 0:00:32
494500 -- (-904.710) [-905.476] (-905.283) (-906.179) * [-903.691] (-900.632) (-906.266) (-902.838) -- 0:00:32
495000 -- (-904.704) (-906.335) [-901.840] (-904.992) * (-905.001) (-903.754) (-904.538) [-903.283] -- 0:00:32
Average standard deviation of split frequencies: 0.010455
495500 -- (-901.923) (-902.595) [-902.996] (-905.261) * [-906.186] (-906.419) (-903.844) (-902.416) -- 0:00:32
496000 -- (-904.157) (-903.963) [-903.932] (-909.563) * [-906.647] (-906.591) (-902.450) (-903.570) -- 0:00:32
496500 -- (-905.654) (-904.815) (-901.727) [-907.540] * (-904.623) [-902.535] (-907.527) (-907.082) -- 0:00:32
497000 -- [-902.942] (-907.289) (-901.604) (-905.762) * (-904.588) (-902.220) (-909.040) [-903.769] -- 0:00:32
497500 -- [-902.797] (-903.403) (-901.172) (-904.280) * (-903.132) (-902.160) [-902.791] (-903.539) -- 0:00:32
498000 -- (-902.602) (-904.865) (-902.992) [-904.846] * [-909.066] (-903.532) (-902.987) (-904.990) -- 0:00:32
498500 -- (-902.714) (-904.623) (-903.293) [-903.315] * (-906.391) (-902.008) [-907.451] (-904.644) -- 0:00:32
499000 -- (-902.817) [-903.129] (-905.761) (-901.997) * (-907.320) [-900.774] (-905.380) (-905.082) -- 0:00:32
499500 -- [-904.449] (-905.517) (-905.996) (-903.687) * (-904.757) (-903.876) (-905.016) [-903.998] -- 0:00:32
500000 -- (-903.429) [-904.289] (-904.153) (-904.912) * [-904.206] (-905.506) (-904.677) (-905.959) -- 0:00:32
Average standard deviation of split frequencies: 0.009855
500500 -- (-903.230) (-904.671) (-902.992) [-902.254] * (-903.578) [-905.795] (-902.465) (-902.578) -- 0:00:31
501000 -- (-903.547) [-902.046] (-904.380) (-904.168) * (-902.872) [-905.245] (-903.365) (-903.555) -- 0:00:31
501500 -- [-903.818] (-905.440) (-908.019) (-903.919) * (-905.970) [-902.438] (-903.214) (-902.423) -- 0:00:32
502000 -- (-902.378) (-905.841) [-904.459] (-904.086) * (-907.017) [-906.569] (-902.480) (-904.271) -- 0:00:32
502500 -- [-902.821] (-903.493) (-901.862) (-908.142) * (-904.138) [-901.423] (-903.183) (-906.409) -- 0:00:32
503000 -- (-901.307) (-902.382) [-906.563] (-902.523) * (-908.910) [-903.515] (-904.321) (-906.998) -- 0:00:32
503500 -- (-903.622) [-902.812] (-901.478) (-903.615) * [-902.402] (-901.940) (-902.529) (-903.401) -- 0:00:32
504000 -- (-908.660) (-903.197) (-902.622) [-902.301] * [-903.764] (-903.815) (-903.584) (-907.298) -- 0:00:32
504500 -- [-905.032] (-902.896) (-904.106) (-903.304) * (-906.715) [-902.706] (-902.840) (-907.584) -- 0:00:32
505000 -- (-911.499) (-903.627) [-901.804] (-902.862) * (-905.281) (-904.344) [-902.575] (-902.796) -- 0:00:32
Average standard deviation of split frequencies: 0.009813
505500 -- (-906.167) (-903.776) (-902.803) [-906.753] * (-902.898) (-903.751) [-904.149] (-903.748) -- 0:00:32
506000 -- [-902.280] (-904.067) (-903.890) (-906.245) * [-902.392] (-903.334) (-910.539) (-906.975) -- 0:00:32
506500 -- (-907.577) (-902.729) [-903.845] (-904.552) * [-901.747] (-902.720) (-904.104) (-907.051) -- 0:00:32
507000 -- (-904.398) [-900.783] (-902.220) (-903.603) * (-905.227) (-903.147) (-904.264) [-908.852] -- 0:00:32
507500 -- (-904.961) [-901.572] (-906.710) (-902.383) * [-900.966] (-903.684) (-904.829) (-908.320) -- 0:00:32
508000 -- (-905.772) [-902.192] (-903.828) (-902.041) * [-900.828] (-904.466) (-902.597) (-906.087) -- 0:00:31
508500 -- (-902.531) (-905.044) [-902.126] (-901.956) * (-903.023) [-902.301] (-903.036) (-906.469) -- 0:00:31
509000 -- (-904.266) (-906.670) (-902.986) [-902.655] * (-902.717) (-901.650) [-903.198] (-902.548) -- 0:00:31
509500 -- (-902.856) [-903.056] (-906.759) (-902.847) * (-905.669) (-903.185) (-901.137) [-906.102] -- 0:00:31
510000 -- (-901.990) (-906.681) (-906.050) [-902.667] * (-903.815) [-902.959] (-901.816) (-907.477) -- 0:00:31
Average standard deviation of split frequencies: 0.009354
510500 -- (-903.159) (-906.597) (-906.967) [-903.631] * [-904.690] (-904.936) (-905.943) (-907.951) -- 0:00:31
511000 -- (-902.949) (-907.925) [-904.871] (-904.267) * (-902.741) (-900.775) [-904.229] (-909.464) -- 0:00:31
511500 -- (-902.752) (-904.934) (-905.759) [-905.212] * [-901.845] (-903.175) (-908.468) (-905.384) -- 0:00:31
512000 -- [-904.173] (-906.355) (-905.840) (-906.726) * (-905.899) (-903.688) [-902.837] (-903.380) -- 0:00:31
512500 -- (-901.442) (-906.876) (-906.328) [-906.101] * [-906.052] (-909.612) (-903.742) (-902.505) -- 0:00:31
513000 -- (-903.577) (-901.155) (-901.738) [-905.090] * (-909.505) (-906.442) (-908.830) [-905.659] -- 0:00:31
513500 -- (-903.044) (-902.513) [-901.755] (-903.977) * (-908.079) (-904.032) [-904.837] (-904.102) -- 0:00:31
514000 -- (-903.974) (-903.843) [-901.858] (-907.495) * (-904.701) (-901.558) (-904.103) [-904.928] -- 0:00:31
514500 -- (-903.578) (-901.660) (-900.954) [-902.168] * (-904.303) (-904.575) (-905.009) [-904.196] -- 0:00:31
515000 -- [-907.247] (-905.199) (-902.538) (-903.337) * (-903.792) [-903.958] (-903.401) (-904.676) -- 0:00:31
Average standard deviation of split frequencies: 0.009258
515500 -- (-903.670) (-905.571) (-905.285) [-903.222] * (-904.792) [-904.786] (-904.212) (-904.339) -- 0:00:31
516000 -- (-905.349) [-903.685] (-901.350) (-901.999) * [-904.777] (-904.083) (-903.313) (-902.278) -- 0:00:30
516500 -- (-906.021) (-905.946) [-902.289] (-902.642) * (-904.186) [-903.525] (-903.782) (-903.737) -- 0:00:30
517000 -- (-912.757) (-905.114) [-903.709] (-905.416) * (-904.091) (-904.153) [-903.798] (-906.034) -- 0:00:31
517500 -- (-907.845) [-909.088] (-903.143) (-905.474) * [-903.793] (-907.961) (-902.278) (-903.442) -- 0:00:31
518000 -- [-903.843] (-909.256) (-904.188) (-904.010) * (-905.333) (-909.023) [-901.309] (-903.984) -- 0:00:31
518500 -- (-903.310) (-905.776) (-903.095) [-904.367] * [-903.654] (-900.736) (-903.009) (-901.575) -- 0:00:31
519000 -- (-904.131) (-903.233) (-902.046) [-903.075] * (-904.034) [-904.120] (-904.138) (-903.220) -- 0:00:31
519500 -- (-901.757) (-905.857) [-900.087] (-903.464) * (-904.274) (-902.386) (-902.792) [-906.423] -- 0:00:31
520000 -- (-902.604) (-902.334) (-906.784) [-902.634] * (-902.707) [-904.888] (-904.829) (-903.363) -- 0:00:31
Average standard deviation of split frequencies: 0.009597
520500 -- (-905.553) (-908.309) [-904.118] (-902.806) * (-904.577) [-903.850] (-902.768) (-904.062) -- 0:00:31
521000 -- (-902.897) (-904.374) (-903.816) [-903.848] * [-901.951] (-904.249) (-905.284) (-904.255) -- 0:00:31
521500 -- (-902.180) (-904.176) (-905.904) [-908.276] * [-903.687] (-904.383) (-902.605) (-905.794) -- 0:00:31
522000 -- [-904.018] (-905.590) (-900.367) (-907.693) * [-904.928] (-904.040) (-902.546) (-902.848) -- 0:00:31
522500 -- (-902.493) (-905.069) (-904.169) [-904.483] * [-903.238] (-906.306) (-905.003) (-904.333) -- 0:00:31
523000 -- (-902.750) [-904.372] (-904.037) (-902.408) * (-902.476) (-902.543) [-906.813] (-904.241) -- 0:00:31
523500 -- (-904.254) (-903.329) [-903.812] (-902.941) * (-903.573) [-905.117] (-903.508) (-909.895) -- 0:00:30
524000 -- (-902.861) (-902.368) [-903.143] (-905.622) * (-904.727) (-900.774) (-902.592) [-905.139] -- 0:00:30
524500 -- (-902.696) (-902.994) (-904.352) [-905.421] * (-909.659) [-905.040] (-901.138) (-904.517) -- 0:00:30
525000 -- (-903.508) (-904.968) (-903.167) [-906.270] * (-908.223) (-902.088) [-900.056] (-905.295) -- 0:00:30
Average standard deviation of split frequencies: 0.008962
525500 -- [-905.198] (-904.238) (-904.296) (-902.614) * [-904.775] (-902.065) (-904.979) (-905.474) -- 0:00:30
526000 -- (-908.191) (-904.643) (-903.709) [-903.598] * (-903.132) [-902.125] (-906.611) (-904.959) -- 0:00:30
526500 -- (-906.130) (-901.326) [-903.463] (-902.711) * (-903.195) (-904.223) (-901.678) [-901.578] -- 0:00:30
527000 -- (-904.702) (-903.012) [-902.300] (-902.319) * (-903.174) [-904.583] (-904.098) (-901.737) -- 0:00:30
527500 -- (-903.278) [-902.349] (-903.501) (-903.274) * (-903.725) [-903.681] (-902.942) (-901.351) -- 0:00:30
528000 -- (-903.629) [-901.966] (-902.885) (-903.921) * [-901.741] (-905.748) (-904.328) (-903.207) -- 0:00:30
528500 -- (-902.684) [-902.957] (-901.872) (-902.768) * (-902.329) (-907.499) [-903.700] (-904.968) -- 0:00:30
529000 -- [-902.344] (-905.792) (-902.572) (-902.846) * (-902.114) (-902.321) [-904.293] (-903.368) -- 0:00:30
529500 -- (-902.866) (-907.395) [-902.825] (-903.427) * (-903.146) (-901.427) [-906.222] (-907.992) -- 0:00:30
530000 -- (-904.142) (-907.373) [-903.897] (-906.730) * [-904.679] (-902.416) (-901.998) (-905.116) -- 0:00:30
Average standard deviation of split frequencies: 0.009002
530500 -- (-904.816) (-905.081) [-901.976] (-910.454) * (-905.264) (-904.886) [-902.021] (-902.517) -- 0:00:30
531000 -- (-900.993) [-903.387] (-904.264) (-906.655) * [-901.142] (-905.529) (-902.133) (-902.279) -- 0:00:30
531500 -- (-903.660) (-904.282) [-902.022] (-902.994) * [-903.873] (-906.613) (-900.767) (-903.061) -- 0:00:29
532000 -- (-904.426) (-905.087) [-903.722] (-907.332) * (-901.274) (-905.469) (-903.309) [-901.791] -- 0:00:29
532500 -- (-901.363) [-902.831] (-904.964) (-903.889) * (-903.344) (-903.343) [-904.569] (-905.504) -- 0:00:30
533000 -- [-903.348] (-904.983) (-902.465) (-905.753) * (-904.268) [-905.437] (-903.134) (-910.045) -- 0:00:30
533500 -- (-902.918) [-902.911] (-905.303) (-903.252) * [-903.649] (-904.736) (-905.267) (-911.089) -- 0:00:30
534000 -- (-905.287) (-905.001) (-907.400) [-902.466] * [-902.988] (-902.447) (-906.845) (-903.976) -- 0:00:30
534500 -- (-904.517) [-907.246] (-903.678) (-903.879) * (-903.783) [-902.148] (-906.632) (-904.572) -- 0:00:30
535000 -- (-902.570) (-902.976) (-904.869) [-902.736] * (-903.498) [-903.374] (-905.074) (-910.547) -- 0:00:30
Average standard deviation of split frequencies: 0.009205
535500 -- [-900.990] (-906.011) (-902.910) (-904.506) * (-901.755) (-904.399) (-903.649) [-907.467] -- 0:00:30
536000 -- (-901.322) [-904.505] (-905.275) (-903.718) * [-902.420] (-905.107) (-903.313) (-906.648) -- 0:00:30
536500 -- [-900.932] (-903.668) (-906.092) (-905.406) * [-902.759] (-901.975) (-902.194) (-902.028) -- 0:00:30
537000 -- (-902.955) (-903.965) [-903.794] (-903.477) * (-903.981) (-902.735) (-901.012) [-902.079] -- 0:00:30
537500 -- (-911.343) (-902.559) [-905.451] (-902.523) * (-902.097) (-903.825) [-901.256] (-901.848) -- 0:00:30
538000 -- (-903.715) [-902.948] (-908.513) (-903.329) * (-903.435) (-902.939) (-901.933) [-904.160] -- 0:00:30
538500 -- (-902.194) (-906.873) (-914.031) [-904.830] * (-902.316) [-903.884] (-908.768) (-904.050) -- 0:00:29
539000 -- (-903.356) [-906.598] (-906.971) (-903.572) * (-902.322) (-905.347) (-901.139) [-904.191] -- 0:00:29
539500 -- (-904.545) (-904.055) [-902.104] (-903.448) * (-904.917) (-903.933) [-902.622] (-903.478) -- 0:00:29
540000 -- (-902.489) (-903.403) (-902.515) [-905.033] * [-904.082] (-903.687) (-901.758) (-905.452) -- 0:00:29
Average standard deviation of split frequencies: 0.009242
540500 -- [-904.076] (-903.525) (-904.028) (-904.787) * (-903.383) [-902.447] (-903.529) (-904.473) -- 0:00:29
541000 -- [-904.044] (-904.245) (-905.569) (-903.696) * (-903.464) (-902.195) (-903.983) [-901.781] -- 0:00:29
541500 -- (-904.781) (-906.881) [-902.817] (-906.920) * [-905.360] (-903.761) (-902.496) (-903.053) -- 0:00:29
542000 -- [-903.958] (-902.747) (-909.056) (-905.358) * (-903.303) (-903.277) (-903.772) [-904.368] -- 0:00:29
542500 -- (-903.183) (-901.683) [-903.699] (-904.182) * [-906.374] (-903.033) (-903.059) (-902.570) -- 0:00:29
543000 -- [-903.221] (-904.380) (-907.860) (-905.905) * (-906.888) [-901.171] (-904.183) (-902.863) -- 0:00:29
543500 -- (-902.822) [-906.389] (-903.991) (-902.411) * [-902.814] (-901.302) (-906.233) (-903.118) -- 0:00:29
544000 -- (-904.308) (-906.403) (-903.366) [-903.346] * (-902.928) [-903.914] (-902.392) (-904.560) -- 0:00:29
544500 -- (-906.865) (-907.579) [-901.459] (-902.916) * [-904.249] (-904.490) (-901.458) (-903.989) -- 0:00:29
545000 -- (-902.602) [-909.223] (-904.027) (-902.721) * [-903.554] (-903.801) (-903.401) (-910.137) -- 0:00:29
Average standard deviation of split frequencies: 0.008634
545500 -- (-903.412) (-908.463) [-904.298] (-903.568) * (-902.976) (-901.519) [-904.820] (-907.009) -- 0:00:29
546000 -- [-902.502] (-906.540) (-904.541) (-903.623) * (-904.722) (-906.479) (-910.029) [-903.778] -- 0:00:29
546500 -- (-903.487) (-904.951) [-903.255] (-904.986) * [-905.696] (-907.701) (-904.452) (-905.893) -- 0:00:29
547000 -- [-904.084] (-904.880) (-902.683) (-903.905) * (-905.704) (-907.588) [-904.414] (-902.807) -- 0:00:28
547500 -- (-905.030) (-907.423) [-903.936] (-903.468) * [-904.883] (-905.805) (-902.970) (-903.230) -- 0:00:28
548000 -- (-907.370) (-903.076) [-903.836] (-905.891) * (-903.766) (-908.781) [-902.680] (-903.495) -- 0:00:29
548500 -- (-906.609) (-903.573) (-902.481) [-903.562] * (-901.897) (-906.646) [-903.133] (-904.675) -- 0:00:29
549000 -- [-902.568] (-903.722) (-905.442) (-904.239) * (-903.119) (-902.745) [-902.133] (-905.004) -- 0:00:29
549500 -- (-902.673) (-902.565) (-904.741) [-902.986] * (-903.127) [-902.069] (-902.085) (-902.482) -- 0:00:29
550000 -- (-905.517) [-903.258] (-904.759) (-906.022) * (-905.923) (-904.139) (-904.891) [-911.353] -- 0:00:29
Average standard deviation of split frequencies: 0.008732
550500 -- (-902.619) [-903.025] (-904.036) (-903.825) * (-903.969) (-904.367) [-903.168] (-906.284) -- 0:00:29
551000 -- (-903.973) (-901.902) (-903.359) [-902.845] * [-901.665] (-909.823) (-905.035) (-903.489) -- 0:00:29
551500 -- (-904.876) (-902.870) (-902.296) [-906.813] * (-906.769) [-900.911] (-902.942) (-903.372) -- 0:00:29
552000 -- [-905.456] (-904.799) (-905.263) (-904.915) * (-907.148) (-902.612) [-902.303] (-903.441) -- 0:00:29
552500 -- (-905.115) (-904.833) (-903.828) [-903.194] * (-904.326) (-901.875) [-902.577] (-902.320) -- 0:00:29
553000 -- (-906.237) [-903.303] (-906.566) (-903.967) * (-903.230) [-905.611] (-902.948) (-901.744) -- 0:00:29
553500 -- (-900.523) (-903.190) (-903.279) [-903.603] * (-902.424) (-903.031) (-903.892) [-906.603] -- 0:00:29
554000 -- [-903.916] (-903.395) (-902.314) (-903.721) * (-903.714) (-903.001) [-902.444] (-904.397) -- 0:00:28
554500 -- (-903.289) (-903.412) [-902.783] (-902.951) * (-904.957) (-903.098) (-903.816) [-905.774] -- 0:00:28
555000 -- (-902.369) (-903.295) [-906.805] (-903.062) * (-906.057) (-903.410) (-908.623) [-901.747] -- 0:00:28
Average standard deviation of split frequencies: 0.008422
555500 -- (-907.933) (-901.749) (-906.398) [-903.631] * (-904.461) (-904.108) (-915.636) [-905.084] -- 0:00:28
556000 -- (-902.182) (-905.507) [-906.860] (-904.735) * [-902.999] (-902.381) (-904.614) (-905.218) -- 0:00:28
556500 -- [-902.075] (-904.663) (-906.610) (-907.118) * [-904.484] (-903.436) (-904.115) (-905.448) -- 0:00:28
557000 -- (-902.768) [-902.176] (-906.650) (-902.957) * [-902.296] (-903.545) (-903.255) (-904.916) -- 0:00:28
557500 -- (-902.108) (-902.086) (-906.707) [-903.691] * (-903.750) [-906.501] (-902.262) (-902.249) -- 0:00:28
558000 -- [-904.394] (-903.392) (-904.821) (-903.477) * (-903.699) [-907.369] (-902.471) (-901.853) -- 0:00:28
558500 -- (-903.394) (-904.188) (-905.828) [-902.555] * (-905.360) (-908.202) [-902.626] (-901.749) -- 0:00:28
559000 -- (-902.976) (-904.503) [-901.531] (-902.387) * (-902.225) (-907.287) (-903.812) [-902.879] -- 0:00:28
559500 -- (-903.168) [-905.327] (-902.297) (-901.290) * (-904.359) [-902.593] (-902.364) (-903.394) -- 0:00:28
560000 -- [-902.393] (-903.397) (-903.664) (-901.074) * (-904.879) (-904.281) [-901.359] (-908.255) -- 0:00:28
Average standard deviation of split frequencies: 0.007567
560500 -- (-906.568) (-904.113) (-903.050) [-901.890] * (-904.043) (-902.662) [-901.871] (-902.339) -- 0:00:28
561000 -- (-903.623) (-904.825) [-902.792] (-904.652) * [-902.333] (-908.314) (-902.782) (-903.201) -- 0:00:28
561500 -- [-904.770] (-902.209) (-905.974) (-904.018) * (-902.271) (-903.373) [-902.691] (-903.606) -- 0:00:28
562000 -- (-902.937) (-902.759) (-902.386) [-905.801] * (-903.408) (-904.053) [-902.815] (-902.492) -- 0:00:28
562500 -- (-904.626) [-903.362] (-902.762) (-902.527) * [-901.609] (-904.884) (-902.381) (-902.768) -- 0:00:28
563000 -- (-902.881) [-902.595] (-907.689) (-909.978) * (-903.846) (-907.027) (-904.828) [-902.885] -- 0:00:27
563500 -- [-905.044] (-907.286) (-907.677) (-908.088) * [-905.169] (-904.457) (-908.198) (-908.199) -- 0:00:28
564000 -- (-907.002) (-902.706) (-908.292) [-903.188] * [-904.328] (-904.214) (-909.115) (-908.727) -- 0:00:28
564500 -- (-905.558) (-902.623) [-903.595] (-902.478) * [-906.124] (-903.696) (-905.335) (-905.440) -- 0:00:28
565000 -- [-904.911] (-904.184) (-905.189) (-904.504) * [-903.053] (-902.957) (-902.475) (-907.985) -- 0:00:28
Average standard deviation of split frequencies: 0.007440
565500 -- (-905.078) [-903.552] (-905.572) (-906.028) * (-905.702) (-904.996) [-901.963] (-902.838) -- 0:00:28
566000 -- (-907.825) [-904.696] (-907.246) (-900.969) * (-903.864) [-904.114] (-906.482) (-905.861) -- 0:00:28
566500 -- (-903.328) [-901.842] (-907.164) (-901.343) * (-902.053) [-903.517] (-905.618) (-904.834) -- 0:00:28
567000 -- (-904.289) [-905.054] (-904.283) (-902.559) * (-904.233) [-904.665] (-903.869) (-902.397) -- 0:00:28
567500 -- [-903.042] (-903.397) (-902.798) (-904.212) * [-905.384] (-903.933) (-902.765) (-901.432) -- 0:00:28
568000 -- (-903.142) [-901.526] (-905.845) (-905.010) * (-910.750) [-903.389] (-902.785) (-902.910) -- 0:00:28
568500 -- (-903.910) [-902.758] (-907.013) (-905.207) * [-906.061] (-901.621) (-901.992) (-902.814) -- 0:00:28
569000 -- (-904.419) (-902.689) (-906.079) [-903.121] * (-903.988) (-908.404) [-902.117] (-903.451) -- 0:00:28
569500 -- (-903.598) (-904.487) [-902.486] (-905.074) * (-903.270) (-904.482) [-905.688] (-902.335) -- 0:00:27
570000 -- [-903.640] (-906.131) (-905.865) (-907.816) * (-902.949) [-905.004] (-902.360) (-904.242) -- 0:00:27
Average standard deviation of split frequencies: 0.007383
570500 -- (-906.127) (-905.026) (-905.639) [-901.770] * (-904.352) (-904.067) [-907.425] (-909.221) -- 0:00:27
571000 -- (-904.115) (-904.673) (-905.150) [-906.219] * [-904.572] (-902.189) (-906.557) (-907.315) -- 0:00:27
571500 -- (-904.064) (-907.218) (-907.386) [-904.337] * (-903.702) [-902.670] (-901.410) (-909.262) -- 0:00:27
572000 -- (-904.023) [-908.718] (-902.933) (-902.635) * (-903.213) (-902.956) (-908.843) [-903.612] -- 0:00:27
572500 -- (-902.721) (-902.361) (-903.310) [-902.203] * [-903.624] (-904.743) (-906.669) (-905.595) -- 0:00:27
573000 -- (-902.732) (-901.931) (-901.259) [-902.096] * (-902.904) (-903.483) [-904.023] (-905.400) -- 0:00:27
573500 -- (-902.911) [-902.335] (-903.441) (-902.723) * (-902.224) (-904.704) [-903.916] (-905.511) -- 0:00:27
574000 -- (-905.532) (-904.092) [-904.063] (-903.416) * (-905.310) [-904.832] (-904.550) (-905.412) -- 0:00:27
574500 -- (-904.455) (-906.794) (-903.473) [-902.317] * (-905.156) (-902.609) (-901.784) [-902.938] -- 0:00:27
575000 -- (-902.890) [-907.163] (-901.158) (-908.695) * [-904.438] (-904.959) (-902.964) (-902.035) -- 0:00:27
Average standard deviation of split frequencies: 0.007468
575500 -- (-903.164) [-904.572] (-902.762) (-906.982) * (-906.274) (-904.182) (-902.481) [-903.218] -- 0:00:27
576000 -- [-903.958] (-904.022) (-905.043) (-905.231) * (-904.365) (-907.376) [-903.176] (-902.416) -- 0:00:27
576500 -- [-904.877] (-905.238) (-903.180) (-905.900) * [-904.222] (-903.652) (-904.891) (-904.764) -- 0:00:27
577000 -- (-902.565) (-905.225) (-901.781) [-902.636] * (-905.753) [-903.224] (-908.024) (-902.863) -- 0:00:27
577500 -- (-908.031) (-907.546) [-902.732] (-904.021) * (-902.168) [-903.106] (-902.018) (-906.657) -- 0:00:27
578000 -- (-904.681) [-901.035] (-904.690) (-903.977) * [-901.894] (-907.227) (-901.638) (-904.291) -- 0:00:27
578500 -- (-903.928) [-903.458] (-903.021) (-905.813) * (-902.266) [-905.849] (-903.355) (-904.609) -- 0:00:26
579000 -- [-902.889] (-902.069) (-905.163) (-905.216) * [-902.507] (-905.738) (-904.013) (-903.171) -- 0:00:27
579500 -- (-902.142) (-907.609) [-901.615] (-904.223) * [-904.059] (-902.927) (-904.163) (-900.741) -- 0:00:27
580000 -- [-903.266] (-903.877) (-903.468) (-902.363) * (-904.708) (-903.015) [-903.678] (-902.484) -- 0:00:27
Average standard deviation of split frequencies: 0.007459
580500 -- (-904.356) (-904.601) [-901.399] (-905.688) * (-906.655) (-902.445) (-903.036) [-903.356] -- 0:00:27
581000 -- (-904.372) (-901.670) (-906.716) [-903.184] * (-904.838) (-902.904) [-904.566] (-904.114) -- 0:00:27
581500 -- [-903.672] (-901.725) (-902.861) (-905.799) * [-906.385] (-908.959) (-906.150) (-903.848) -- 0:00:27
582000 -- (-906.764) (-902.826) (-903.184) [-902.626] * (-903.216) (-904.163) [-903.588] (-903.627) -- 0:00:27
582500 -- (-908.266) (-904.788) [-904.392] (-903.560) * (-903.608) [-905.216] (-901.621) (-904.862) -- 0:00:27
583000 -- (-906.787) (-906.683) [-901.687] (-903.849) * (-903.443) (-905.160) (-903.402) [-905.947] -- 0:00:27
583500 -- (-902.841) (-905.127) [-908.673] (-903.797) * (-902.732) (-905.857) [-902.073] (-904.747) -- 0:00:27
584000 -- [-903.110] (-904.585) (-905.383) (-904.500) * [-903.868] (-906.119) (-901.832) (-902.663) -- 0:00:27
584500 -- (-905.696) [-905.045] (-905.878) (-903.325) * [-904.142] (-904.558) (-905.231) (-906.400) -- 0:00:27
585000 -- (-906.285) (-901.326) (-905.447) [-901.989] * (-908.103) [-904.438] (-904.347) (-903.823) -- 0:00:26
Average standard deviation of split frequencies: 0.007341
585500 -- (-907.763) (-903.796) [-902.153] (-903.363) * (-905.626) (-904.185) (-903.569) [-902.520] -- 0:00:26
586000 -- (-904.765) [-902.704] (-903.220) (-903.967) * [-903.984] (-903.920) (-901.464) (-903.741) -- 0:00:26
586500 -- (-903.985) (-900.901) (-901.812) [-902.200] * (-903.260) [-904.478] (-901.960) (-908.264) -- 0:00:26
587000 -- (-902.735) [-901.974] (-905.659) (-904.889) * (-904.005) [-901.757] (-905.931) (-902.535) -- 0:00:26
587500 -- [-901.836] (-901.685) (-902.527) (-903.465) * (-905.200) (-902.342) [-905.957] (-902.266) -- 0:00:26
588000 -- (-904.681) (-903.000) (-903.096) [-905.464] * (-902.181) (-901.919) (-905.359) [-902.676] -- 0:00:26
588500 -- [-902.162] (-903.620) (-902.902) (-905.601) * (-904.087) (-901.632) (-903.213) [-902.841] -- 0:00:26
589000 -- [-902.638] (-903.190) (-903.409) (-903.628) * (-904.715) (-901.939) (-903.510) [-903.393] -- 0:00:26
589500 -- (-902.883) (-902.752) (-902.641) [-902.486] * (-904.041) (-903.822) [-910.026] (-901.600) -- 0:00:26
590000 -- (-902.273) (-910.604) (-904.271) [-903.900] * (-904.490) [-904.080] (-903.908) (-902.177) -- 0:00:26
Average standard deviation of split frequencies: 0.006933
590500 -- (-903.311) [-903.253] (-905.441) (-904.078) * (-903.096) [-902.879] (-901.825) (-902.668) -- 0:00:26
591000 -- (-903.841) (-904.263) [-904.648] (-909.723) * [-906.069] (-905.939) (-902.486) (-907.981) -- 0:00:26
591500 -- [-902.572] (-903.517) (-905.224) (-907.404) * (-905.801) (-902.405) (-902.874) [-901.463] -- 0:00:26
592000 -- (-902.015) (-903.611) [-905.399] (-901.420) * [-904.714] (-901.807) (-911.068) (-902.583) -- 0:00:26
592500 -- (-903.887) [-902.149] (-903.635) (-903.385) * (-904.931) (-902.177) [-901.514] (-904.239) -- 0:00:26
593000 -- (-901.908) (-901.380) (-903.566) [-901.985] * (-911.217) (-901.906) (-904.446) [-901.759] -- 0:00:26
593500 -- (-902.730) (-905.414) [-899.952] (-902.763) * (-902.556) [-902.593] (-905.635) (-903.993) -- 0:00:26
594000 -- (-905.048) (-901.273) [-905.885] (-903.581) * (-908.031) (-903.385) (-902.994) [-905.229] -- 0:00:25
594500 -- [-902.313] (-902.326) (-903.327) (-908.487) * (-905.820) (-902.497) (-903.440) [-903.368] -- 0:00:26
595000 -- [-901.209] (-901.538) (-904.293) (-905.689) * (-903.329) [-902.412] (-904.564) (-903.272) -- 0:00:26
Average standard deviation of split frequencies: 0.007069
595500 -- (-901.580) (-905.749) [-903.852] (-905.855) * (-902.132) (-903.755) (-906.102) [-901.676] -- 0:00:26
596000 -- [-905.058] (-903.141) (-905.534) (-904.105) * (-902.078) (-904.236) [-904.623] (-906.103) -- 0:00:26
596500 -- [-905.212] (-904.512) (-906.726) (-905.387) * (-902.366) (-904.369) (-905.366) [-905.897] -- 0:00:26
597000 -- (-903.222) (-902.758) [-903.050] (-904.918) * (-903.321) (-907.271) (-906.841) [-904.173] -- 0:00:26
597500 -- [-902.389] (-903.032) (-902.529) (-903.799) * (-903.439) [-902.959] (-910.224) (-904.168) -- 0:00:26
598000 -- (-902.658) (-903.786) [-902.023] (-905.043) * (-903.262) (-906.151) (-909.010) [-901.620] -- 0:00:26
598500 -- (-901.161) (-907.648) [-904.403] (-905.080) * (-902.046) [-901.829] (-908.541) (-907.861) -- 0:00:26
599000 -- (-902.728) (-903.625) (-899.276) [-901.581] * (-902.226) (-902.974) (-904.657) [-902.254] -- 0:00:26
599500 -- [-902.665] (-904.543) (-902.119) (-902.549) * (-903.889) [-902.790] (-903.720) (-907.060) -- 0:00:26
600000 -- (-903.438) (-904.550) (-906.958) [-902.688] * (-903.603) (-903.294) (-903.299) [-902.802] -- 0:00:25
Average standard deviation of split frequencies: 0.007210
600500 -- (-906.326) [-902.499] (-905.673) (-908.494) * (-904.193) (-902.400) [-903.721] (-905.962) -- 0:00:25
601000 -- [-902.286] (-905.272) (-906.783) (-903.265) * (-903.232) [-904.592] (-906.456) (-903.432) -- 0:00:25
601500 -- (-904.531) (-904.337) [-904.196] (-905.555) * (-906.408) (-906.828) [-905.103] (-906.701) -- 0:00:25
602000 -- (-902.556) [-905.721] (-903.702) (-906.708) * [-903.525] (-903.933) (-904.465) (-904.999) -- 0:00:25
602500 -- [-902.438] (-906.228) (-904.966) (-902.638) * (-902.838) (-906.233) [-906.084] (-903.787) -- 0:00:25
603000 -- (-904.896) (-903.832) [-903.362] (-902.657) * [-902.117] (-905.904) (-907.372) (-905.919) -- 0:00:25
603500 -- [-903.281] (-904.837) (-904.032) (-903.066) * (-904.994) (-902.435) [-907.534] (-904.658) -- 0:00:25
604000 -- [-903.640] (-904.801) (-902.829) (-903.394) * (-902.622) [-903.071] (-901.174) (-904.270) -- 0:00:25
604500 -- (-904.764) (-904.672) (-906.591) [-901.431] * (-902.789) (-906.360) (-904.614) [-901.624] -- 0:00:25
605000 -- [-901.651] (-908.625) (-907.323) (-901.590) * (-903.431) (-903.718) (-904.489) [-903.606] -- 0:00:25
Average standard deviation of split frequencies: 0.007687
605500 -- (-902.457) (-905.900) [-904.821] (-902.743) * [-903.921] (-901.644) (-903.946) (-906.146) -- 0:00:25
606000 -- (-904.752) (-904.170) (-904.553) [-902.445] * [-909.364] (-905.541) (-903.302) (-903.219) -- 0:00:25
606500 -- (-902.149) (-905.541) (-904.638) [-906.694] * [-907.956] (-904.108) (-903.846) (-903.683) -- 0:00:25
607000 -- [-902.854] (-903.694) (-904.580) (-902.574) * (-903.513) (-902.524) (-909.199) [-908.254] -- 0:00:25
607500 -- (-902.931) (-905.900) (-903.762) [-900.709] * (-902.798) [-901.881] (-902.534) (-907.230) -- 0:00:25
608000 -- (-903.222) (-905.949) (-904.457) [-902.771] * (-903.765) (-905.670) (-902.407) [-904.421] -- 0:00:25
608500 -- (-906.492) [-902.763] (-902.531) (-904.509) * (-902.455) (-902.516) (-908.264) [-902.254] -- 0:00:25
609000 -- (-903.072) (-906.789) (-902.707) [-903.360] * [-901.098] (-904.701) (-902.533) (-905.046) -- 0:00:25
609500 -- [-903.929] (-904.432) (-907.223) (-904.050) * [-903.910] (-901.324) (-903.768) (-904.254) -- 0:00:24
610000 -- [-903.660] (-903.463) (-905.177) (-905.667) * (-901.643) [-904.175] (-904.341) (-903.868) -- 0:00:25
Average standard deviation of split frequencies: 0.007810
610500 -- (-905.451) [-904.063] (-904.493) (-905.175) * [-901.957] (-906.335) (-903.647) (-907.272) -- 0:00:25
611000 -- (-903.065) (-901.627) (-906.977) [-904.718] * (-904.145) (-904.521) [-902.141] (-907.698) -- 0:00:25
611500 -- (-903.651) (-905.396) [-906.535] (-905.092) * (-902.087) (-903.295) [-903.558] (-905.476) -- 0:00:25
612000 -- (-904.976) [-903.609] (-903.601) (-904.668) * [-902.511] (-901.655) (-905.382) (-904.598) -- 0:00:25
612500 -- (-904.032) (-904.608) (-902.259) [-903.027] * (-902.541) (-904.148) [-903.303] (-905.889) -- 0:00:25
613000 -- [-903.356] (-903.815) (-904.013) (-904.140) * (-904.633) (-903.172) [-903.690] (-904.417) -- 0:00:25
613500 -- (-903.982) [-905.120] (-902.376) (-902.972) * (-902.937) (-903.887) [-903.855] (-904.824) -- 0:00:25
614000 -- (-905.652) [-902.745] (-904.828) (-906.748) * (-909.757) (-902.855) [-902.398] (-904.113) -- 0:00:25
614500 -- [-904.198] (-902.765) (-905.397) (-908.343) * (-910.466) [-902.871] (-904.428) (-905.509) -- 0:00:25
615000 -- (-904.531) [-904.472] (-904.005) (-908.075) * (-904.133) [-903.622] (-906.983) (-902.050) -- 0:00:25
Average standard deviation of split frequencies: 0.007653
615500 -- (-904.100) (-905.325) (-902.844) [-904.276] * (-902.923) (-903.818) (-904.614) [-906.061] -- 0:00:24
616000 -- (-903.665) [-905.070] (-902.911) (-904.074) * (-903.149) (-902.864) (-906.227) [-903.299] -- 0:00:24
616500 -- [-903.205] (-904.052) (-903.188) (-902.546) * (-907.283) [-902.476] (-902.964) (-904.368) -- 0:00:24
617000 -- (-907.146) [-904.476] (-904.450) (-903.772) * (-904.159) (-902.988) [-904.686] (-903.617) -- 0:00:24
617500 -- (-902.393) [-904.282] (-903.502) (-905.241) * (-905.490) [-904.895] (-903.792) (-903.610) -- 0:00:24
618000 -- [-902.416] (-902.751) (-904.907) (-904.051) * (-904.058) (-903.784) (-904.351) [-903.474] -- 0:00:24
618500 -- (-902.560) (-902.545) (-906.451) [-903.721] * (-904.415) (-902.625) [-901.699] (-904.535) -- 0:00:24
619000 -- (-901.641) [-903.248] (-906.020) (-903.502) * (-904.250) (-903.924) [-901.916] (-905.921) -- 0:00:24
619500 -- (-901.095) [-902.147] (-902.374) (-901.622) * (-903.682) (-909.511) [-902.601] (-903.572) -- 0:00:24
620000 -- [-903.792] (-905.047) (-903.797) (-903.271) * [-903.130] (-905.403) (-903.412) (-902.851) -- 0:00:24
Average standard deviation of split frequencies: 0.007953
620500 -- (-906.493) [-902.992] (-901.571) (-904.797) * (-906.222) (-910.258) [-904.651] (-901.622) -- 0:00:24
621000 -- (-902.706) (-903.109) (-904.190) [-903.356] * (-903.074) (-904.142) [-903.438] (-900.284) -- 0:00:24
621500 -- (-906.244) [-903.577] (-904.757) (-903.915) * (-902.715) (-904.015) (-903.851) [-901.703] -- 0:00:24
622000 -- (-906.568) [-902.207] (-905.658) (-904.814) * (-900.697) (-904.633) (-903.557) [-904.060] -- 0:00:24
622500 -- [-904.261] (-902.394) (-905.198) (-905.568) * (-900.661) (-905.008) (-905.484) [-902.103] -- 0:00:24
623000 -- (-904.481) (-902.060) (-903.547) [-903.779] * [-904.094] (-903.591) (-902.050) (-904.105) -- 0:00:24
623500 -- (-906.821) (-900.396) [-905.906] (-902.330) * [-905.972] (-905.081) (-907.222) (-903.002) -- 0:00:24
624000 -- [-902.697] (-904.305) (-902.492) (-902.560) * (-907.230) (-904.547) (-905.056) [-903.490] -- 0:00:24
624500 -- [-905.881] (-902.261) (-907.816) (-904.025) * [-903.451] (-904.515) (-904.312) (-906.478) -- 0:00:24
625000 -- [-905.022] (-905.210) (-903.705) (-903.013) * (-902.444) (-903.675) (-906.823) [-905.822] -- 0:00:24
Average standard deviation of split frequencies: 0.007991
625500 -- (-905.307) (-902.048) (-902.815) [-902.434] * [-902.813] (-904.488) (-902.608) (-906.022) -- 0:00:24
626000 -- (-902.147) (-902.738) (-903.342) [-901.180] * (-904.743) (-904.205) [-902.403] (-905.329) -- 0:00:24
626500 -- [-901.788] (-904.120) (-904.192) (-901.044) * (-901.637) [-904.426] (-903.132) (-903.476) -- 0:00:24
627000 -- (-906.298) (-903.325) [-903.151] (-903.047) * [-908.987] (-907.425) (-903.089) (-905.795) -- 0:00:24
627500 -- (-905.371) (-902.054) (-903.480) [-902.611] * [-902.237] (-903.348) (-903.289) (-907.075) -- 0:00:24
628000 -- [-903.994] (-903.184) (-903.434) (-902.110) * [-904.270] (-904.644) (-905.826) (-904.622) -- 0:00:24
628500 -- (-904.740) [-902.926] (-901.044) (-907.679) * (-908.663) (-906.066) (-904.717) [-902.520] -- 0:00:24
629000 -- (-905.963) [-905.805] (-904.942) (-908.315) * (-904.044) (-908.193) (-904.642) [-902.437] -- 0:00:24
629500 -- [-908.915] (-904.996) (-903.460) (-904.050) * (-902.902) (-908.576) (-905.771) [-903.298] -- 0:00:24
630000 -- (-906.155) [-905.940] (-900.082) (-902.687) * (-902.321) (-912.554) (-903.380) [-902.416] -- 0:00:24
Average standard deviation of split frequencies: 0.007724
630500 -- (-903.495) (-906.902) (-901.401) [-901.623] * (-901.908) (-905.122) [-902.673] (-903.132) -- 0:00:24
631000 -- (-907.165) (-904.206) [-902.246] (-901.698) * [-902.605] (-904.393) (-906.558) (-903.092) -- 0:00:23
631500 -- (-905.903) [-905.631] (-902.736) (-907.042) * (-904.758) (-905.473) (-902.455) [-901.567] -- 0:00:23
632000 -- (-904.984) [-903.949] (-903.725) (-902.093) * (-905.073) [-903.888] (-901.743) (-902.917) -- 0:00:23
632500 -- (-903.414) (-909.991) [-902.777] (-904.244) * [-902.035] (-905.093) (-901.843) (-903.366) -- 0:00:23
633000 -- (-903.592) (-912.538) [-903.117] (-901.745) * (-905.741) (-903.965) [-902.298] (-905.610) -- 0:00:23
633500 -- (-904.531) (-908.896) [-903.751] (-903.602) * (-903.561) (-904.071) [-903.709] (-903.701) -- 0:00:23
634000 -- (-903.597) (-906.784) [-900.899] (-902.903) * (-904.086) [-903.362] (-908.828) (-902.093) -- 0:00:23
634500 -- (-904.541) (-904.762) [-899.471] (-903.361) * [-905.033] (-904.667) (-902.630) (-904.809) -- 0:00:23
635000 -- [-901.289] (-902.768) (-904.548) (-904.296) * [-903.629] (-902.813) (-904.624) (-901.700) -- 0:00:23
Average standard deviation of split frequencies: 0.006486
635500 -- (-903.825) [-902.620] (-903.191) (-904.679) * (-899.958) (-904.397) (-903.603) [-902.592] -- 0:00:23
636000 -- [-902.195] (-905.491) (-903.163) (-907.817) * (-904.396) (-909.317) (-905.084) [-901.029] -- 0:00:23
636500 -- [-903.912] (-908.480) (-903.453) (-902.786) * (-901.909) [-906.188] (-905.061) (-904.302) -- 0:00:23
637000 -- (-902.880) [-901.535] (-902.195) (-903.090) * (-905.536) [-905.461] (-903.220) (-905.327) -- 0:00:23
637500 -- (-903.105) [-903.441] (-902.669) (-905.198) * (-907.157) (-905.729) [-903.113] (-903.902) -- 0:00:23
638000 -- (-907.321) [-902.474] (-902.742) (-904.365) * (-904.885) (-905.311) (-902.945) [-902.571] -- 0:00:23
638500 -- (-903.495) (-905.126) [-901.240] (-901.159) * (-902.840) (-907.642) (-903.107) [-904.041] -- 0:00:23
639000 -- [-906.084] (-904.193) (-902.913) (-901.734) * (-908.372) (-905.701) (-901.915) [-907.441] -- 0:00:23
639500 -- (-903.829) (-905.253) [-904.433] (-903.694) * (-903.610) (-904.282) [-905.021] (-909.107) -- 0:00:23
640000 -- (-906.833) (-904.676) [-901.636] (-902.763) * (-904.389) (-902.038) [-907.357] (-908.528) -- 0:00:23
Average standard deviation of split frequencies: 0.006208
640500 -- (-903.540) (-902.178) [-904.784] (-907.632) * (-903.409) [-902.277] (-905.574) (-910.513) -- 0:00:23
641000 -- [-905.345] (-901.374) (-906.057) (-905.336) * (-903.326) (-902.220) (-904.810) [-904.999] -- 0:00:23
641500 -- (-903.843) [-904.490] (-906.346) (-903.086) * [-901.140] (-903.578) (-905.092) (-904.708) -- 0:00:23
642000 -- (-908.036) (-902.220) [-905.784] (-901.903) * [-903.385] (-902.806) (-902.560) (-901.516) -- 0:00:23
642500 -- (-905.544) [-904.641] (-908.148) (-904.579) * (-903.879) [-904.329] (-903.490) (-904.605) -- 0:00:23
643000 -- (-902.364) [-901.995] (-902.180) (-903.400) * (-902.993) (-900.383) [-902.281] (-901.548) -- 0:00:23
643500 -- (-903.453) (-904.140) [-901.778] (-903.137) * [-902.645] (-902.232) (-903.807) (-901.465) -- 0:00:23
644000 -- (-903.910) [-901.195] (-903.135) (-902.608) * (-903.176) [-905.750] (-906.634) (-902.417) -- 0:00:23
644500 -- (-908.870) [-904.342] (-903.087) (-901.909) * (-903.613) (-902.731) (-905.065) [-902.917] -- 0:00:23
645000 -- (-906.598) [-903.302] (-901.254) (-903.102) * (-901.945) (-902.253) [-902.659] (-901.968) -- 0:00:23
Average standard deviation of split frequencies: 0.006157
645500 -- (-903.255) [-903.448] (-904.170) (-903.564) * [-903.339] (-904.282) (-903.915) (-903.600) -- 0:00:23
646000 -- (-903.144) [-903.111] (-902.843) (-902.907) * (-903.919) (-905.082) (-906.620) [-903.522] -- 0:00:23
646500 -- (-903.552) [-902.803] (-902.308) (-910.886) * (-904.089) (-903.710) [-902.351] (-905.579) -- 0:00:22
647000 -- (-903.073) (-902.479) [-902.393] (-905.341) * (-902.882) (-904.571) [-903.682] (-904.910) -- 0:00:22
647500 -- [-902.269] (-902.477) (-902.170) (-905.516) * (-902.593) (-901.920) [-902.865] (-902.440) -- 0:00:22
648000 -- (-904.701) (-901.856) [-900.956] (-904.505) * [-907.519] (-910.681) (-905.081) (-904.619) -- 0:00:22
648500 -- [-901.550] (-905.827) (-904.171) (-902.292) * (-902.725) (-905.995) [-903.781] (-906.207) -- 0:00:22
649000 -- (-903.452) (-906.276) [-902.969] (-903.572) * [-903.166] (-904.317) (-903.625) (-905.216) -- 0:00:22
649500 -- (-904.367) (-901.773) (-903.795) [-903.092] * (-902.981) [-904.568] (-902.501) (-901.344) -- 0:00:22
650000 -- (-905.177) [-902.403] (-902.891) (-902.849) * [-904.872] (-905.334) (-903.704) (-902.608) -- 0:00:22
Average standard deviation of split frequencies: 0.005796
650500 -- [-903.783] (-901.004) (-905.323) (-902.792) * (-905.000) (-909.161) [-903.576] (-903.518) -- 0:00:22
651000 -- (-903.425) (-902.844) [-901.653] (-903.832) * (-909.279) (-911.836) [-903.489] (-902.690) -- 0:00:22
651500 -- (-902.908) (-902.611) [-901.713] (-902.841) * (-905.391) (-901.468) [-907.080] (-902.550) -- 0:00:22
652000 -- (-904.142) (-901.020) [-901.408] (-903.205) * (-903.171) (-904.839) [-904.398] (-901.288) -- 0:00:22
652500 -- (-905.618) [-902.487] (-905.382) (-902.169) * (-903.013) (-906.644) (-904.443) [-903.199] -- 0:00:22
653000 -- (-904.184) (-903.530) (-903.553) [-903.041] * (-904.028) [-902.876] (-906.402) (-903.646) -- 0:00:22
653500 -- (-904.473) (-902.737) (-904.809) [-905.340] * (-904.873) (-903.291) (-901.942) [-904.337] -- 0:00:22
654000 -- (-904.122) (-905.151) (-905.422) [-904.108] * (-903.149) [-904.536] (-903.223) (-906.507) -- 0:00:22
654500 -- (-905.258) [-903.783] (-905.537) (-904.964) * (-906.122) [-905.544] (-904.010) (-904.666) -- 0:00:22
655000 -- (-906.016) [-903.305] (-903.943) (-904.364) * (-905.758) (-901.665) (-903.604) [-902.583] -- 0:00:22
Average standard deviation of split frequencies: 0.006018
655500 -- (-902.724) (-902.636) [-905.061] (-904.538) * (-903.497) [-901.661] (-906.285) (-905.637) -- 0:00:22
656000 -- (-903.618) (-902.046) [-904.043] (-904.559) * (-906.130) (-904.939) [-902.509] (-904.040) -- 0:00:22
656500 -- (-906.137) [-900.964] (-901.757) (-903.605) * (-904.881) (-905.154) [-903.799] (-905.366) -- 0:00:22
657000 -- [-904.195] (-909.718) (-900.864) (-903.738) * (-902.573) (-904.112) (-902.845) [-904.375] -- 0:00:22
657500 -- (-903.577) [-902.697] (-901.247) (-902.568) * (-904.688) (-907.835) [-902.741] (-903.732) -- 0:00:22
658000 -- [-906.075] (-905.584) (-901.320) (-903.356) * (-905.333) [-904.003] (-906.058) (-904.162) -- 0:00:22
658500 -- (-906.484) (-902.486) [-901.098] (-903.365) * (-904.583) (-901.952) [-903.107] (-902.327) -- 0:00:22
659000 -- [-904.702] (-902.680) (-903.379) (-904.937) * (-902.388) [-902.560] (-908.241) (-902.170) -- 0:00:22
659500 -- (-904.753) (-902.677) [-902.233] (-906.427) * (-906.056) [-902.396] (-903.278) (-902.722) -- 0:00:22
660000 -- (-903.603) [-901.790] (-901.771) (-904.960) * (-905.659) (-901.494) [-906.122] (-904.699) -- 0:00:22
Average standard deviation of split frequencies: 0.005574
660500 -- (-904.143) [-902.454] (-902.666) (-902.515) * (-903.328) [-902.511] (-903.047) (-904.410) -- 0:00:22
661000 -- [-902.757] (-903.464) (-900.920) (-906.077) * (-902.332) (-904.635) (-904.514) [-907.552] -- 0:00:22
661500 -- (-904.980) (-901.843) (-903.988) [-904.123] * (-903.153) (-909.551) [-904.349] (-905.308) -- 0:00:22
662000 -- [-903.184] (-902.364) (-907.758) (-905.659) * (-901.802) [-903.840] (-902.535) (-905.377) -- 0:00:21
662500 -- (-904.761) (-904.637) [-901.193] (-904.100) * (-905.836) (-902.650) [-904.921] (-906.707) -- 0:00:21
663000 -- (-906.503) (-903.272) [-901.420] (-904.233) * (-903.305) (-902.693) (-904.426) [-907.332] -- 0:00:21
663500 -- (-907.176) [-904.850] (-904.108) (-904.626) * (-904.371) (-906.312) [-903.195] (-903.785) -- 0:00:21
664000 -- [-905.835] (-902.708) (-903.986) (-904.102) * (-906.727) [-902.978] (-905.333) (-911.084) -- 0:00:21
664500 -- (-907.175) [-902.325] (-904.888) (-904.229) * (-904.914) (-904.914) [-900.592] (-909.930) -- 0:00:21
665000 -- (-907.569) (-903.980) [-902.431] (-907.723) * (-902.368) (-905.401) (-903.226) [-906.778] -- 0:00:21
Average standard deviation of split frequencies: 0.006503
665500 -- [-907.765] (-904.027) (-900.577) (-904.681) * (-901.609) [-905.073] (-903.326) (-905.672) -- 0:00:21
666000 -- (-904.613) [-906.289] (-903.537) (-905.383) * (-906.015) (-905.084) [-901.846] (-905.367) -- 0:00:21
666500 -- (-903.242) [-902.704] (-902.726) (-904.611) * (-903.449) [-902.199] (-902.513) (-910.523) -- 0:00:21
667000 -- (-904.505) [-904.419] (-904.911) (-906.263) * (-905.174) (-902.030) (-902.105) [-906.494] -- 0:00:21
667500 -- (-902.995) (-901.967) [-905.984] (-904.080) * (-905.002) [-900.452] (-902.629) (-903.603) -- 0:00:21
668000 -- [-902.660] (-903.621) (-903.112) (-902.830) * (-906.737) [-901.079] (-901.582) (-906.169) -- 0:00:21
668500 -- (-903.141) [-902.527] (-903.387) (-901.411) * [-901.813] (-902.496) (-902.858) (-903.073) -- 0:00:21
669000 -- (-904.048) [-904.746] (-907.050) (-902.526) * [-901.503] (-902.036) (-902.646) (-904.377) -- 0:00:21
669500 -- (-906.234) (-904.289) (-905.308) [-901.864] * (-902.933) [-902.690] (-903.711) (-902.937) -- 0:00:21
670000 -- (-908.244) (-904.420) (-906.951) [-905.365] * (-907.637) (-905.261) [-902.044] (-902.700) -- 0:00:21
Average standard deviation of split frequencies: 0.006502
670500 -- (-903.789) [-902.468] (-907.182) (-906.445) * [-902.779] (-901.722) (-903.829) (-902.964) -- 0:00:21
671000 -- (-904.966) (-904.102) [-904.915] (-902.598) * [-902.119] (-903.505) (-905.506) (-905.187) -- 0:00:21
671500 -- [-904.802] (-905.703) (-904.268) (-902.573) * (-902.089) (-902.915) [-904.624] (-905.410) -- 0:00:21
672000 -- (-904.400) (-902.775) (-905.090) [-904.199] * (-904.645) (-904.067) (-904.621) [-905.768] -- 0:00:21
672500 -- (-905.584) (-904.086) [-903.289] (-904.731) * (-902.466) (-903.584) (-904.651) [-901.708] -- 0:00:21
673000 -- (-903.431) (-903.366) [-902.538] (-903.847) * (-902.128) (-903.828) (-904.530) [-904.173] -- 0:00:21
673500 -- (-904.064) (-903.139) (-902.881) [-902.705] * (-904.277) (-902.512) (-904.558) [-903.680] -- 0:00:21
674000 -- (-903.132) (-903.071) [-905.540] (-906.190) * [-906.084] (-905.567) (-904.824) (-903.112) -- 0:00:21
674500 -- (-903.708) [-901.772] (-904.363) (-903.956) * [-903.313] (-903.878) (-902.467) (-904.411) -- 0:00:21
675000 -- (-904.069) (-904.736) [-903.854] (-906.668) * (-902.118) (-903.251) [-903.709] (-904.162) -- 0:00:21
Average standard deviation of split frequencies: 0.006668
675500 -- (-903.555) (-905.479) (-906.769) [-902.737] * (-902.470) (-903.131) (-907.126) [-903.229] -- 0:00:21
676000 -- (-904.208) (-904.869) (-905.824) [-904.903] * [-903.237] (-902.466) (-908.151) (-910.960) -- 0:00:21
676500 -- (-906.608) [-905.853] (-907.212) (-902.298) * (-903.452) (-907.491) (-903.727) [-903.269] -- 0:00:21
677000 -- [-904.560] (-904.044) (-904.315) (-908.948) * [-901.874] (-906.823) (-906.558) (-907.640) -- 0:00:20
677500 -- (-910.430) (-904.259) (-905.111) [-905.341] * (-901.794) (-903.665) [-906.835] (-903.743) -- 0:00:20
678000 -- (-906.506) (-904.029) [-904.212] (-902.835) * [-902.287] (-904.965) (-903.816) (-904.104) -- 0:00:20
678500 -- [-905.367] (-905.028) (-904.040) (-903.581) * (-901.343) [-904.650] (-903.463) (-902.878) -- 0:00:20
679000 -- (-904.978) (-903.845) (-906.048) [-903.631] * (-903.134) (-903.967) (-903.631) [-904.348] -- 0:00:20
679500 -- [-911.529] (-904.849) (-906.876) (-903.858) * [-902.078] (-902.959) (-903.143) (-904.530) -- 0:00:20
680000 -- (-908.085) (-902.054) (-901.615) [-903.052] * (-901.070) (-904.288) (-903.300) [-905.811] -- 0:00:20
Average standard deviation of split frequencies: 0.006882
680500 -- (-905.271) (-900.754) [-904.671] (-900.765) * (-902.278) (-902.203) (-905.103) [-902.311] -- 0:00:20
681000 -- [-906.128] (-905.769) (-901.929) (-900.667) * (-900.774) [-903.415] (-907.033) (-905.811) -- 0:00:20
681500 -- (-904.817) (-905.903) [-901.498] (-909.736) * [-904.220] (-904.053) (-903.039) (-903.369) -- 0:00:20
682000 -- [-903.176] (-901.788) (-901.977) (-905.730) * [-904.785] (-903.332) (-901.673) (-904.001) -- 0:00:20
682500 -- (-905.188) [-905.286] (-904.786) (-904.906) * (-904.306) [-903.925] (-901.438) (-903.524) -- 0:00:20
683000 -- (-903.026) (-903.745) [-903.883] (-903.816) * [-904.381] (-906.532) (-904.607) (-905.661) -- 0:00:20
683500 -- [-904.128] (-909.338) (-906.065) (-902.838) * (-903.484) [-906.385] (-904.269) (-903.240) -- 0:00:20
684000 -- (-904.402) [-908.509] (-905.814) (-904.841) * (-911.538) (-902.216) [-902.122] (-906.431) -- 0:00:20
684500 -- (-902.879) (-903.017) [-903.547] (-908.245) * (-904.406) (-902.487) [-902.700] (-904.049) -- 0:00:20
685000 -- (-903.629) (-902.480) (-903.483) [-905.525] * [-902.687] (-903.700) (-905.946) (-905.865) -- 0:00:20
Average standard deviation of split frequencies: 0.006571
685500 -- (-906.167) (-904.254) (-905.419) [-902.692] * (-905.962) [-902.306] (-904.128) (-903.947) -- 0:00:20
686000 -- (-903.438) [-903.931] (-903.161) (-902.513) * [-903.829] (-903.188) (-903.543) (-904.226) -- 0:00:20
686500 -- (-903.508) (-909.502) (-906.063) [-901.721] * (-906.087) (-904.082) [-903.158] (-903.402) -- 0:00:20
687000 -- [-903.988] (-904.664) (-902.333) (-903.298) * [-901.759] (-903.004) (-906.319) (-903.424) -- 0:00:20
687500 -- [-904.795] (-903.758) (-902.950) (-903.342) * [-902.689] (-903.123) (-903.499) (-902.960) -- 0:00:20
688000 -- (-903.672) [-904.353] (-905.782) (-903.098) * (-902.988) (-905.186) [-901.542] (-905.011) -- 0:00:20
688500 -- (-902.619) (-906.834) [-905.706] (-903.762) * (-905.128) [-903.869] (-904.526) (-905.987) -- 0:00:20
689000 -- (-903.932) [-905.725] (-907.867) (-903.691) * (-904.676) (-902.854) [-905.236] (-907.540) -- 0:00:20
689500 -- (-905.634) (-903.147) [-904.306] (-903.013) * (-903.044) (-903.267) (-906.633) [-907.525] -- 0:00:20
690000 -- (-903.659) (-903.795) (-905.588) [-903.723] * [-906.469] (-905.553) (-908.851) (-903.607) -- 0:00:20
Average standard deviation of split frequencies: 0.006399
690500 -- (-906.102) (-901.868) (-901.497) [-904.706] * (-905.271) (-904.304) [-902.575] (-905.242) -- 0:00:20
691000 -- [-904.435] (-902.918) (-905.021) (-907.810) * (-903.685) (-900.773) [-905.453] (-902.123) -- 0:00:20
691500 -- (-905.503) (-903.412) [-903.732] (-908.084) * (-906.195) (-904.907) (-907.619) [-904.921] -- 0:00:20
692000 -- (-904.900) (-903.275) [-904.308] (-905.575) * (-902.874) (-903.974) (-902.765) [-905.710] -- 0:00:20
692500 -- (-903.091) [-902.062] (-905.383) (-904.242) * (-903.795) [-902.764] (-903.769) (-903.324) -- 0:00:19
693000 -- (-907.185) (-903.951) [-904.848] (-904.034) * (-903.731) (-907.603) (-904.629) [-902.652] -- 0:00:19
693500 -- [-904.905] (-904.287) (-903.718) (-905.146) * (-903.504) (-902.095) (-906.062) [-904.996] -- 0:00:19
694000 -- (-906.017) (-906.175) (-904.230) [-905.773] * (-907.638) (-906.368) (-904.762) [-910.512] -- 0:00:19
694500 -- [-904.293] (-907.400) (-904.211) (-902.612) * (-904.049) (-907.645) [-903.313] (-903.525) -- 0:00:19
695000 -- (-902.968) [-903.586] (-907.760) (-908.592) * (-906.335) (-904.668) (-903.702) [-904.624] -- 0:00:19
Average standard deviation of split frequencies: 0.006561
695500 -- [-903.066] (-901.783) (-903.323) (-901.691) * (-906.489) (-903.890) [-902.317] (-904.239) -- 0:00:19
696000 -- (-903.642) [-906.763] (-904.941) (-901.578) * [-904.592] (-902.691) (-905.519) (-903.964) -- 0:00:19
696500 -- (-903.524) [-904.819] (-905.507) (-906.548) * [-903.757] (-906.262) (-905.961) (-902.488) -- 0:00:19
697000 -- (-904.179) (-907.029) [-903.219] (-900.629) * (-903.540) (-906.793) (-906.697) [-903.823] -- 0:00:19
697500 -- [-902.746] (-905.219) (-901.749) (-905.688) * (-910.039) (-904.146) (-904.259) [-902.097] -- 0:00:19
698000 -- (-903.459) (-905.953) (-903.083) [-903.297] * (-903.663) (-904.273) (-903.189) [-902.721] -- 0:00:19
698500 -- (-903.871) (-905.273) [-901.227] (-905.034) * [-902.775] (-903.971) (-905.276) (-908.271) -- 0:00:19
699000 -- (-906.820) [-903.177] (-902.222) (-900.838) * [-904.340] (-902.594) (-905.103) (-903.225) -- 0:00:19
699500 -- (-908.868) (-901.355) (-904.431) [-903.642] * (-904.398) (-904.751) [-904.636] (-906.029) -- 0:00:19
700000 -- (-905.879) (-903.220) [-904.690] (-902.492) * (-904.762) (-907.028) [-903.678] (-904.512) -- 0:00:19
Average standard deviation of split frequencies: 0.006097
700500 -- (-907.121) [-905.297] (-903.404) (-904.312) * (-907.910) [-902.927] (-902.658) (-902.736) -- 0:00:19
701000 -- [-905.682] (-903.922) (-904.009) (-907.977) * (-909.249) (-903.100) (-904.901) [-902.557] -- 0:00:19
701500 -- (-902.461) (-903.585) (-905.676) [-903.313] * [-906.082] (-907.116) (-906.843) (-905.507) -- 0:00:19
702000 -- [-902.879] (-903.347) (-905.319) (-901.519) * (-901.047) (-903.630) [-904.542] (-903.587) -- 0:00:19
702500 -- [-905.405] (-905.285) (-903.837) (-907.041) * [-903.349] (-902.195) (-905.642) (-905.868) -- 0:00:19
703000 -- (-904.517) (-903.450) (-911.068) [-904.524] * (-903.551) (-902.350) (-904.399) [-902.813] -- 0:00:19
703500 -- (-904.978) (-903.504) (-903.848) [-902.628] * (-902.775) [-903.417] (-905.251) (-903.892) -- 0:00:19
704000 -- (-906.252) (-904.825) [-903.521] (-904.242) * (-902.303) (-903.268) (-905.360) [-903.312] -- 0:00:19
704500 -- (-906.464) (-905.328) [-903.594] (-901.474) * [-902.908] (-905.440) (-903.658) (-903.104) -- 0:00:19
705000 -- [-908.919] (-903.254) (-902.765) (-901.695) * [-907.450] (-910.458) (-906.497) (-902.691) -- 0:00:19
Average standard deviation of split frequencies: 0.005717
705500 -- (-908.790) (-902.045) [-903.954] (-906.411) * (-903.422) (-903.286) (-904.025) [-903.538] -- 0:00:19
706000 -- (-906.791) (-902.222) [-903.302] (-904.410) * (-903.686) (-903.587) (-901.871) [-903.256] -- 0:00:19
706500 -- [-904.174] (-903.665) (-901.495) (-905.263) * (-903.773) (-903.545) [-902.981] (-903.622) -- 0:00:19
707000 -- (-904.964) (-906.198) (-902.063) [-903.916] * (-904.093) [-905.348] (-905.676) (-902.816) -- 0:00:19
707500 -- (-905.593) (-905.054) [-904.428] (-901.284) * (-904.141) (-904.669) (-903.512) [-903.398] -- 0:00:19
708000 -- [-906.448] (-905.895) (-903.793) (-905.415) * [-903.285] (-902.562) (-905.351) (-906.490) -- 0:00:18
708500 -- [-906.730] (-904.992) (-906.243) (-903.446) * (-904.473) (-904.988) [-902.677] (-903.760) -- 0:00:18
709000 -- (-905.919) (-905.064) (-908.504) [-906.506] * (-905.210) (-906.014) [-900.926] (-903.689) -- 0:00:18
709500 -- (-905.109) (-902.508) [-904.085] (-901.615) * (-902.621) [-904.270] (-904.783) (-907.962) -- 0:00:18
710000 -- [-905.681] (-903.152) (-906.938) (-902.553) * (-905.240) (-903.135) [-903.553] (-905.248) -- 0:00:18
Average standard deviation of split frequencies: 0.005887
710500 -- (-904.695) (-908.056) (-905.875) [-900.892] * (-904.378) (-902.082) [-903.988] (-906.318) -- 0:00:18
711000 -- (-905.263) (-905.036) (-905.857) [-901.705] * (-906.647) [-904.275] (-902.758) (-904.440) -- 0:00:18
711500 -- (-902.713) [-901.980] (-909.889) (-904.758) * (-902.467) (-902.584) [-904.079] (-905.052) -- 0:00:18
712000 -- (-908.556) [-902.667] (-912.045) (-902.353) * [-902.501] (-901.615) (-901.296) (-902.528) -- 0:00:18
712500 -- (-904.478) (-904.849) [-902.796] (-901.865) * (-903.675) (-900.768) (-905.008) [-903.556] -- 0:00:18
713000 -- (-904.320) (-903.437) [-903.193] (-903.497) * (-906.622) [-901.508] (-906.406) (-904.102) -- 0:00:18
713500 -- (-906.027) [-902.149] (-903.824) (-905.166) * (-902.893) [-901.265] (-904.781) (-904.463) -- 0:00:18
714000 -- (-903.950) [-905.211] (-904.297) (-902.969) * (-907.827) (-905.836) (-905.004) [-902.876] -- 0:00:18
714500 -- [-901.228] (-903.591) (-904.124) (-902.045) * [-906.661] (-904.422) (-903.443) (-902.655) -- 0:00:18
715000 -- (-908.263) (-900.365) (-903.686) [-905.974] * [-904.211] (-903.503) (-905.979) (-901.955) -- 0:00:18
Average standard deviation of split frequencies: 0.005487
715500 -- (-902.958) (-901.967) (-906.498) [-901.062] * (-902.894) (-904.620) (-902.085) [-904.650] -- 0:00:18
716000 -- (-904.172) (-901.998) (-904.645) [-904.390] * (-905.324) (-906.796) [-904.940] (-905.221) -- 0:00:18
716500 -- (-908.122) (-902.188) [-902.898] (-905.769) * (-902.557) [-902.671] (-902.895) (-903.779) -- 0:00:18
717000 -- (-904.278) (-902.012) (-902.891) [-904.210] * (-904.252) (-903.841) (-903.933) [-904.129] -- 0:00:18
717500 -- (-904.837) (-903.605) [-902.911] (-904.629) * (-906.413) (-903.441) (-905.535) [-902.083] -- 0:00:18
718000 -- (-902.202) [-902.543] (-909.060) (-903.369) * (-905.017) (-902.053) (-904.849) [-901.069] -- 0:00:18
718500 -- (-902.278) (-901.623) [-903.405] (-903.191) * (-903.489) (-902.216) (-903.149) [-901.076] -- 0:00:18
719000 -- (-902.985) (-906.557) (-905.713) [-903.211] * [-901.704] (-901.449) (-901.591) (-904.898) -- 0:00:18
719500 -- [-903.441] (-910.012) (-902.413) (-901.252) * (-904.123) [-902.647] (-902.974) (-903.381) -- 0:00:18
720000 -- (-904.761) [-902.380] (-902.307) (-903.542) * [-903.129] (-902.765) (-905.384) (-907.293) -- 0:00:18
Average standard deviation of split frequencies: 0.005189
720500 -- (-907.556) (-904.220) [-904.131] (-901.700) * (-902.114) (-903.439) (-907.113) [-903.304] -- 0:00:18
721000 -- (-906.182) (-905.379) (-906.937) [-901.627] * (-903.868) (-905.293) [-907.381] (-901.146) -- 0:00:18
721500 -- (-904.237) (-904.276) (-904.721) [-900.755] * (-904.412) [-904.666] (-902.998) (-904.338) -- 0:00:18
722000 -- (-902.529) (-903.636) [-904.584] (-905.382) * (-907.403) [-902.553] (-902.182) (-902.237) -- 0:00:18
722500 -- (-902.394) (-904.510) [-906.546] (-904.862) * (-903.988) (-905.419) (-903.990) [-904.862] -- 0:00:18
723000 -- (-901.960) [-904.077] (-906.080) (-906.148) * [-904.022] (-907.755) (-904.879) (-902.839) -- 0:00:18
723500 -- (-904.777) (-903.493) [-902.639] (-903.979) * (-904.135) (-906.724) (-902.425) [-904.847] -- 0:00:17
724000 -- (-905.048) [-902.355] (-906.892) (-901.993) * (-905.727) [-902.364] (-902.572) (-902.819) -- 0:00:17
724500 -- (-908.125) (-903.319) (-906.540) [-903.600] * (-900.575) [-903.004] (-905.759) (-904.032) -- 0:00:17
725000 -- (-906.061) (-900.851) [-904.467] (-903.875) * (-904.906) (-902.238) (-903.948) [-903.278] -- 0:00:17
Average standard deviation of split frequencies: 0.006656
725500 -- [-902.942] (-903.347) (-904.415) (-906.676) * (-908.411) [-903.276] (-904.807) (-902.644) -- 0:00:17
726000 -- [-902.942] (-903.613) (-909.479) (-902.549) * (-904.551) [-902.846] (-904.805) (-902.358) -- 0:00:17
726500 -- (-901.255) (-903.482) [-906.778] (-903.102) * (-903.942) (-902.993) [-904.448] (-904.960) -- 0:00:17
727000 -- (-903.127) [-902.574] (-902.654) (-901.728) * (-904.212) (-905.370) (-903.966) [-902.091] -- 0:00:17
727500 -- [-902.756] (-906.482) (-905.717) (-904.728) * [-902.391] (-903.487) (-903.139) (-903.520) -- 0:00:17
728000 -- (-904.597) (-901.941) (-904.113) [-903.383] * (-906.356) (-904.361) (-903.818) [-912.589] -- 0:00:17
728500 -- (-908.272) [-902.153] (-905.127) (-903.298) * (-901.804) (-904.750) (-905.665) [-903.783] -- 0:00:17
729000 -- [-910.412] (-901.475) (-904.169) (-906.317) * [-903.234] (-903.700) (-902.579) (-905.530) -- 0:00:17
729500 -- (-906.003) [-903.854] (-906.096) (-903.882) * (-901.846) (-904.887) (-903.269) [-905.115] -- 0:00:17
730000 -- [-905.521] (-902.840) (-903.595) (-905.681) * (-904.025) [-905.500] (-903.391) (-903.958) -- 0:00:17
Average standard deviation of split frequencies: 0.006774
730500 -- [-902.022] (-904.155) (-904.302) (-903.759) * (-902.759) (-904.741) [-904.376] (-903.101) -- 0:00:17
731000 -- [-902.149] (-904.254) (-903.864) (-901.088) * [-904.189] (-903.899) (-904.705) (-902.559) -- 0:00:17
731500 -- [-909.329] (-906.293) (-901.220) (-904.073) * (-904.591) [-902.549] (-905.090) (-904.813) -- 0:00:17
732000 -- (-910.467) (-904.287) [-901.024] (-901.676) * (-902.947) (-902.487) [-903.929] (-905.403) -- 0:00:17
732500 -- (-904.464) (-906.199) (-904.034) [-901.127] * (-908.104) (-902.833) (-902.575) [-901.599] -- 0:00:17
733000 -- [-903.191] (-903.788) (-903.427) (-901.850) * (-903.129) [-902.744] (-903.660) (-903.426) -- 0:00:17
733500 -- [-905.484] (-902.803) (-905.450) (-901.714) * (-904.012) [-905.425] (-903.910) (-904.390) -- 0:00:17
734000 -- (-903.336) (-902.653) (-902.893) [-901.915] * [-903.308] (-902.650) (-902.521) (-903.912) -- 0:00:17
734500 -- (-905.766) (-907.358) [-904.443] (-902.710) * (-901.833) [-906.630] (-901.820) (-900.428) -- 0:00:17
735000 -- [-906.130] (-903.157) (-909.436) (-904.197) * (-910.959) (-903.691) (-903.755) [-900.771] -- 0:00:17
Average standard deviation of split frequencies: 0.006605
735500 -- (-905.387) (-901.936) (-903.584) [-904.819] * [-904.315] (-905.222) (-904.399) (-903.266) -- 0:00:17
736000 -- (-904.896) [-903.052] (-904.260) (-904.738) * (-902.374) (-902.019) (-904.371) [-904.003] -- 0:00:17
736500 -- (-904.484) (-902.870) (-902.613) [-903.454] * [-905.506] (-903.761) (-904.378) (-908.170) -- 0:00:17
737000 -- [-902.692] (-903.066) (-907.060) (-901.327) * (-900.370) (-902.956) (-903.709) [-904.559] -- 0:00:17
737500 -- [-904.080] (-904.152) (-904.096) (-906.095) * (-902.357) [-902.805] (-905.717) (-905.722) -- 0:00:17
738000 -- (-905.696) (-902.626) [-902.500] (-903.682) * [-907.256] (-904.619) (-905.435) (-904.965) -- 0:00:17
738500 -- [-904.400] (-905.448) (-901.607) (-902.400) * (-907.664) [-907.549] (-907.560) (-904.168) -- 0:00:16
739000 -- (-905.346) (-902.960) (-901.997) [-903.411] * (-905.281) [-904.067] (-904.530) (-906.633) -- 0:00:16
739500 -- [-902.211] (-904.061) (-903.147) (-903.446) * (-903.396) [-903.456] (-905.097) (-903.232) -- 0:00:16
740000 -- (-902.501) (-903.255) [-903.313] (-904.035) * (-907.781) (-909.546) (-903.790) [-902.663] -- 0:00:16
Average standard deviation of split frequencies: 0.006882
740500 -- (-902.424) (-903.692) [-902.541] (-905.844) * [-899.995] (-902.994) (-912.065) (-903.364) -- 0:00:16
741000 -- (-903.411) (-901.242) (-903.427) [-904.781] * (-905.297) (-903.494) (-906.342) [-903.268] -- 0:00:16
741500 -- (-904.171) (-905.683) (-903.493) [-904.912] * (-903.576) (-903.758) [-905.060] (-903.124) -- 0:00:16
742000 -- (-908.002) (-903.962) [-903.876] (-902.257) * [-902.569] (-903.151) (-903.428) (-904.170) -- 0:00:16
742500 -- (-904.079) [-902.689] (-903.012) (-905.575) * (-902.522) (-904.125) (-903.654) [-903.761] -- 0:00:16
743000 -- (-905.787) (-902.891) (-905.247) [-903.489] * (-902.857) (-904.888) [-906.297] (-903.898) -- 0:00:16
743500 -- [-907.579] (-905.103) (-906.668) (-902.624) * (-901.689) (-903.268) [-908.873] (-901.873) -- 0:00:16
744000 -- (-902.401) (-903.079) (-904.530) [-900.957] * [-904.220] (-902.255) (-904.005) (-905.527) -- 0:00:16
744500 -- (-904.383) (-902.723) (-905.605) [-901.891] * (-901.174) (-902.663) (-903.720) [-905.345] -- 0:00:16
745000 -- (-902.976) (-904.202) [-903.660] (-904.219) * (-900.971) (-906.060) [-906.241] (-903.375) -- 0:00:16
Average standard deviation of split frequencies: 0.006754
745500 -- [-903.433] (-903.144) (-904.655) (-903.801) * (-901.996) [-904.601] (-902.411) (-903.280) -- 0:00:16
746000 -- [-904.288] (-901.867) (-903.096) (-902.919) * [-900.892] (-905.061) (-902.720) (-904.912) -- 0:00:16
746500 -- (-905.672) [-905.853] (-904.352) (-908.763) * [-901.980] (-905.294) (-903.916) (-905.971) -- 0:00:16
747000 -- [-903.564] (-904.186) (-903.069) (-903.150) * [-903.165] (-902.819) (-904.890) (-904.479) -- 0:00:16
747500 -- (-903.855) [-905.826] (-904.262) (-903.518) * [-901.747] (-906.179) (-903.007) (-907.033) -- 0:00:16
748000 -- (-903.879) (-901.830) (-903.899) [-903.341] * [-901.533] (-902.281) (-903.698) (-902.274) -- 0:00:16
748500 -- (-908.104) [-903.435] (-905.050) (-903.163) * (-901.785) (-904.124) [-902.695] (-905.229) -- 0:00:16
749000 -- [-905.455] (-905.158) (-903.405) (-903.264) * (-905.558) (-904.960) (-902.267) [-906.494] -- 0:00:16
749500 -- (-904.061) (-903.762) [-904.380] (-905.008) * [-903.892] (-904.942) (-902.434) (-904.006) -- 0:00:16
750000 -- (-904.504) (-907.173) (-903.452) [-902.536] * (-903.450) [-906.389] (-904.244) (-902.851) -- 0:00:16
Average standard deviation of split frequencies: 0.005861
750500 -- (-905.076) [-912.420] (-904.217) (-905.294) * (-906.743) (-905.140) [-903.251] (-903.744) -- 0:00:16
751000 -- (-903.760) (-906.457) [-903.923] (-902.500) * (-904.255) (-906.214) (-903.221) [-902.773] -- 0:00:16
751500 -- (-903.622) (-902.465) [-903.300] (-901.786) * (-904.257) (-907.861) [-903.523] (-902.137) -- 0:00:16
752000 -- (-904.632) [-903.158] (-904.096) (-904.451) * (-908.729) (-904.157) (-904.692) [-906.337] -- 0:00:16
752500 -- (-903.685) (-905.922) (-905.108) [-905.382] * [-904.742] (-905.536) (-904.004) (-906.104) -- 0:00:16
753000 -- (-903.113) (-902.752) (-906.958) [-904.198] * (-908.136) [-901.956] (-903.686) (-903.325) -- 0:00:16
753500 -- [-903.294] (-909.575) (-901.634) (-905.110) * (-903.690) (-907.137) (-906.748) [-903.213] -- 0:00:16
754000 -- (-904.504) (-902.372) [-902.370] (-906.077) * (-904.403) (-903.393) (-903.350) [-903.802] -- 0:00:15
754500 -- [-902.782] (-904.064) (-903.853) (-904.319) * (-905.468) [-903.394] (-906.719) (-903.634) -- 0:00:15
755000 -- (-901.537) [-903.354] (-905.170) (-903.043) * (-906.384) [-902.011] (-902.820) (-901.884) -- 0:00:15
Average standard deviation of split frequencies: 0.005363
755500 -- (-906.847) [-902.934] (-903.204) (-902.978) * (-905.829) (-904.026) [-902.786] (-903.362) -- 0:00:15
756000 -- (-904.078) (-903.392) (-901.545) [-904.792] * [-902.168] (-904.049) (-907.649) (-905.792) -- 0:00:15
756500 -- [-906.368] (-905.067) (-902.700) (-903.912) * (-903.377) (-902.367) (-904.881) [-902.538] -- 0:00:15
757000 -- (-904.846) [-902.746] (-908.677) (-902.905) * [-902.274] (-903.196) (-906.155) (-902.151) -- 0:00:15
757500 -- (-904.316) [-902.951] (-904.643) (-903.909) * (-904.663) (-901.891) [-906.447] (-906.441) -- 0:00:15
758000 -- (-903.532) (-908.955) [-904.840] (-902.638) * [-904.263] (-904.213) (-905.740) (-903.303) -- 0:00:15
758500 -- (-902.793) (-905.987) [-904.222] (-905.675) * (-906.382) [-907.172] (-904.257) (-903.766) -- 0:00:15
759000 -- (-904.482) [-905.334] (-904.040) (-903.984) * (-904.204) (-907.344) (-905.216) [-903.975] -- 0:00:15
759500 -- (-903.959) (-903.790) (-904.870) [-907.268] * (-903.526) (-903.763) [-906.151] (-904.616) -- 0:00:15
760000 -- (-903.142) [-902.664] (-905.681) (-904.500) * [-907.046] (-902.887) (-905.630) (-908.750) -- 0:00:15
Average standard deviation of split frequencies: 0.005371
760500 -- (-904.437) [-904.627] (-905.193) (-909.163) * (-902.598) [-903.610] (-905.492) (-905.852) -- 0:00:15
761000 -- [-903.387] (-903.911) (-903.346) (-903.037) * (-902.731) (-904.588) (-904.940) [-902.420] -- 0:00:15
761500 -- (-904.450) [-904.050] (-905.544) (-902.922) * (-902.405) (-905.316) [-905.669] (-903.252) -- 0:00:15
762000 -- (-902.269) (-903.818) [-902.669] (-902.483) * [-904.188] (-905.517) (-905.449) (-903.944) -- 0:00:15
762500 -- [-904.475] (-904.838) (-907.683) (-903.073) * (-901.980) (-906.736) (-907.364) [-901.277] -- 0:00:15
763000 -- [-905.116] (-907.052) (-904.146) (-905.018) * [-905.282] (-903.565) (-905.716) (-902.862) -- 0:00:15
763500 -- (-905.475) [-903.250] (-906.568) (-903.018) * (-903.114) [-905.091] (-904.303) (-903.537) -- 0:00:15
764000 -- (-906.009) [-903.836] (-902.594) (-902.914) * (-903.248) (-903.651) [-906.964] (-907.100) -- 0:00:15
764500 -- (-908.912) (-905.201) (-903.940) [-904.314] * (-902.829) (-905.786) (-906.846) [-904.949] -- 0:00:15
765000 -- (-903.339) [-903.144] (-904.253) (-905.413) * (-901.840) (-904.844) [-902.243] (-909.562) -- 0:00:15
Average standard deviation of split frequencies: 0.005252
765500 -- [-902.779] (-902.984) (-903.014) (-902.306) * [-904.297] (-903.804) (-902.220) (-910.186) -- 0:00:15
766000 -- (-903.882) (-905.733) (-903.022) [-902.812] * (-903.213) [-906.237] (-904.193) (-904.261) -- 0:00:15
766500 -- (-905.124) (-902.499) (-906.547) [-902.910] * (-903.763) [-904.211] (-907.179) (-905.304) -- 0:00:15
767000 -- (-903.570) [-901.413] (-904.564) (-906.544) * (-907.043) (-905.533) [-902.403] (-901.631) -- 0:00:15
767500 -- (-904.298) (-902.385) (-905.774) [-903.346] * (-905.318) (-902.355) [-904.910] (-903.217) -- 0:00:15
768000 -- (-905.225) [-902.058] (-903.661) (-903.172) * (-903.222) [-903.493] (-903.192) (-902.431) -- 0:00:15
768500 -- (-907.123) [-902.622] (-904.700) (-904.879) * (-904.514) (-905.160) [-902.287] (-903.394) -- 0:00:15
769000 -- [-903.165] (-901.445) (-908.528) (-902.688) * (-903.634) (-904.060) [-903.806] (-903.791) -- 0:00:15
769500 -- (-907.583) (-902.814) [-909.088] (-905.520) * (-906.878) [-901.605] (-904.884) (-905.290) -- 0:00:14
770000 -- [-903.338] (-904.431) (-905.634) (-902.762) * (-904.196) [-904.207] (-901.805) (-903.080) -- 0:00:14
Average standard deviation of split frequencies: 0.005546
770500 -- [-905.300] (-903.029) (-903.253) (-902.640) * [-905.311] (-902.744) (-905.188) (-902.782) -- 0:00:14
771000 -- (-904.119) [-904.134] (-907.713) (-902.965) * (-905.245) (-901.425) (-902.921) [-902.341] -- 0:00:14
771500 -- (-902.053) [-902.704] (-907.816) (-902.937) * (-903.259) (-903.846) (-903.055) [-902.839] -- 0:00:14
772000 -- (-906.843) (-904.138) [-905.881] (-904.449) * (-904.439) [-904.597] (-904.398) (-902.294) -- 0:00:14
772500 -- (-908.665) (-904.634) (-903.837) [-903.874] * (-904.521) [-904.436] (-901.645) (-904.817) -- 0:00:14
773000 -- [-902.830] (-901.646) (-902.644) (-903.307) * (-903.783) (-903.897) (-905.316) [-904.101] -- 0:00:14
773500 -- [-900.153] (-903.749) (-904.262) (-902.988) * [-903.676] (-903.209) (-904.751) (-902.963) -- 0:00:14
774000 -- (-907.179) (-902.906) (-902.855) [-901.066] * [-904.194] (-904.335) (-906.934) (-903.610) -- 0:00:14
774500 -- (-904.155) (-903.954) (-910.386) [-902.487] * [-902.656] (-906.702) (-903.675) (-902.725) -- 0:00:14
775000 -- (-902.752) (-902.737) [-901.197] (-902.654) * (-902.487) (-904.640) (-904.659) [-903.399] -- 0:00:14
Average standard deviation of split frequencies: 0.005427
775500 -- (-904.393) (-903.270) (-903.081) [-902.409] * (-903.246) (-904.878) (-904.500) [-904.394] -- 0:00:14
776000 -- [-904.001] (-903.277) (-903.645) (-905.702) * [-902.649] (-904.492) (-905.907) (-906.197) -- 0:00:14
776500 -- (-903.590) [-905.299] (-902.376) (-905.073) * (-902.240) [-903.348] (-903.166) (-902.651) -- 0:00:14
777000 -- [-903.400] (-903.187) (-901.324) (-901.991) * (-903.343) (-904.478) (-901.860) [-902.619] -- 0:00:14
777500 -- (-903.953) [-903.047] (-902.856) (-906.563) * [-905.284] (-903.226) (-905.132) (-903.616) -- 0:00:14
778000 -- (-904.479) (-903.827) [-904.139] (-902.634) * (-903.838) [-903.056] (-904.652) (-902.419) -- 0:00:14
778500 -- (-904.266) (-905.046) [-902.233] (-903.890) * (-901.437) (-903.127) [-905.946] (-903.030) -- 0:00:14
779000 -- [-902.667] (-904.709) (-902.446) (-909.634) * (-904.231) [-907.653] (-903.322) (-906.072) -- 0:00:14
779500 -- (-907.783) (-902.046) (-903.383) [-903.136] * (-902.378) [-903.208] (-904.818) (-907.317) -- 0:00:14
780000 -- (-904.309) (-904.037) [-902.153] (-903.545) * (-902.312) (-903.698) (-903.356) [-906.524] -- 0:00:14
Average standard deviation of split frequencies: 0.006189
780500 -- (-903.731) (-903.110) (-905.397) [-903.829] * (-902.231) [-906.453] (-903.873) (-903.178) -- 0:00:14
781000 -- (-903.638) (-905.041) (-906.977) [-902.515] * (-902.815) (-904.557) [-901.445] (-906.286) -- 0:00:14
781500 -- [-903.484] (-903.495) (-903.395) (-905.237) * (-902.028) (-906.917) [-900.736] (-904.640) -- 0:00:14
782000 -- (-905.580) (-905.981) (-904.449) [-903.745] * [-902.495] (-903.292) (-902.549) (-903.265) -- 0:00:14
782500 -- (-903.937) [-903.938] (-904.365) (-903.655) * (-903.851) [-902.789] (-901.114) (-903.906) -- 0:00:14
783000 -- (-901.750) [-902.754] (-903.490) (-906.136) * [-902.815] (-905.500) (-904.842) (-903.247) -- 0:00:14
783500 -- (-902.354) (-904.638) [-902.312] (-904.882) * (-903.334) (-907.896) (-902.079) [-904.067] -- 0:00:14
784000 -- (-902.241) [-905.679] (-904.929) (-903.095) * [-905.979] (-903.557) (-903.672) (-902.234) -- 0:00:14
784500 -- (-903.716) [-901.347] (-903.831) (-904.120) * (-902.202) [-905.087] (-902.686) (-903.330) -- 0:00:14
785000 -- (-906.824) [-903.629] (-903.918) (-903.716) * [-901.875] (-906.394) (-903.370) (-904.182) -- 0:00:13
Average standard deviation of split frequencies: 0.006297
785500 -- [-903.768] (-904.696) (-906.621) (-903.439) * (-902.547) (-904.950) (-905.898) [-907.383] -- 0:00:13
786000 -- (-902.959) (-904.914) (-904.117) [-902.823] * (-902.855) [-902.416] (-903.772) (-904.459) -- 0:00:13
786500 -- [-903.544] (-903.807) (-905.150) (-907.578) * (-902.097) (-904.395) [-903.572] (-905.226) -- 0:00:13
787000 -- [-903.961] (-905.895) (-905.801) (-903.814) * (-903.428) (-904.854) [-905.238] (-906.142) -- 0:00:13
787500 -- (-905.718) (-904.666) (-904.895) [-904.931] * (-903.586) [-905.580] (-905.128) (-904.750) -- 0:00:13
788000 -- (-904.158) (-903.595) (-903.281) [-904.548] * (-907.217) (-903.867) [-902.554] (-904.155) -- 0:00:13
788500 -- [-902.500] (-905.474) (-902.193) (-903.423) * (-904.974) (-904.156) (-903.853) [-901.838] -- 0:00:13
789000 -- (-901.658) (-904.985) [-902.011] (-904.704) * (-901.912) (-904.151) [-905.371] (-903.906) -- 0:00:13
789500 -- (-902.138) (-900.260) [-901.291] (-909.800) * (-903.439) [-905.531] (-904.994) (-902.891) -- 0:00:13
790000 -- (-906.134) [-901.960] (-904.260) (-905.764) * (-905.910) (-902.422) (-903.908) [-903.378] -- 0:00:13
Average standard deviation of split frequencies: 0.005286
790500 -- [-904.008] (-903.256) (-903.878) (-906.355) * [-904.647] (-905.498) (-903.330) (-904.785) -- 0:00:13
791000 -- (-903.155) [-903.131] (-903.073) (-903.202) * (-904.541) (-904.536) [-903.834] (-904.067) -- 0:00:13
791500 -- [-902.866] (-902.832) (-903.480) (-904.250) * (-902.614) (-904.968) (-903.097) [-904.376] -- 0:00:13
792000 -- (-907.340) [-901.259] (-904.682) (-904.193) * (-901.435) (-905.201) (-904.108) [-905.680] -- 0:00:13
792500 -- (-904.622) (-902.339) (-907.395) [-906.510] * (-903.623) (-903.357) [-907.445] (-903.660) -- 0:00:13
793000 -- [-904.249] (-902.235) (-903.791) (-904.716) * (-902.428) [-905.426] (-904.315) (-905.132) -- 0:00:13
793500 -- (-902.163) (-905.827) [-902.443] (-905.584) * [-905.030] (-904.702) (-904.304) (-905.018) -- 0:00:13
794000 -- [-903.215] (-906.954) (-901.057) (-904.395) * (-901.877) [-904.807] (-904.094) (-906.954) -- 0:00:13
794500 -- (-903.861) (-903.580) (-903.951) [-902.752] * (-904.462) (-903.386) [-901.792] (-903.557) -- 0:00:13
795000 -- (-904.349) (-905.172) (-902.849) [-905.083] * (-905.153) [-901.413] (-901.243) (-903.200) -- 0:00:13
Average standard deviation of split frequencies: 0.005133
795500 -- (-902.776) (-903.460) (-909.055) [-905.702] * [-903.162] (-902.465) (-902.639) (-905.998) -- 0:00:13
796000 -- (-903.250) (-904.126) [-902.904] (-902.338) * (-904.743) (-900.987) (-901.846) [-903.495] -- 0:00:13
796500 -- (-905.647) (-906.173) (-902.937) [-903.396] * (-903.114) [-905.368] (-902.583) (-903.346) -- 0:00:13
797000 -- (-905.265) (-906.730) [-902.525] (-902.292) * (-902.865) (-901.885) [-902.496] (-903.539) -- 0:00:13
797500 -- [-907.573] (-906.526) (-904.975) (-901.633) * (-905.484) [-902.640] (-903.718) (-910.789) -- 0:00:13
798000 -- (-902.390) (-905.197) (-903.167) [-903.133] * (-905.282) (-902.960) (-903.671) [-905.519] -- 0:00:13
798500 -- [-906.147] (-903.737) (-907.092) (-901.434) * (-902.649) (-902.075) [-904.081] (-905.340) -- 0:00:13
799000 -- [-905.751] (-904.563) (-905.125) (-902.801) * [-901.557] (-901.831) (-904.990) (-903.255) -- 0:00:13
799500 -- [-904.943] (-903.367) (-906.658) (-902.858) * (-903.728) [-901.945] (-905.682) (-906.868) -- 0:00:13
800000 -- (-902.669) [-905.533] (-904.388) (-902.491) * (-903.198) (-902.616) (-904.362) [-905.119] -- 0:00:12
Average standard deviation of split frequencies: 0.005181
800500 -- (-903.415) [-904.303] (-903.907) (-902.125) * (-903.638) [-901.411] (-905.296) (-905.596) -- 0:00:12
801000 -- [-906.277] (-903.668) (-902.594) (-904.823) * (-903.511) [-904.883] (-900.896) (-907.167) -- 0:00:12
801500 -- (-901.171) [-904.529] (-904.262) (-905.397) * (-904.263) [-904.185] (-902.509) (-907.344) -- 0:00:12
802000 -- [-900.828] (-904.660) (-903.972) (-905.294) * (-905.156) (-903.937) [-904.172] (-902.943) -- 0:00:12
802500 -- (-907.633) (-906.417) (-904.695) [-901.892] * (-904.704) (-903.410) [-902.307] (-903.805) -- 0:00:12
803000 -- (-904.453) [-903.739] (-905.247) (-908.438) * (-900.250) (-901.858) [-902.625] (-904.280) -- 0:00:12
803500 -- (-903.501) (-909.087) [-903.027] (-902.298) * [-902.442] (-905.963) (-906.199) (-906.246) -- 0:00:12
804000 -- (-900.589) (-905.172) (-903.337) [-902.453] * [-902.381] (-903.621) (-906.187) (-906.147) -- 0:00:12
804500 -- (-904.404) (-908.282) [-901.846] (-902.402) * (-909.760) (-903.865) (-904.980) [-902.407] -- 0:00:12
805000 -- [-904.519] (-905.598) (-902.923) (-904.041) * (-906.733) (-901.920) (-905.075) [-904.038] -- 0:00:12
Average standard deviation of split frequencies: 0.005264
805500 -- (-902.918) (-905.582) [-900.100] (-904.308) * (-903.532) (-903.967) (-906.542) [-904.348] -- 0:00:12
806000 -- (-908.581) (-908.400) [-902.076] (-904.315) * (-901.219) (-901.300) (-904.605) [-903.895] -- 0:00:12
806500 -- (-907.867) (-903.767) [-900.477] (-906.006) * [-904.886] (-902.132) (-900.699) (-903.517) -- 0:00:12
807000 -- (-906.636) (-905.578) (-904.654) [-907.825] * (-905.192) (-902.960) [-902.646] (-902.676) -- 0:00:12
807500 -- [-904.428] (-903.431) (-905.905) (-902.283) * [-901.699] (-907.390) (-905.219) (-903.465) -- 0:00:12
808000 -- (-904.274) [-903.204] (-902.530) (-904.698) * (-902.092) (-901.329) (-905.809) [-904.117] -- 0:00:12
808500 -- (-903.636) (-905.183) [-904.940] (-905.586) * (-903.669) (-900.936) (-909.424) [-905.637] -- 0:00:12
809000 -- [-903.465] (-904.862) (-903.262) (-906.735) * [-901.120] (-904.343) (-907.666) (-904.053) -- 0:00:12
809500 -- [-903.650] (-904.394) (-902.611) (-903.239) * (-903.719) (-904.732) (-902.976) [-903.559] -- 0:00:12
810000 -- [-903.209] (-907.824) (-903.932) (-906.233) * (-902.804) [-901.198] (-905.703) (-903.190) -- 0:00:12
Average standard deviation of split frequencies: 0.005052
810500 -- (-902.783) (-905.750) [-907.836] (-902.828) * (-902.473) (-902.361) [-903.930] (-903.477) -- 0:00:12
811000 -- (-905.561) (-901.484) (-905.716) [-903.825] * (-908.556) (-902.526) [-903.703] (-907.075) -- 0:00:12
811500 -- [-902.874] (-904.834) (-905.752) (-903.898) * (-905.649) [-902.668] (-904.353) (-903.108) -- 0:00:12
812000 -- (-907.974) (-903.142) (-905.577) [-902.492] * (-905.419) (-902.505) (-904.444) [-903.086] -- 0:00:12
812500 -- (-904.124) (-901.747) (-904.960) [-903.156] * (-904.924) (-902.574) (-903.597) [-902.091] -- 0:00:12
813000 -- (-902.899) [-903.527] (-902.195) (-903.383) * (-906.317) (-902.122) [-902.714] (-903.385) -- 0:00:12
813500 -- (-904.272) [-904.180] (-905.831) (-904.991) * (-904.471) (-905.104) (-903.600) [-902.744] -- 0:00:12
814000 -- (-902.873) (-904.410) (-903.808) [-905.795] * (-902.957) [-903.047] (-902.211) (-901.254) -- 0:00:12
814500 -- (-906.299) [-904.887] (-904.887) (-906.128) * (-903.573) (-902.356) [-902.459] (-904.318) -- 0:00:12
815000 -- (-904.570) [-903.215] (-903.307) (-905.932) * (-906.348) (-901.587) (-903.492) [-900.820] -- 0:00:12
Average standard deviation of split frequencies: 0.005127
815500 -- (-904.770) [-904.578] (-904.967) (-903.766) * [-905.398] (-905.247) (-903.873) (-904.719) -- 0:00:11
816000 -- (-905.462) (-902.898) (-903.735) [-902.947] * (-903.761) (-907.858) [-908.242] (-905.173) -- 0:00:11
816500 -- (-905.739) (-904.415) (-902.532) [-902.030] * (-903.026) (-906.353) [-901.839] (-904.748) -- 0:00:11
817000 -- (-903.568) (-904.142) (-904.697) [-906.081] * (-904.006) [-901.503] (-902.849) (-902.419) -- 0:00:11
817500 -- (-901.288) (-903.799) [-904.225] (-903.821) * (-903.041) (-905.404) [-902.804] (-905.710) -- 0:00:11
818000 -- (-904.233) (-905.306) [-906.645] (-906.738) * (-902.624) [-901.794] (-906.899) (-901.202) -- 0:00:11
818500 -- (-905.286) (-902.508) [-901.985] (-902.803) * (-902.361) [-902.870] (-903.824) (-905.489) -- 0:00:11
819000 -- (-903.174) (-904.222) [-902.241] (-901.945) * (-907.187) [-902.774] (-904.325) (-904.717) -- 0:00:11
819500 -- [-903.960] (-902.851) (-904.264) (-903.287) * (-904.985) [-904.438] (-905.252) (-903.066) -- 0:00:11
820000 -- [-902.788] (-902.865) (-904.419) (-904.599) * [-903.594] (-904.523) (-901.495) (-903.791) -- 0:00:11
Average standard deviation of split frequencies: 0.005277
820500 -- (-901.606) (-905.899) (-903.141) [-903.804] * [-905.031] (-902.335) (-905.741) (-904.297) -- 0:00:11
821000 -- (-905.008) (-902.264) (-910.466) [-904.991] * [-905.299] (-903.824) (-906.770) (-903.165) -- 0:00:11
821500 -- (-902.319) (-901.597) (-906.446) [-902.081] * (-904.181) (-902.559) (-902.541) [-903.165] -- 0:00:11
822000 -- (-901.553) (-904.800) (-905.434) [-904.060] * (-904.105) (-905.590) (-903.307) [-902.378] -- 0:00:11
822500 -- (-904.022) [-903.847] (-903.048) (-902.186) * (-905.266) (-902.048) [-903.178] (-902.916) -- 0:00:11
823000 -- (-905.779) [-905.231] (-903.261) (-903.442) * (-901.861) (-904.919) [-903.696] (-904.811) -- 0:00:11
823500 -- (-903.587) [-902.542] (-908.000) (-902.693) * [-902.358] (-902.317) (-901.373) (-903.707) -- 0:00:11
824000 -- (-904.592) (-903.690) (-907.560) [-903.417] * [-905.080] (-903.139) (-904.007) (-907.784) -- 0:00:11
824500 -- (-903.508) [-902.708] (-904.767) (-902.379) * (-904.556) [-901.931] (-902.429) (-903.796) -- 0:00:11
825000 -- (-903.637) (-903.008) [-903.685] (-904.944) * (-906.726) (-905.059) (-902.387) [-904.236] -- 0:00:11
Average standard deviation of split frequencies: 0.005350
825500 -- [-902.327] (-903.741) (-904.393) (-903.154) * (-905.923) [-904.078] (-902.546) (-905.043) -- 0:00:11
826000 -- (-904.593) [-904.343] (-908.540) (-903.037) * (-905.101) (-906.896) (-902.836) [-903.161] -- 0:00:11
826500 -- (-904.676) (-904.408) [-903.657] (-903.847) * (-910.519) [-901.504] (-901.166) (-903.260) -- 0:00:11
827000 -- [-905.780] (-910.107) (-902.757) (-902.654) * (-903.044) [-903.289] (-902.245) (-904.501) -- 0:00:11
827500 -- [-905.172] (-904.472) (-904.784) (-903.895) * [-901.816] (-903.702) (-902.262) (-910.964) -- 0:00:11
828000 -- (-904.714) (-907.754) (-906.114) [-903.515] * [-905.766] (-904.804) (-903.912) (-905.779) -- 0:00:11
828500 -- (-903.248) (-907.507) (-902.592) [-902.066] * (-902.474) (-904.520) [-909.224] (-907.682) -- 0:00:11
829000 -- [-903.066] (-907.543) (-905.443) (-904.798) * (-902.566) (-907.142) (-904.103) [-903.402] -- 0:00:11
829500 -- (-901.751) (-906.149) [-902.905] (-903.776) * [-903.462] (-902.778) (-904.256) (-910.971) -- 0:00:11
830000 -- (-903.284) (-904.558) (-905.789) [-904.750] * [-902.781] (-903.299) (-902.362) (-904.665) -- 0:00:11
Average standard deviation of split frequencies: 0.005249
830500 -- [-903.194] (-905.888) (-904.985) (-902.589) * (-904.783) (-900.923) (-904.048) [-905.367] -- 0:00:11
831000 -- [-903.391] (-905.218) (-904.638) (-907.637) * (-905.140) (-901.214) [-904.695] (-906.072) -- 0:00:10
831500 -- (-906.433) [-906.059] (-902.013) (-905.815) * (-902.992) (-901.448) [-901.049] (-906.450) -- 0:00:10
832000 -- [-903.786] (-906.442) (-905.913) (-906.526) * [-903.530] (-901.707) (-903.087) (-904.360) -- 0:00:10
832500 -- (-901.201) [-909.856] (-902.650) (-905.818) * [-904.002] (-902.239) (-901.374) (-905.196) -- 0:00:10
833000 -- (-901.569) (-908.485) (-900.931) [-901.184] * (-905.821) (-903.419) (-901.600) [-903.088] -- 0:00:10
833500 -- (-904.409) (-910.137) [-907.595] (-901.435) * (-908.150) (-908.491) [-902.091] (-903.381) -- 0:00:10
834000 -- [-901.288] (-905.050) (-902.728) (-901.527) * [-904.942] (-903.509) (-903.095) (-903.015) -- 0:00:10
834500 -- (-909.505) (-905.590) (-902.633) [-902.615] * [-901.367] (-906.322) (-903.771) (-902.450) -- 0:00:10
835000 -- (-904.140) (-907.534) [-905.332] (-901.986) * [-903.997] (-902.902) (-909.377) (-904.364) -- 0:00:10
Average standard deviation of split frequencies: 0.004899
835500 -- (-902.545) [-902.443] (-902.440) (-905.463) * [-904.489] (-905.190) (-905.396) (-903.454) -- 0:00:10
836000 -- (-903.719) (-908.390) [-904.476] (-903.073) * (-904.746) (-906.575) (-905.824) [-902.397] -- 0:00:10
836500 -- (-904.318) (-909.644) (-909.317) [-905.074] * [-901.617] (-904.563) (-906.210) (-902.840) -- 0:00:10
837000 -- (-902.591) [-910.029] (-903.542) (-905.334) * (-903.271) (-904.692) (-904.776) [-904.489] -- 0:00:10
837500 -- [-902.166] (-904.464) (-903.056) (-900.945) * (-904.231) (-904.010) [-903.955] (-901.228) -- 0:00:10
838000 -- (-902.507) (-904.155) [-902.668] (-901.697) * [-903.424] (-905.423) (-903.975) (-902.567) -- 0:00:10
838500 -- (-903.503) [-905.988] (-902.050) (-903.612) * (-905.192) (-903.043) (-904.018) [-903.172] -- 0:00:10
839000 -- (-903.603) (-902.150) [-904.439] (-903.885) * [-902.149] (-902.399) (-906.302) (-902.581) -- 0:00:10
839500 -- (-903.891) (-904.189) [-902.163] (-904.672) * [-901.140] (-905.405) (-908.005) (-902.911) -- 0:00:10
840000 -- (-906.271) (-904.441) (-901.896) [-903.175] * (-902.752) (-902.567) [-903.468] (-901.707) -- 0:00:10
Average standard deviation of split frequencies: 0.005012
840500 -- (-906.292) (-906.080) (-902.630) [-901.712] * (-903.825) (-905.531) (-902.961) [-902.233] -- 0:00:10
841000 -- (-903.467) (-903.441) [-901.992] (-902.907) * (-900.928) (-903.973) [-905.765] (-903.343) -- 0:00:10
841500 -- (-903.964) [-903.142] (-903.639) (-902.274) * [-902.985] (-904.197) (-904.699) (-903.486) -- 0:00:10
842000 -- (-904.489) (-904.318) (-906.192) [-902.865] * (-906.220) [-902.854] (-905.381) (-904.293) -- 0:00:10
842500 -- [-903.851] (-902.813) (-904.323) (-903.508) * (-910.557) (-903.572) (-904.259) [-902.652] -- 0:00:10
843000 -- (-902.439) [-903.924] (-905.838) (-902.940) * [-902.891] (-902.579) (-907.969) (-903.366) -- 0:00:10
843500 -- (-902.204) [-904.249] (-904.910) (-900.399) * [-901.587] (-905.259) (-905.348) (-904.304) -- 0:00:10
844000 -- (-901.580) (-904.284) [-902.846] (-902.313) * (-905.693) (-902.453) [-905.569] (-904.360) -- 0:00:10
844500 -- (-906.600) [-903.490] (-903.203) (-900.407) * (-902.929) (-903.097) (-903.795) [-903.486] -- 0:00:10
845000 -- (-903.256) (-904.362) (-906.749) [-901.712] * (-905.725) (-904.408) [-903.122] (-905.112) -- 0:00:10
Average standard deviation of split frequencies: 0.005154
845500 -- [-905.742] (-905.531) (-902.666) (-902.132) * [-902.986] (-904.026) (-903.298) (-902.776) -- 0:00:10
846000 -- [-901.819] (-904.781) (-902.788) (-902.984) * [-903.495] (-905.808) (-905.567) (-906.663) -- 0:00:10
846500 -- [-904.728] (-903.519) (-903.309) (-902.707) * (-901.104) (-903.847) (-902.851) [-901.413] -- 0:00:09
847000 -- (-903.792) [-906.722] (-903.066) (-901.356) * (-902.205) (-903.024) (-906.676) [-903.127] -- 0:00:09
847500 -- (-907.633) (-904.459) [-901.318] (-906.512) * [-903.003] (-905.401) (-905.437) (-904.228) -- 0:00:09
848000 -- [-902.625] (-904.180) (-903.755) (-906.049) * [-903.702] (-905.066) (-905.785) (-903.344) -- 0:00:09
848500 -- (-903.763) (-904.198) [-903.192] (-902.367) * [-902.524] (-902.950) (-903.167) (-902.054) -- 0:00:09
849000 -- (-903.619) (-902.452) (-901.942) [-902.247] * [-902.134] (-903.790) (-902.020) (-904.765) -- 0:00:09
849500 -- (-902.872) (-904.355) [-901.361] (-903.820) * (-904.163) (-903.106) (-903.828) [-903.653] -- 0:00:09
850000 -- (-905.560) (-904.506) (-903.492) [-904.272] * (-902.766) (-904.952) [-902.141] (-902.133) -- 0:00:09
Average standard deviation of split frequencies: 0.005334
850500 -- (-904.645) (-902.674) (-900.760) [-903.263] * (-903.963) (-904.561) (-902.093) [-903.671] -- 0:00:09
851000 -- (-903.451) (-902.790) [-901.259] (-902.695) * [-901.705] (-905.025) (-903.041) (-903.672) -- 0:00:09
851500 -- (-903.289) (-906.973) [-899.676] (-904.669) * (-901.667) (-903.965) [-902.096] (-902.615) -- 0:00:09
852000 -- (-904.264) (-902.966) [-903.957] (-902.943) * (-903.866) (-904.106) [-905.914] (-904.289) -- 0:00:09
852500 -- (-902.551) (-903.087) (-902.012) [-907.540] * (-903.704) [-906.749] (-904.206) (-906.776) -- 0:00:09
853000 -- (-903.861) [-900.949] (-901.601) (-907.574) * (-902.262) [-907.941] (-905.294) (-905.785) -- 0:00:09
853500 -- [-903.410] (-900.228) (-903.170) (-905.915) * [-904.929] (-911.525) (-905.410) (-904.921) -- 0:00:09
854000 -- [-904.553] (-902.904) (-906.182) (-907.026) * (-906.417) (-904.210) (-903.883) [-902.941] -- 0:00:09
854500 -- (-904.692) [-908.320] (-905.304) (-904.789) * (-906.434) [-904.980] (-902.316) (-905.303) -- 0:00:09
855000 -- (-903.936) [-904.614] (-902.991) (-904.631) * (-902.199) (-905.919) (-902.620) [-905.466] -- 0:00:09
Average standard deviation of split frequencies: 0.005266
855500 -- (-903.159) [-902.430] (-903.332) (-903.810) * [-905.171] (-903.114) (-906.532) (-907.611) -- 0:00:09
856000 -- (-902.918) (-902.379) (-904.288) [-906.720] * (-908.284) (-904.830) [-904.239] (-906.485) -- 0:00:09
856500 -- (-902.436) [-900.618] (-903.095) (-903.409) * (-904.738) (-902.636) (-906.617) [-909.207] -- 0:00:09
857000 -- (-902.691) [-904.002] (-904.975) (-903.433) * (-904.392) [-902.916] (-903.518) (-903.143) -- 0:00:09
857500 -- [-903.266] (-902.381) (-902.075) (-903.482) * (-901.528) [-902.680] (-904.155) (-904.691) -- 0:00:09
858000 -- (-903.388) (-904.012) [-903.163] (-902.362) * (-901.349) (-903.049) [-903.068] (-906.291) -- 0:00:09
858500 -- (-902.866) (-905.782) (-902.780) [-903.196] * [-902.213] (-905.495) (-903.366) (-905.694) -- 0:00:09
859000 -- (-903.174) (-910.188) (-903.640) [-902.748] * (-903.979) [-904.505] (-907.406) (-905.207) -- 0:00:09
859500 -- [-904.140] (-904.718) (-905.030) (-904.235) * (-903.860) (-904.263) (-904.784) [-901.088] -- 0:00:09
860000 -- (-904.022) (-904.766) [-906.745] (-902.623) * (-903.383) (-902.909) (-903.483) [-904.493] -- 0:00:09
Average standard deviation of split frequencies: 0.005066
860500 -- [-903.428] (-907.432) (-905.088) (-903.314) * (-903.518) [-903.081] (-903.830) (-900.542) -- 0:00:09
861000 -- (-903.009) (-904.572) [-902.370] (-905.175) * [-901.524] (-906.228) (-903.181) (-902.865) -- 0:00:09
861500 -- (-907.793) (-902.964) [-900.674] (-907.090) * [-902.585] (-907.514) (-902.951) (-908.623) -- 0:00:09
862000 -- [-903.592] (-907.588) (-906.105) (-904.649) * (-900.952) (-904.959) (-903.836) [-903.661] -- 0:00:08
862500 -- (-904.877) [-903.279] (-903.279) (-901.444) * [-902.189] (-905.518) (-904.985) (-905.873) -- 0:00:08
863000 -- [-906.211] (-903.476) (-902.582) (-905.689) * (-903.997) (-901.343) [-904.112] (-902.554) -- 0:00:08
863500 -- (-903.508) (-902.703) [-902.512] (-902.370) * (-904.640) [-904.075] (-902.859) (-904.681) -- 0:00:08
864000 -- [-906.373] (-908.589) (-903.209) (-901.323) * (-903.539) (-907.298) (-902.859) [-903.093] -- 0:00:08
864500 -- (-905.415) [-903.363] (-903.061) (-902.248) * (-904.039) (-905.026) [-904.822] (-901.887) -- 0:00:08
865000 -- (-905.226) (-903.579) (-905.672) [-902.215] * [-903.282] (-906.173) (-903.604) (-905.410) -- 0:00:08
Average standard deviation of split frequencies: 0.005171
865500 -- (-904.874) (-903.191) (-906.114) [-901.671] * (-905.229) [-903.114] (-903.296) (-903.973) -- 0:00:08
866000 -- (-906.717) (-904.104) (-904.114) [-901.481] * (-903.663) [-905.006] (-902.414) (-905.390) -- 0:00:08
866500 -- (-906.338) (-902.855) (-904.951) [-902.304] * (-903.641) [-903.252] (-902.471) (-907.974) -- 0:00:08
867000 -- (-905.169) (-903.753) (-902.919) [-902.561] * [-901.616] (-903.480) (-901.866) (-904.312) -- 0:00:08
867500 -- (-906.382) [-903.368] (-902.443) (-900.904) * (-901.498) (-901.704) [-901.765] (-904.308) -- 0:00:08
868000 -- (-902.621) (-903.813) [-903.216] (-904.236) * (-903.665) (-905.100) (-904.467) [-904.914] -- 0:00:08
868500 -- (-904.447) [-902.379] (-902.595) (-903.653) * (-902.338) (-905.033) (-904.268) [-902.832] -- 0:00:08
869000 -- (-906.942) [-906.056] (-904.441) (-905.081) * (-905.333) (-904.187) (-903.594) [-905.421] -- 0:00:08
869500 -- [-901.422] (-902.476) (-903.950) (-902.414) * (-901.275) (-905.604) [-905.134] (-904.052) -- 0:00:08
870000 -- [-902.557] (-903.525) (-903.417) (-902.740) * (-903.210) [-903.737] (-902.397) (-903.508) -- 0:00:08
Average standard deviation of split frequencies: 0.005279
870500 -- (-901.749) [-901.479] (-902.085) (-902.366) * (-902.640) (-905.615) (-905.460) [-902.127] -- 0:00:08
871000 -- (-903.740) (-903.950) [-901.819] (-902.262) * (-901.842) (-904.866) (-901.808) [-904.965] -- 0:00:08
871500 -- (-905.077) [-903.121] (-905.708) (-904.610) * (-900.976) (-903.991) [-903.192] (-908.319) -- 0:00:08
872000 -- (-903.805) (-902.280) [-904.718] (-905.845) * (-904.682) [-903.777] (-903.638) (-901.693) -- 0:00:08
872500 -- (-902.840) (-902.034) [-904.345] (-904.885) * (-903.600) [-904.222] (-908.601) (-902.458) -- 0:00:08
873000 -- (-901.738) (-902.817) (-902.915) [-904.716] * [-904.839] (-902.707) (-906.947) (-902.894) -- 0:00:08
873500 -- (-903.236) (-909.787) [-906.618] (-904.099) * (-906.856) (-903.601) (-903.580) [-902.235] -- 0:00:08
874000 -- (-908.163) (-901.585) [-905.834] (-910.715) * (-906.596) [-902.095] (-902.910) (-900.937) -- 0:00:08
874500 -- (-904.586) (-904.467) [-907.257] (-902.933) * [-902.428] (-901.505) (-904.520) (-904.142) -- 0:00:08
875000 -- [-904.465] (-902.927) (-908.284) (-901.823) * [-904.322] (-902.980) (-902.874) (-903.217) -- 0:00:08
Average standard deviation of split frequencies: 0.005583
875500 -- (-903.432) (-902.264) [-906.536] (-901.919) * [-903.597] (-902.191) (-907.953) (-901.498) -- 0:00:08
876000 -- (-903.905) [-903.504] (-903.303) (-902.006) * [-904.416] (-907.588) (-903.746) (-912.628) -- 0:00:08
876500 -- (-904.074) (-902.534) [-902.911] (-903.061) * (-902.794) (-902.891) (-905.436) [-903.245] -- 0:00:08
877000 -- [-903.751] (-903.560) (-903.979) (-902.241) * (-903.195) [-900.862] (-902.277) (-899.821) -- 0:00:07
877500 -- (-902.556) [-902.377] (-910.110) (-902.546) * (-903.618) (-903.181) (-903.056) [-902.529] -- 0:00:07
878000 -- (-901.741) [-904.766] (-902.441) (-901.264) * (-906.177) [-902.770] (-906.236) (-903.286) -- 0:00:07
878500 -- [-904.926] (-903.060) (-902.894) (-902.881) * (-906.554) [-900.765] (-902.793) (-903.923) -- 0:00:07
879000 -- (-903.614) [-907.369] (-902.622) (-903.290) * (-901.803) [-902.188] (-903.311) (-904.783) -- 0:00:07
879500 -- (-902.244) (-902.702) (-905.543) [-905.988] * (-904.121) (-902.782) [-903.302] (-903.792) -- 0:00:07
880000 -- (-906.650) [-901.195] (-906.039) (-904.063) * (-909.169) [-902.360] (-904.406) (-902.519) -- 0:00:07
Average standard deviation of split frequencies: 0.005286
880500 -- (-905.618) [-902.844] (-905.108) (-901.227) * (-910.282) [-903.028] (-905.949) (-902.407) -- 0:00:07
881000 -- (-900.473) (-901.913) [-903.772] (-902.587) * [-905.848] (-904.070) (-903.946) (-904.240) -- 0:00:07
881500 -- (-906.060) (-901.972) [-905.932] (-901.929) * (-905.145) [-902.825] (-903.486) (-903.775) -- 0:00:07
882000 -- (-904.470) (-907.376) (-901.183) [-903.382] * [-904.240] (-903.144) (-903.822) (-904.135) -- 0:00:07
882500 -- [-904.445] (-901.256) (-902.082) (-902.943) * (-902.341) (-904.514) [-905.811] (-903.236) -- 0:00:07
883000 -- [-904.074] (-906.120) (-903.596) (-902.482) * (-901.014) [-902.894] (-913.139) (-904.533) -- 0:00:07
883500 -- (-907.948) (-904.410) [-901.562] (-902.319) * (-905.446) (-904.178) (-903.687) [-902.683] -- 0:00:07
884000 -- [-902.684] (-902.209) (-903.175) (-904.538) * (-911.754) (-903.450) [-903.635] (-903.919) -- 0:00:07
884500 -- [-905.567] (-902.114) (-902.903) (-904.806) * [-905.553] (-902.869) (-903.434) (-904.143) -- 0:00:07
885000 -- (-904.271) (-902.663) [-903.526] (-903.814) * (-903.046) [-902.665] (-904.796) (-903.685) -- 0:00:07
Average standard deviation of split frequencies: 0.005088
885500 -- (-902.869) (-901.441) (-902.937) [-904.790] * (-903.971) [-902.949] (-904.061) (-908.360) -- 0:00:07
886000 -- [-903.388] (-900.913) (-903.991) (-904.905) * (-903.286) (-904.844) [-903.163] (-904.415) -- 0:00:07
886500 -- [-905.962] (-904.782) (-908.404) (-902.047) * (-903.398) (-903.331) [-904.877] (-907.554) -- 0:00:07
887000 -- (-904.773) (-906.135) (-901.750) [-902.292] * (-905.638) [-902.305] (-905.516) (-904.572) -- 0:00:07
887500 -- (-901.354) (-902.226) [-903.336] (-902.666) * (-903.538) (-903.167) (-903.790) [-903.449] -- 0:00:07
888000 -- (-906.072) [-901.605] (-904.254) (-907.158) * (-903.317) (-903.053) [-902.654] (-902.651) -- 0:00:07
888500 -- (-904.717) (-904.589) (-904.139) [-904.199] * (-906.942) (-904.571) (-902.751) [-902.850] -- 0:00:07
889000 -- [-901.877] (-904.075) (-906.008) (-906.627) * [-908.409] (-906.797) (-903.709) (-901.951) -- 0:00:07
889500 -- [-903.517] (-903.147) (-903.109) (-904.034) * (-902.105) (-904.369) [-903.679] (-904.049) -- 0:00:07
890000 -- (-903.705) (-903.066) (-900.358) [-902.250] * (-902.281) (-907.024) (-904.154) [-902.397] -- 0:00:07
Average standard deviation of split frequencies: 0.005326
890500 -- (-902.454) [-903.115] (-904.103) (-902.852) * (-909.456) (-906.704) (-903.420) [-903.144] -- 0:00:07
891000 -- (-903.061) (-900.920) (-902.230) [-902.382] * [-904.000] (-905.315) (-906.509) (-901.299) -- 0:00:07
891500 -- (-902.955) [-907.209] (-902.000) (-904.063) * (-906.455) [-906.701] (-902.800) (-904.111) -- 0:00:07
892000 -- (-902.551) [-904.230] (-904.426) (-902.306) * [-902.754] (-905.019) (-902.236) (-904.198) -- 0:00:07
892500 -- (-901.750) (-905.713) (-902.206) [-902.983] * (-906.099) (-901.783) (-902.564) [-906.027] -- 0:00:06
893000 -- (-901.607) (-903.636) [-903.636] (-903.410) * [-903.378] (-904.618) (-902.605) (-904.372) -- 0:00:06
893500 -- (-902.690) [-903.726] (-901.702) (-901.827) * (-903.680) (-901.616) [-902.329] (-903.869) -- 0:00:06
894000 -- [-904.460] (-902.853) (-901.997) (-903.495) * (-901.186) (-903.498) [-905.877] (-906.329) -- 0:00:06
894500 -- [-903.376] (-902.544) (-902.163) (-904.879) * (-904.136) (-906.042) [-902.445] (-904.619) -- 0:00:06
895000 -- (-903.414) [-902.723] (-901.814) (-906.647) * (-902.273) (-902.799) (-906.381) [-902.791] -- 0:00:06
Average standard deviation of split frequencies: 0.004998
895500 -- (-900.822) (-905.291) [-901.775] (-903.174) * [-904.056] (-907.339) (-903.283) (-902.656) -- 0:00:06
896000 -- (-904.902) (-904.075) [-902.695] (-904.265) * (-905.617) (-907.243) (-903.852) [-902.173] -- 0:00:06
896500 -- [-908.458] (-903.343) (-903.252) (-903.667) * (-902.080) [-909.337] (-902.484) (-902.809) -- 0:00:06
897000 -- (-903.226) (-905.835) (-903.640) [-904.374] * [-901.207] (-903.652) (-904.578) (-902.874) -- 0:00:06
897500 -- (-904.650) [-904.732] (-905.266) (-906.118) * (-905.153) [-904.381] (-902.944) (-906.429) -- 0:00:06
898000 -- (-904.603) (-905.741) [-901.577] (-905.372) * (-904.537) (-903.132) [-906.006] (-910.398) -- 0:00:06
898500 -- (-902.899) [-900.815] (-904.355) (-903.834) * [-905.966] (-903.535) (-902.708) (-902.910) -- 0:00:06
899000 -- (-902.446) [-905.531] (-902.661) (-903.003) * (-906.079) [-903.785] (-905.134) (-902.328) -- 0:00:06
899500 -- [-904.218] (-903.061) (-905.129) (-905.428) * (-912.764) [-903.656] (-906.856) (-903.343) -- 0:00:06
900000 -- (-907.427) [-902.736] (-904.926) (-903.332) * (-903.690) [-903.617] (-908.135) (-901.376) -- 0:00:06
Average standard deviation of split frequencies: 0.004850
900500 -- [-906.983] (-901.694) (-903.126) (-903.330) * (-905.018) [-904.435] (-905.988) (-905.546) -- 0:00:06
901000 -- (-900.836) (-903.524) (-901.897) [-904.279] * (-904.179) (-906.172) (-902.688) [-904.125] -- 0:00:06
901500 -- (-908.709) (-904.771) [-901.963] (-905.937) * (-904.288) [-902.349] (-904.188) (-903.820) -- 0:00:06
902000 -- (-906.294) (-904.266) [-902.046] (-903.058) * (-904.504) [-903.761] (-905.609) (-902.712) -- 0:00:06
902500 -- (-903.239) [-903.365] (-906.148) (-903.207) * [-905.268] (-902.457) (-902.880) (-904.552) -- 0:00:06
903000 -- [-907.620] (-903.298) (-903.745) (-902.944) * (-904.370) [-903.596] (-906.951) (-902.413) -- 0:00:06
903500 -- (-906.875) [-902.095] (-904.300) (-901.486) * [-904.058] (-903.820) (-905.561) (-903.024) -- 0:00:06
904000 -- (-903.137) (-905.684) [-907.093] (-902.304) * (-905.984) (-905.282) (-900.953) [-905.764] -- 0:00:06
904500 -- (-905.519) (-904.051) [-905.655] (-904.361) * (-902.578) (-902.920) (-901.380) [-904.668] -- 0:00:06
905000 -- (-912.613) (-903.593) [-904.479] (-904.172) * (-904.545) (-903.502) [-901.766] (-902.351) -- 0:00:06
Average standard deviation of split frequencies: 0.004752
905500 -- [-905.100] (-901.720) (-908.295) (-902.795) * (-903.527) (-901.776) (-907.686) [-903.303] -- 0:00:06
906000 -- (-910.679) (-901.809) [-903.699] (-904.801) * (-907.543) (-902.851) (-905.329) [-904.430] -- 0:00:06
906500 -- (-904.176) (-903.465) [-904.083] (-904.529) * [-902.787] (-902.990) (-904.418) (-902.526) -- 0:00:06
907000 -- (-904.936) [-905.956] (-909.193) (-904.977) * (-904.287) [-903.339] (-902.808) (-900.765) -- 0:00:06
907500 -- (-904.487) [-903.138] (-905.266) (-905.212) * (-904.888) (-902.447) [-902.268] (-903.029) -- 0:00:06
908000 -- (-903.980) (-901.857) [-903.015] (-907.902) * (-906.335) [-902.896] (-902.081) (-904.326) -- 0:00:05
908500 -- (-903.774) [-903.224] (-902.754) (-903.073) * (-903.211) (-905.123) (-904.437) [-902.469] -- 0:00:05
909000 -- (-902.889) (-902.201) [-906.148] (-908.763) * (-904.629) (-903.610) [-903.323] (-903.849) -- 0:00:05
909500 -- (-903.396) [-903.098] (-903.410) (-904.252) * [-901.571] (-903.283) (-903.701) (-907.576) -- 0:00:05
910000 -- (-903.817) (-904.885) (-902.912) [-903.029] * (-901.668) (-907.887) (-904.717) [-903.325] -- 0:00:05
Average standard deviation of split frequencies: 0.004866
910500 -- (-904.110) (-906.639) [-902.722] (-904.728) * (-903.056) (-902.848) (-904.076) [-903.906] -- 0:00:05
911000 -- (-903.752) (-904.189) [-906.752] (-902.592) * (-901.512) (-903.010) [-905.879] (-903.573) -- 0:00:05
911500 -- (-904.090) (-903.252) (-907.078) [-904.080] * (-903.361) (-903.581) [-903.769] (-904.107) -- 0:00:05
912000 -- [-904.021] (-903.284) (-904.221) (-901.748) * (-904.009) (-903.836) [-905.826] (-906.758) -- 0:00:05
912500 -- (-902.355) (-901.840) (-904.271) [-903.673] * (-903.252) (-903.497) [-903.088] (-905.880) -- 0:00:05
913000 -- (-902.614) [-902.173] (-904.042) (-903.774) * (-903.707) (-904.233) (-903.902) [-902.459] -- 0:00:05
913500 -- (-903.887) (-903.023) [-907.264] (-903.225) * [-903.927] (-903.165) (-902.653) (-902.717) -- 0:00:05
914000 -- (-903.126) (-904.183) (-904.741) [-903.903] * (-903.437) [-902.900] (-902.814) (-902.936) -- 0:00:05
914500 -- (-904.392) (-902.696) [-904.021] (-903.817) * (-901.964) (-901.839) (-903.778) [-901.977] -- 0:00:05
915000 -- (-904.173) [-900.933] (-903.262) (-903.547) * (-902.595) (-903.986) (-903.228) [-905.490] -- 0:00:05
Average standard deviation of split frequencies: 0.004666
915500 -- (-903.120) [-903.132] (-903.099) (-907.144) * (-903.396) (-906.555) (-905.133) [-903.278] -- 0:00:05
916000 -- (-902.738) (-904.064) [-903.296] (-904.748) * [-903.513] (-903.749) (-903.330) (-904.032) -- 0:00:05
916500 -- (-905.906) (-907.996) [-903.334] (-904.302) * [-905.855] (-904.253) (-905.435) (-907.678) -- 0:00:05
917000 -- (-904.243) [-903.244] (-903.169) (-904.476) * (-904.219) (-903.479) [-901.614] (-903.335) -- 0:00:05
917500 -- [-902.550] (-902.744) (-901.725) (-903.938) * (-903.501) (-904.602) (-902.930) [-901.434] -- 0:00:05
918000 -- (-902.326) [-906.381] (-903.325) (-907.182) * (-904.649) (-904.249) [-902.755] (-902.583) -- 0:00:05
918500 -- [-902.693] (-906.233) (-901.896) (-904.847) * (-905.172) (-906.067) (-902.490) [-903.156] -- 0:00:05
919000 -- (-903.220) (-900.253) [-903.066] (-903.996) * [-903.175] (-905.762) (-905.451) (-902.312) -- 0:00:05
919500 -- (-906.568) (-904.855) (-904.349) [-902.548] * (-904.356) (-907.807) (-902.434) [-903.227] -- 0:00:05
920000 -- (-905.038) [-903.792] (-906.544) (-902.607) * (-902.273) [-906.556] (-901.304) (-901.868) -- 0:00:05
Average standard deviation of split frequencies: 0.004779
920500 -- (-907.710) (-903.288) [-906.258] (-903.428) * (-902.155) (-908.177) (-903.208) [-902.744] -- 0:00:05
921000 -- (-908.767) (-902.354) (-903.372) [-904.285] * (-901.639) [-903.772] (-902.417) (-904.076) -- 0:00:05
921500 -- [-905.255] (-903.188) (-905.184) (-902.888) * (-902.503) [-903.513] (-904.907) (-905.209) -- 0:00:05
922000 -- (-903.091) [-902.798] (-903.711) (-904.577) * (-903.472) [-905.471] (-906.889) (-902.545) -- 0:00:05
922500 -- (-905.995) (-903.567) [-904.357] (-904.817) * (-903.381) (-903.058) (-904.848) [-900.729] -- 0:00:05
923000 -- (-904.227) (-905.885) (-904.299) [-901.991] * (-903.231) [-904.949] (-901.987) (-903.739) -- 0:00:05
923500 -- (-904.863) (-907.582) [-902.865] (-902.440) * (-902.486) (-903.272) [-900.361] (-900.617) -- 0:00:04
924000 -- (-902.931) (-904.226) (-903.350) [-901.125] * (-902.722) (-902.499) [-902.337] (-903.438) -- 0:00:04
924500 -- [-905.275] (-904.785) (-903.348) (-900.470) * (-903.590) (-903.528) [-907.672] (-902.266) -- 0:00:04
925000 -- (-905.813) (-908.924) [-906.975] (-902.148) * [-904.453] (-903.527) (-907.234) (-902.341) -- 0:00:04
Average standard deviation of split frequencies: 0.004717
925500 -- (-903.267) [-903.821] (-906.380) (-900.938) * (-903.487) (-904.255) (-905.694) [-902.888] -- 0:00:04
926000 -- (-903.152) (-902.754) [-906.389] (-902.026) * (-901.776) (-903.356) [-905.395] (-902.207) -- 0:00:04
926500 -- (-903.319) [-906.606] (-905.606) (-902.224) * (-902.710) (-902.688) (-906.612) [-905.162] -- 0:00:04
927000 -- (-905.386) (-903.662) (-902.421) [-902.032] * (-904.419) [-903.900] (-904.283) (-904.326) -- 0:00:04
927500 -- [-903.505] (-903.073) (-904.837) (-901.656) * (-906.512) [-904.703] (-903.946) (-905.789) -- 0:00:04
928000 -- (-902.909) (-905.539) [-908.369] (-903.848) * [-904.370] (-903.278) (-908.025) (-905.564) -- 0:00:04
928500 -- (-902.327) (-904.846) [-905.884] (-902.465) * (-905.386) (-904.000) [-904.479] (-906.425) -- 0:00:04
929000 -- (-903.557) [-904.262] (-902.751) (-902.819) * (-901.877) (-902.704) (-903.015) [-903.376] -- 0:00:04
929500 -- [-902.989] (-903.578) (-904.088) (-902.848) * (-908.010) (-903.963) (-904.678) [-904.195] -- 0:00:04
930000 -- (-903.103) [-902.613] (-903.125) (-902.062) * (-902.103) (-902.948) [-905.301] (-902.322) -- 0:00:04
Average standard deviation of split frequencies: 0.004795
930500 -- (-902.866) [-902.512] (-905.906) (-901.971) * (-905.478) [-905.633] (-903.239) (-903.473) -- 0:00:04
931000 -- (-902.469) (-905.856) [-903.159] (-902.475) * (-903.586) [-902.544] (-902.435) (-907.247) -- 0:00:04
931500 -- (-902.956) (-904.293) (-903.855) [-905.206] * (-903.279) (-904.398) [-903.750] (-902.882) -- 0:00:04
932000 -- (-904.566) (-907.018) [-903.071] (-902.704) * [-904.227] (-904.568) (-907.804) (-904.205) -- 0:00:04
932500 -- (-904.051) [-906.095] (-903.544) (-902.067) * (-905.626) [-906.003] (-904.493) (-906.747) -- 0:00:04
933000 -- (-903.097) (-906.985) [-905.040] (-904.943) * [-906.665] (-903.154) (-904.764) (-905.469) -- 0:00:04
933500 -- (-903.727) (-903.946) (-904.342) [-904.289] * (-907.081) (-905.544) (-903.464) [-903.797] -- 0:00:04
934000 -- (-903.224) (-903.036) [-904.064] (-903.068) * (-903.924) (-905.491) [-901.567] (-904.479) -- 0:00:04
934500 -- (-902.629) (-903.712) (-907.131) [-903.660] * [-904.981] (-901.505) (-904.806) (-905.784) -- 0:00:04
935000 -- (-904.606) [-903.795] (-907.375) (-902.154) * (-904.786) (-903.014) [-903.302] (-903.721) -- 0:00:04
Average standard deviation of split frequencies: 0.004801
935500 -- (-904.253) [-902.989] (-906.466) (-903.244) * (-907.317) (-902.868) [-906.330] (-911.699) -- 0:00:04
936000 -- [-904.206] (-903.444) (-905.508) (-905.201) * (-906.222) [-903.283] (-905.754) (-906.267) -- 0:00:04
936500 -- (-904.531) (-902.195) (-905.245) [-901.908] * (-902.753) (-905.081) (-905.736) [-904.621] -- 0:00:04
937000 -- [-904.701] (-902.834) (-903.712) (-903.752) * (-903.229) [-903.501] (-903.066) (-902.677) -- 0:00:04
937500 -- (-904.716) (-907.945) [-902.557] (-903.766) * (-903.093) (-903.320) (-905.440) [-902.748] -- 0:00:04
938000 -- (-908.269) (-904.608) (-905.278) [-901.519] * (-903.966) (-903.441) (-905.391) [-902.706] -- 0:00:04
938500 -- (-904.489) [-904.788] (-907.104) (-904.456) * [-902.592] (-901.642) (-903.902) (-906.122) -- 0:00:03
939000 -- (-903.138) (-906.010) (-902.991) [-900.539] * (-901.519) [-902.317] (-904.819) (-901.276) -- 0:00:03
939500 -- (-903.777) (-905.742) [-902.979] (-901.048) * (-903.146) (-904.762) [-907.285] (-904.874) -- 0:00:03
940000 -- (-905.401) [-901.981] (-902.585) (-903.777) * (-903.985) [-902.031] (-905.756) (-903.794) -- 0:00:03
Average standard deviation of split frequencies: 0.004978
940500 -- [-903.119] (-902.456) (-903.459) (-908.017) * (-907.306) (-900.905) (-904.849) [-902.906] -- 0:00:03
941000 -- (-904.502) [-903.358] (-902.998) (-903.090) * (-903.063) [-901.732] (-907.134) (-901.587) -- 0:00:03
941500 -- (-902.324) (-905.759) [-903.583] (-904.370) * (-910.129) [-903.162] (-903.601) (-903.434) -- 0:00:03
942000 -- (-903.273) [-903.877] (-902.623) (-904.155) * (-903.163) [-902.071] (-903.272) (-902.838) -- 0:00:03
942500 -- (-903.113) (-906.317) [-905.160] (-905.245) * [-903.340] (-901.847) (-909.652) (-902.234) -- 0:00:03
943000 -- [-904.390] (-902.577) (-908.511) (-904.372) * (-903.624) (-902.635) [-904.585] (-902.703) -- 0:00:03
943500 -- [-902.899] (-904.077) (-906.087) (-902.223) * [-910.939] (-904.126) (-902.876) (-904.628) -- 0:00:03
944000 -- (-904.059) [-902.694] (-902.238) (-908.529) * [-907.531] (-902.384) (-904.590) (-903.001) -- 0:00:03
944500 -- (-904.811) [-906.085] (-905.323) (-903.767) * (-903.951) [-903.526] (-905.373) (-903.644) -- 0:00:03
945000 -- (-906.995) (-904.959) (-904.804) [-903.817] * (-903.086) (-903.031) [-901.280] (-903.441) -- 0:00:03
Average standard deviation of split frequencies: 0.004983
945500 -- (-903.188) (-906.588) [-903.064] (-905.189) * (-909.250) (-903.603) [-903.735] (-901.836) -- 0:00:03
946000 -- (-906.742) [-901.702] (-902.962) (-903.884) * (-906.440) (-904.261) (-905.473) [-905.669] -- 0:00:03
946500 -- (-903.819) (-904.205) (-902.220) [-904.608] * [-905.627] (-903.589) (-904.101) (-908.739) -- 0:00:03
947000 -- (-903.266) [-902.399] (-904.648) (-904.182) * (-904.584) (-902.867) [-902.639] (-903.553) -- 0:00:03
947500 -- (-902.103) (-905.553) (-904.404) [-903.694] * (-907.221) (-902.319) (-906.590) [-905.143] -- 0:00:03
948000 -- [-902.413] (-902.703) (-903.406) (-903.989) * (-904.455) (-905.668) [-904.923] (-903.081) -- 0:00:03
948500 -- (-902.123) [-904.327] (-902.131) (-907.254) * (-912.056) [-905.387] (-903.212) (-903.722) -- 0:00:03
949000 -- (-903.937) (-907.024) [-907.391] (-905.230) * (-904.289) [-905.172] (-907.234) (-906.136) -- 0:00:03
949500 -- [-905.491] (-902.987) (-904.452) (-904.587) * (-905.590) (-903.930) [-904.202] (-908.728) -- 0:00:03
950000 -- (-905.833) [-905.189] (-903.141) (-904.369) * (-904.628) (-907.695) [-903.520] (-905.322) -- 0:00:03
Average standard deviation of split frequencies: 0.005058
950500 -- (-905.737) [-906.548] (-902.748) (-906.420) * (-904.120) [-906.249] (-903.012) (-901.438) -- 0:00:03
951000 -- (-903.206) [-903.405] (-906.950) (-902.972) * [-904.009] (-907.289) (-903.751) (-903.607) -- 0:00:03
951500 -- (-905.591) (-905.494) [-902.784] (-902.591) * (-901.057) (-901.478) (-904.730) [-902.905] -- 0:00:03
952000 -- (-903.970) (-905.864) (-903.535) [-902.576] * (-904.059) [-902.999] (-905.460) (-906.741) -- 0:00:03
952500 -- (-902.836) (-905.588) (-904.853) [-902.624] * [-901.706] (-901.396) (-902.144) (-902.879) -- 0:00:03
953000 -- [-902.343] (-903.942) (-902.155) (-903.212) * (-903.261) (-904.294) (-903.303) [-905.718] -- 0:00:03
953500 -- [-906.830] (-905.569) (-903.032) (-905.279) * (-904.297) [-903.680] (-905.255) (-901.915) -- 0:00:03
954000 -- [-905.731] (-904.176) (-902.425) (-904.301) * [-903.751] (-907.841) (-904.674) (-903.696) -- 0:00:02
954500 -- (-914.742) [-906.056] (-903.579) (-909.476) * (-905.542) [-902.194] (-902.110) (-904.674) -- 0:00:02
955000 -- (-908.035) (-903.223) (-902.904) [-904.755] * (-905.765) [-904.953] (-904.211) (-902.209) -- 0:00:02
Average standard deviation of split frequencies: 0.004734
955500 -- (-902.710) [-902.457] (-910.494) (-905.284) * [-903.444] (-905.114) (-904.348) (-901.857) -- 0:00:02
956000 -- (-904.279) (-902.569) [-906.414] (-904.306) * [-901.272] (-904.862) (-903.554) (-904.894) -- 0:00:02
956500 -- [-903.422] (-902.942) (-906.615) (-901.974) * (-902.898) (-905.365) [-903.299] (-906.016) -- 0:00:02
957000 -- (-905.067) (-902.510) [-902.559] (-903.197) * (-903.824) (-903.476) [-904.964] (-904.084) -- 0:00:02
957500 -- (-902.840) [-902.339] (-903.612) (-906.258) * (-902.460) [-904.812] (-901.544) (-907.393) -- 0:00:02
958000 -- [-902.436] (-905.270) (-901.453) (-903.047) * (-904.883) (-903.003) (-901.865) [-905.028] -- 0:00:02
958500 -- (-902.125) (-906.250) (-903.469) [-902.934] * [-906.129] (-902.432) (-904.022) (-905.185) -- 0:00:02
959000 -- (-902.428) (-904.312) [-903.756] (-902.668) * (-902.949) [-906.836] (-904.187) (-905.626) -- 0:00:02
959500 -- (-904.604) (-903.549) [-903.583] (-904.059) * (-903.879) [-904.410] (-904.030) (-905.980) -- 0:00:02
960000 -- (-903.847) [-903.693] (-902.895) (-902.137) * (-900.310) [-904.114] (-905.480) (-903.018) -- 0:00:02
Average standard deviation of split frequencies: 0.004972
960500 -- (-907.574) (-905.460) [-905.440] (-903.700) * (-903.289) [-903.135] (-904.823) (-902.873) -- 0:00:02
961000 -- (-905.420) (-905.127) [-904.284] (-903.526) * (-902.312) (-902.712) (-903.692) [-903.669] -- 0:00:02
961500 -- (-903.420) [-903.633] (-903.547) (-902.890) * (-904.089) [-905.335] (-902.724) (-903.581) -- 0:00:02
962000 -- (-905.951) (-905.281) (-904.701) [-904.525] * (-903.009) (-903.967) [-901.061] (-902.627) -- 0:00:02
962500 -- (-903.071) (-903.719) [-901.555] (-904.829) * [-902.520] (-902.562) (-904.517) (-903.317) -- 0:00:02
963000 -- [-900.966] (-903.430) (-903.621) (-903.759) * (-899.652) (-904.376) (-900.372) [-902.452] -- 0:00:02
963500 -- [-902.985] (-903.337) (-903.758) (-902.197) * [-902.508] (-902.818) (-902.824) (-902.961) -- 0:00:02
964000 -- (-903.793) [-905.631] (-903.389) (-901.946) * (-904.618) [-902.463] (-903.528) (-903.805) -- 0:00:02
964500 -- (-902.983) [-905.407] (-904.039) (-902.665) * (-905.007) (-905.250) (-901.876) [-904.184] -- 0:00:02
965000 -- (-902.669) (-902.298) (-904.610) [-902.536] * (-906.615) [-902.682] (-903.510) (-904.655) -- 0:00:02
Average standard deviation of split frequencies: 0.004750
965500 -- (-908.074) (-904.223) (-902.347) [-904.784] * (-903.723) (-902.840) [-903.274] (-901.672) -- 0:00:02
966000 -- (-905.878) [-902.062] (-905.543) (-905.761) * [-902.927] (-905.051) (-903.473) (-903.181) -- 0:00:02
966500 -- (-905.836) (-905.674) (-901.684) [-904.090] * (-908.520) [-903.711] (-903.141) (-905.423) -- 0:00:02
967000 -- (-903.581) (-904.547) (-900.748) [-904.177] * [-904.347] (-904.266) (-902.613) (-904.051) -- 0:00:02
967500 -- (-901.728) [-901.847] (-902.319) (-904.379) * (-903.517) (-904.504) [-901.591] (-904.324) -- 0:00:02
968000 -- (-903.659) [-904.889] (-903.396) (-903.158) * (-903.458) [-905.262] (-902.985) (-902.393) -- 0:00:02
968500 -- [-902.366] (-907.423) (-904.506) (-903.782) * [-902.879] (-903.168) (-902.250) (-901.654) -- 0:00:02
969000 -- [-901.716] (-906.818) (-904.227) (-902.253) * [-904.646] (-905.223) (-903.279) (-904.971) -- 0:00:02
969500 -- (-903.443) (-903.799) [-903.736] (-901.378) * (-906.996) (-904.948) [-902.960] (-903.557) -- 0:00:01
970000 -- (-901.838) (-908.419) [-902.480] (-903.386) * (-902.895) [-903.049] (-905.243) (-905.193) -- 0:00:01
Average standard deviation of split frequencies: 0.004759
970500 -- (-903.805) (-903.516) (-901.936) [-903.101] * (-903.360) (-904.356) [-903.374] (-905.767) -- 0:00:01
971000 -- [-903.109] (-903.895) (-903.564) (-907.903) * (-903.363) [-902.982] (-904.682) (-903.454) -- 0:00:01
971500 -- (-902.413) (-904.192) (-901.866) [-904.797] * (-905.236) [-902.778] (-904.391) (-901.684) -- 0:00:01
972000 -- [-903.485] (-907.059) (-902.573) (-903.636) * (-904.659) (-903.964) (-902.661) [-901.385] -- 0:00:01
972500 -- (-902.577) (-906.579) (-901.425) [-902.657] * (-904.176) [-904.762] (-905.944) (-904.697) -- 0:00:01
973000 -- (-903.997) (-906.268) [-900.907] (-904.454) * [-904.365] (-903.516) (-903.001) (-906.067) -- 0:00:01
973500 -- (-904.593) (-902.993) (-902.156) [-902.915] * (-905.403) (-904.147) [-901.592] (-904.367) -- 0:00:01
974000 -- [-903.013] (-906.877) (-902.873) (-903.923) * (-903.551) [-907.141] (-901.308) (-904.278) -- 0:00:01
974500 -- (-902.260) (-906.078) (-904.113) [-908.767] * (-906.626) (-906.255) [-901.919] (-904.675) -- 0:00:01
975000 -- (-909.911) (-905.584) [-903.125] (-903.297) * (-908.622) (-902.231) (-906.231) [-901.925] -- 0:00:01
Average standard deviation of split frequencies: 0.004798
975500 -- (-903.206) (-903.968) [-902.991] (-902.031) * [-906.170] (-908.030) (-904.416) (-901.646) -- 0:00:01
976000 -- (-904.300) [-902.427] (-905.644) (-902.881) * [-903.961] (-905.767) (-904.304) (-903.879) -- 0:00:01
976500 -- (-902.820) (-904.444) [-903.544] (-903.244) * [-903.111] (-903.196) (-907.784) (-903.576) -- 0:00:01
977000 -- (-903.597) [-905.109] (-905.885) (-904.015) * [-905.015] (-902.743) (-905.633) (-902.919) -- 0:00:01
977500 -- (-903.170) [-904.572] (-906.555) (-905.361) * (-902.075) [-902.832] (-903.851) (-903.583) -- 0:00:01
978000 -- (-904.043) (-903.305) (-904.069) [-901.453] * (-901.844) (-908.511) (-904.192) [-904.094] -- 0:00:01
978500 -- (-902.007) (-902.855) [-902.410] (-903.303) * (-902.573) (-904.052) [-905.399] (-904.012) -- 0:00:01
979000 -- (-906.441) (-904.325) (-904.297) [-903.306] * (-902.854) (-904.584) [-904.093] (-903.364) -- 0:00:01
979500 -- (-907.149) [-903.471] (-903.905) (-903.320) * (-902.976) [-902.803] (-907.211) (-907.527) -- 0:00:01
980000 -- (-905.124) (-904.101) (-902.331) [-903.033] * (-904.406) [-903.078] (-903.470) (-907.192) -- 0:00:01
Average standard deviation of split frequencies: 0.004775
980500 -- [-904.806] (-902.687) (-902.387) (-904.698) * (-903.965) (-904.164) [-905.809] (-904.928) -- 0:00:01
981000 -- (-903.424) [-902.397] (-903.756) (-902.919) * [-903.589] (-903.529) (-908.475) (-904.162) -- 0:00:01
981500 -- [-902.339] (-907.250) (-903.551) (-901.858) * [-904.498] (-903.304) (-904.611) (-902.269) -- 0:00:01
982000 -- (-901.853) (-906.913) (-904.195) [-900.330] * (-903.996) [-903.844] (-903.442) (-904.523) -- 0:00:01
982500 -- (-903.302) (-906.356) (-905.813) [-901.400] * (-904.228) (-902.056) [-908.534] (-903.134) -- 0:00:01
983000 -- (-901.537) (-904.546) (-908.093) [-902.980] * [-904.062] (-902.648) (-908.700) (-902.879) -- 0:00:01
983500 -- (-903.738) (-903.409) [-902.601] (-902.383) * [-905.226] (-907.121) (-905.757) (-901.960) -- 0:00:01
984000 -- (-902.314) [-902.709] (-902.533) (-903.128) * (-904.531) [-904.973] (-907.763) (-904.683) -- 0:00:01
984500 -- (-902.863) (-903.842) [-906.556] (-904.793) * (-902.930) (-907.738) (-904.719) [-902.875] -- 0:00:01
985000 -- [-903.668] (-902.535) (-906.658) (-903.325) * (-902.727) [-907.999] (-902.495) (-903.477) -- 0:00:00
Average standard deviation of split frequencies: 0.004622
985500 -- [-901.562] (-906.667) (-911.013) (-902.663) * (-904.895) [-902.938] (-903.924) (-904.671) -- 0:00:00
986000 -- (-904.334) (-903.722) [-901.413] (-905.243) * (-903.303) (-902.942) (-902.245) [-904.320] -- 0:00:00
986500 -- (-904.614) (-905.412) [-906.585] (-904.781) * (-906.210) [-905.128] (-904.629) (-905.793) -- 0:00:00
987000 -- [-905.358] (-906.074) (-903.532) (-908.819) * (-908.643) [-904.903] (-902.681) (-902.314) -- 0:00:00
987500 -- (-904.018) (-903.877) [-902.240] (-902.407) * (-911.742) (-905.128) (-902.653) [-902.806] -- 0:00:00
988000 -- (-903.868) (-904.675) (-903.751) [-903.002] * (-905.445) [-903.184] (-902.211) (-902.889) -- 0:00:00
988500 -- (-903.613) [-904.174] (-903.585) (-903.253) * (-906.506) [-904.876] (-903.545) (-905.275) -- 0:00:00
989000 -- (-906.340) (-903.147) (-901.940) [-903.018] * (-907.287) (-902.022) (-903.600) [-903.800] -- 0:00:00
989500 -- [-902.302] (-904.169) (-902.889) (-903.351) * (-903.767) [-903.732] (-906.555) (-901.726) -- 0:00:00
990000 -- (-903.633) (-906.848) (-901.047) [-905.157] * [-904.134] (-902.793) (-905.337) (-903.029) -- 0:00:00
Average standard deviation of split frequencies: 0.004600
990500 -- [-901.284] (-902.893) (-906.852) (-905.910) * [-901.664] (-903.101) (-903.896) (-903.444) -- 0:00:00
991000 -- (-906.327) (-905.785) [-902.247] (-906.206) * (-904.376) [-903.582] (-904.213) (-902.945) -- 0:00:00
991500 -- (-904.575) (-906.429) [-906.756] (-906.307) * (-903.190) [-902.381] (-902.759) (-902.605) -- 0:00:00
992000 -- [-901.983] (-904.693) (-910.853) (-904.812) * (-903.485) (-906.658) (-905.184) [-903.037] -- 0:00:00
992500 -- (-903.033) [-904.509] (-907.089) (-906.534) * (-905.287) (-906.599) [-901.853] (-904.071) -- 0:00:00
993000 -- (-903.601) (-904.270) (-904.012) [-903.342] * (-902.735) (-906.069) [-906.708] (-903.974) -- 0:00:00
993500 -- (-902.453) (-903.135) [-905.253] (-901.163) * (-906.531) [-902.688] (-905.475) (-901.836) -- 0:00:00
994000 -- (-904.424) (-904.076) [-902.347] (-903.946) * (-903.226) (-904.537) (-903.913) [-905.206] -- 0:00:00
994500 -- [-905.288] (-903.104) (-903.494) (-902.716) * (-903.586) (-904.927) [-901.658] (-902.859) -- 0:00:00
995000 -- (-905.826) (-904.977) (-903.099) [-901.957] * [-900.485] (-908.711) (-902.532) (-902.198) -- 0:00:00
Average standard deviation of split frequencies: 0.004291
995500 -- (-904.415) [-904.163] (-902.672) (-904.393) * (-903.135) [-902.352] (-903.194) (-904.664) -- 0:00:00
996000 -- (-903.084) [-902.294] (-903.242) (-905.137) * (-903.086) (-905.639) (-906.341) [-902.486] -- 0:00:00
996500 -- [-901.805] (-902.087) (-902.262) (-912.908) * (-903.128) (-905.969) (-903.135) [-902.930] -- 0:00:00
997000 -- (-901.934) [-904.216] (-902.244) (-905.363) * (-903.242) (-902.653) [-902.489] (-903.507) -- 0:00:00
997500 -- [-901.495] (-904.373) (-902.522) (-906.070) * (-903.388) (-901.315) [-903.493] (-905.421) -- 0:00:00
998000 -- (-902.703) (-904.276) (-905.142) [-905.592] * (-906.042) (-903.897) [-904.226] (-903.444) -- 0:00:00
998500 -- (-903.464) (-904.781) (-904.865) [-902.114] * (-904.828) (-904.331) (-904.717) [-901.677] -- 0:00:00
999000 -- [-901.056] (-910.428) (-905.135) (-902.447) * (-900.846) (-903.946) [-903.904] (-905.554) -- 0:00:00
999500 -- (-905.866) (-902.926) (-905.536) [-903.058] * (-902.915) [-907.113] (-902.896) (-905.698) -- 0:00:00
1000000 -- (-902.820) (-904.284) (-907.621) [-902.330] * (-903.438) (-906.022) [-901.556] (-903.578) -- 0:00:00
Average standard deviation of split frequencies: 0.004365
Analysis completed in 1 mins 5 seconds
Analysis used 64.05 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -899.00
Likelihood of best state for "cold" chain of run 2 was -898.97
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 71 %) Dirichlet(Revmat{all})
98.6 % ( 96 %) Slider(Revmat{all})
29.1 % ( 29 %) Dirichlet(Pi{all})
29.5 % ( 20 %) Slider(Pi{all})
70.6 % ( 43 %) Multiplier(Alpha{1,2})
79.5 % ( 50 %) Multiplier(Alpha{3})
25.6 % ( 21 %) Slider(Pinvar{all})
97.3 % ( 97 %) ExtSPR(Tau{all},V{all})
69.1 % ( 66 %) ExtTBR(Tau{all},V{all})
98.2 % ( 97 %) NNI(Tau{all},V{all})
87.9 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
95.5 % ( 95 %) Nodeslider(V{all})
30.8 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 81 %) Dirichlet(Revmat{all})
98.7 % ( 95 %) Slider(Revmat{all})
28.3 % ( 25 %) Dirichlet(Pi{all})
29.8 % ( 29 %) Slider(Pi{all})
71.6 % ( 40 %) Multiplier(Alpha{1,2})
79.3 % ( 50 %) Multiplier(Alpha{3})
26.0 % ( 27 %) Slider(Pinvar{all})
97.3 % ( 96 %) ExtSPR(Tau{all},V{all})
69.2 % ( 75 %) ExtTBR(Tau{all},V{all})
98.2 % ( 98 %) NNI(Tau{all},V{all})
87.9 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
95.6 % ( 97 %) Nodeslider(V{all})
30.3 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166532 0.82 0.66
3 | 166996 167227 0.84
4 | 166722 166599 165924
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167037 0.82 0.66
3 | 166337 166768 0.83
4 | 167056 166317 166485
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -902.85
| 2 1 |
| 2 |
| 1 111 1|
| 2 1 1 1 1 22 1 212|
| 1 22 2 1* 1 2 1 2 2 2 1 |
|1 1 2 122 1 2 2 |
|22 1 2 2 2 1 2 2 1 2 11 1 1 1 |
| 1 1 2 * 112 2 2 2 |
| 1 2 1 1 2 1 2 1 1 1 1 |
| 1 1 2 1 2 2 2 2 |
| 1 22 1 1 2 22 2 1 1 |
| 2 1 2 1 2 2 2 |
| 1 2 21 1 1 1 |
| 2 2 * |
| 2 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -904.55
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.69 -906.26
2 -902.75 -906.48
--------------------------------------
TOTAL -902.72 -906.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882135 0.089117 0.364375 1.508518 0.849445 1458.10 1472.74 1.000
r(A<->C){all} 0.208231 0.026429 0.000053 0.537697 0.170842 188.40 192.04 1.000
r(A<->G){all} 0.169149 0.018651 0.000064 0.439347 0.135059 174.84 178.03 1.000
r(A<->T){all} 0.151132 0.017970 0.000048 0.437361 0.114661 173.36 247.02 1.000
r(C<->G){all} 0.144970 0.017948 0.000104 0.414087 0.105025 268.61 272.99 1.000
r(C<->T){all} 0.161983 0.019203 0.000072 0.438920 0.122400 164.21 187.56 1.000
r(G<->T){all} 0.164535 0.020419 0.000080 0.457434 0.125515 247.30 252.38 1.000
pi(A){all} 0.242824 0.000291 0.210167 0.276506 0.242917 1249.10 1303.95 1.000
pi(C){all} 0.339865 0.000355 0.305563 0.378812 0.339614 1282.35 1304.37 1.000
pi(G){all} 0.243438 0.000284 0.211305 0.276657 0.243317 846.41 1081.69 1.000
pi(T){all} 0.173873 0.000209 0.144553 0.200758 0.173586 1143.96 1184.80 1.000
alpha{1,2} 0.344940 0.164062 0.000904 1.140021 0.215664 1137.52 1231.86 1.000
alpha{3} 0.424980 0.251453 0.000258 1.469676 0.250020 1147.22 1203.99 1.000
pinvar{all} 0.994903 0.000019 0.986545 0.999866 0.996117 1209.44 1318.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ...*.*
9 -- .**...
10 -- .****.
11 -- ..****
12 -- ..*.*.
13 -- .*.***
14 -- .*..*.
15 -- .*...*
16 -- .**.**
17 -- ....**
18 -- ...**.
19 -- ..*..*
20 -- .***.*
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 477 0.158894 0.008009 0.153231 0.164557 2
8 474 0.157895 0.002827 0.155896 0.159893 2
9 460 0.153231 0.000000 0.153231 0.153231 2
10 447 0.148901 0.000471 0.148568 0.149234 2
11 440 0.146569 0.000942 0.145903 0.147235 2
12 440 0.146569 0.007537 0.141239 0.151899 2
13 436 0.145237 0.004711 0.141905 0.148568 2
14 429 0.142905 0.007066 0.137908 0.147901 2
15 421 0.140240 0.014604 0.129913 0.150566 2
16 418 0.139241 0.000000 0.139241 0.139241 2
17 417 0.138907 0.008009 0.133245 0.144570 2
18 410 0.136576 0.001884 0.135243 0.137908 2
19 409 0.136243 0.003298 0.133911 0.138574 2
20 402 0.133911 0.003769 0.131246 0.136576 2
21 399 0.132911 0.002355 0.131246 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.093754 0.009295 0.000025 0.281915 0.064379 1.000 2
length{all}[2] 0.092149 0.008854 0.000012 0.269674 0.062574 1.000 2
length{all}[3] 0.094006 0.009433 0.000021 0.286753 0.063975 1.000 2
length{all}[4] 0.090840 0.008739 0.000016 0.276451 0.061037 1.001 2
length{all}[5] 0.130575 0.014709 0.000002 0.375084 0.096828 1.000 2
length{all}[6] 0.097511 0.009215 0.000093 0.293100 0.068339 1.000 2
length{all}[7] 0.087116 0.007925 0.000174 0.264582 0.061140 1.001 2
length{all}[8] 0.093048 0.009145 0.000170 0.270766 0.067206 1.002 2
length{all}[9] 0.095431 0.009068 0.000264 0.272965 0.064058 1.000 2
length{all}[10] 0.088121 0.008148 0.000206 0.251392 0.060867 0.999 2
length{all}[11] 0.092702 0.008918 0.000058 0.272759 0.061465 0.999 2
length{all}[12] 0.100386 0.012442 0.000051 0.324528 0.069165 0.998 2
length{all}[13] 0.091520 0.010145 0.000156 0.301740 0.054508 0.999 2
length{all}[14] 0.092915 0.009008 0.000101 0.286554 0.066919 1.008 2
length{all}[15] 0.096523 0.009190 0.000898 0.278765 0.065255 1.002 2
length{all}[16] 0.091197 0.007927 0.000006 0.272619 0.065771 1.000 2
length{all}[17] 0.095310 0.009668 0.000516 0.306737 0.056581 0.998 2
length{all}[18] 0.088492 0.007383 0.000170 0.268369 0.064323 0.998 2
length{all}[19] 0.097203 0.010157 0.000034 0.307679 0.063028 0.998 2
length{all}[20] 0.097377 0.009890 0.000171 0.281716 0.063442 1.002 2
length{all}[21] 0.094342 0.009329 0.000211 0.313840 0.064648 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004365
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------ C1 (1)
|
|----------------------------------------------- C2 (2)
|
|------------------------------------------------ C3 (3)
+
|--------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------- C6 (6)
|-------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 654
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 218 / 218 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 218 / 218 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.057712 0.029822 0.097348 0.048154 0.049327 0.055477 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -937.469869
Iterating by ming2
Initial: fx= 937.469869
x= 0.05771 0.02982 0.09735 0.04815 0.04933 0.05548 0.30000 1.30000
1 h-m-p 0.0000 0.0001 515.9746 ++ 900.677440 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 4296.2072 ++ 884.260171 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 1827.3973 ++ 879.211686 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0000 286.7145 ++ 878.210660 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0000 36540.3605 ++ 868.945171 m 0.0000 57 | 5/8
6 h-m-p 0.0099 0.4379 0.4662 ++YCYYC 868.203969 4 0.2783 76 | 5/8
7 h-m-p 0.0829 0.4144 0.4747 ++ 868.112302 m 0.4144 90 | 6/8
8 h-m-p 0.0730 8.0000 0.6910 ++CYC 868.068967 2 1.3053 109 | 6/8
9 h-m-p 1.5652 7.8262 0.4818 CCCC 868.029069 3 1.7216 128 | 6/8
10 h-m-p 1.6000 8.0000 0.4773 +YCCC 868.001057 3 4.9353 147 | 6/8
11 h-m-p 1.6000 8.0000 0.8566 CCC 867.985509 2 2.1367 164 | 6/8
12 h-m-p 1.6000 8.0000 1.0223 +CCC 867.972732 2 5.4240 182 | 6/8
13 h-m-p 1.6000 8.0000 1.8947 CCC 867.966193 2 2.1692 197 | 6/8
14 h-m-p 1.6000 8.0000 2.3350 +CC 867.960504 1 5.6137 211 | 6/8
15 h-m-p 1.6000 8.0000 4.2741 CC 867.957741 1 2.1311 224 | 6/8
16 h-m-p 1.6000 8.0000 5.3664 +C 867.955178 0 6.1443 236 | 6/8
17 h-m-p 1.6000 8.0000 9.5107 CC 867.954033 1 1.9817 249 | 6/8
18 h-m-p 1.5670 8.0000 12.0274 +YC 867.952861 1 7.1069 262 | 6/8
19 h-m-p 1.6000 8.0000 22.9349 CC 867.952403 1 1.8615 275 | 6/8
20 h-m-p 1.5408 8.0000 27.7087 ++ 867.951902 m 8.0000 286 | 6/8
21 h-m-p 1.6000 8.0000 54.2738 C 867.951719 0 1.7662 297 | 6/8
22 h-m-p 1.4273 7.1364 64.7769 ++ 867.951514 m 7.1364 308 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 Y 867.951496 0 0.9914 319 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 ------Y 867.951496 0 0.0001 337
Out..
lnL = -867.951496
338 lfun, 338 eigenQcodon, 2028 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.053473 0.076271 0.069104 0.098306 0.024760 0.071449 0.000100 0.584949 0.242111
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 13.277017
np = 9
lnL0 = -945.718063
Iterating by ming2
Initial: fx= 945.718063
x= 0.05347 0.07627 0.06910 0.09831 0.02476 0.07145 0.00011 0.58495 0.24211
1 h-m-p 0.0000 0.0000 456.9559 ++ 945.167648 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 10630.2467 +CYCCYCCC 926.620159 7 0.0000 40 | 1/9
3 h-m-p 0.0001 0.0004 375.7922 ++ 890.527384 m 0.0004 52 | 2/9
4 h-m-p 0.0000 0.0000 4015.0272 ++ 877.310229 m 0.0000 64 | 3/9
5 h-m-p 0.0000 0.0001 342.0390 ++ 875.724419 m 0.0001 76 | 4/9
6 h-m-p 0.0000 0.0000 3620.8762 ++ 873.711821 m 0.0000 88 | 5/9
7 h-m-p 0.0000 0.0000 8065.8591 ++ 873.065624 m 0.0000 100 | 5/9
8 h-m-p -0.0000 -0.0000 778.4643
h-m-p: -2.10088811e-22 -1.05044405e-21 7.78464334e+02 873.065624
.. | 5/9
9 h-m-p 0.0000 0.0001 1154.3878 CYCCCCC 871.884869 6 0.0000 132 | 5/9
10 h-m-p 0.0000 0.0001 218.5006 ++ 868.503101 m 0.0001 144 | 6/9
11 h-m-p 0.0000 0.0001 0.6575 ++ 868.503045 m 0.0001 156 | 7/9
12 h-m-p 0.0013 0.6587 0.9727 +++++ 868.229407 m 0.6587 174 | 8/9
13 h-m-p 1.4440 8.0000 0.0018 YCCCC 868.171712 4 0.7947 195 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 868.171712 m 8.0000 208 | 7/9
15 h-m-p 0.1619 8.0000 0.0000 ----C 868.171712 0 0.0002 225 | 8/9
16 h-m-p 0.0160 8.0000 0.0000 -----------Y 868.171712 0 0.0000 250
Out..
lnL = -868.171712
251 lfun, 753 eigenQcodon, 3012 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.096873 0.017187 0.023385 0.097487 0.024157 0.021795 0.000100 1.333854 0.486199 0.391133 1126.287815
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.072306
np = 11
lnL0 = -895.438004
Iterating by ming2
Initial: fx= 895.438004
x= 0.09687 0.01719 0.02338 0.09749 0.02416 0.02179 0.00011 1.33385 0.48620 0.39113 951.42857
1 h-m-p 0.0000 0.0000 106.4894 ++ 895.396704 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0041 33.4524 +++++ 893.336599 m 0.0041 33 | 2/11
3 h-m-p 0.0001 0.0005 30.2166 ++ 892.331461 m 0.0005 47 | 3/11
4 h-m-p 0.0003 0.0017 52.2773 ++ 890.761276 m 0.0017 61 | 4/11
5 h-m-p 0.0005 0.0025 63.2910 ++ 879.841286 m 0.0025 75 | 5/11
6 h-m-p 0.0001 0.0003 34.8062 ++ 879.695973 m 0.0003 89 | 6/11
7 h-m-p 0.0006 0.0319 16.8219 +++ 874.004294 m 0.0319 104 | 6/11
8 h-m-p 0.3858 4.1145 1.3899 Y
a 0.000000 0.385806 1.543223 0.937534
f 874.004294 871.811780 872.050103 873.359582
0.000000e+00 874.004294
7.716115e-02 868.204949
1.543223e-01 869.158781
2.314834e-01 870.166684
3.086446e-01 871.064977
3.858057e-01 871.811780
4.629669e-01 872.399711
5.401280e-01 872.836519
6.172892e-01 873.137698
6.944503e-01 873.322390
7.716115e-01 873.410621
8.487726e-01 873.421380
9.259337e-01 873.371433
1.003095e+00 873.274829
1.080256e+00 873.142980
1.157417e+00 872.985133
1.234578e+00 872.809015
1.311739e+00 872.621426
1.388901e+00 872.428615
1.466062e+00 872.236404
1.543223e+00 872.050103
Linesearch2 a4: multiple optima?
YYCYYCYYC 867.984324 10 0.0417 152 | 6/11
9 h-m-p 1.6000 8.0000 0.0166 ++ 867.981811 m 8.0000 166 | 6/11
10 h-m-p 0.1542 8.0000 0.8615 ++YC 867.971306 1 1.6108 188 | 6/11
11 h-m-p 1.6000 8.0000 0.0107 ++ 867.970893 m 8.0000 207 | 6/11
12 h-m-p 0.2027 8.0000 0.4225 ++CYC 867.966962 2 2.6610 231 | 6/11
13 h-m-p 1.6000 8.0000 0.2366 ++ 867.955387 m 8.0000 250 | 6/11
14 h-m-p 1.1713 5.8565 0.5951 ++ 867.951852 m 5.8565 269 | 7/11
15 h-m-p 1.6000 8.0000 0.2985 ++ 867.951653 m 8.0000 288 | 7/11
16 h-m-p 1.6000 8.0000 0.0098 ++ 867.951652 m 8.0000 306 | 7/11
17 h-m-p 0.3433 8.0000 0.2277 +C 867.951647 0 1.4987 325 | 7/11
18 h-m-p 1.6000 8.0000 0.0139 ++ 867.951618 m 8.0000 343 | 7/11
19 h-m-p 0.1014 8.0000 1.0988 ++C 867.951542 0 1.4572 363 | 7/11
20 h-m-p 1.6000 8.0000 0.4539 C 867.951523 0 2.4593 377 | 7/11
21 h-m-p 1.6000 8.0000 0.4912 Y 867.951514 0 2.8477 395 | 7/11
22 h-m-p 1.6000 8.0000 0.4994 Y 867.951511 0 2.5651 413 | 7/11
23 h-m-p 1.6000 8.0000 0.4898 C 867.951509 0 2.4291 431 | 7/11
24 h-m-p 1.6000 8.0000 0.5347 Y 867.951509 0 3.1130 449 | 7/11
25 h-m-p 1.6000 8.0000 0.4618 C 867.951508 0 1.8230 467 | 7/11
26 h-m-p 1.5001 8.0000 0.5613 +C 867.951508 0 6.0002 486 | 7/11
27 h-m-p 1.6000 8.0000 0.3150 Y 867.951508 0 0.9809 504 | 7/11
28 h-m-p 0.7353 8.0000 0.4202 C 867.951508 0 1.1568 522 | 7/11
29 h-m-p 0.7051 8.0000 0.6894 +C 867.951508 0 2.8203 541 | 7/11
30 h-m-p 1.6000 8.0000 0.6702 Y 867.951508 0 3.9593 559 | 7/11
31 h-m-p 1.6000 8.0000 0.1277 Y 867.951508 0 0.2435 577 | 7/11
32 h-m-p 0.0829 8.0000 0.3751 C 867.951508 0 0.1038 595 | 7/11
33 h-m-p 0.0443 8.0000 0.8779 Y 867.951508 0 0.1030 613 | 7/11
34 h-m-p 0.0160 8.0000 5.7764 Y 867.951508 0 0.0354 631 | 7/11
35 h-m-p 1.4276 8.0000 0.1431 +Y 867.951508 0 6.6759 646 | 7/11
36 h-m-p 1.6000 8.0000 0.1934 C 867.951508 0 0.5508 664 | 7/11
37 h-m-p 1.6000 8.0000 0.0664 -C 867.951508 0 0.1272 683 | 7/11
38 h-m-p 0.0160 8.0000 1.0632 ---Y 867.951508 0 0.0001 704 | 7/11
39 h-m-p 0.0160 8.0000 0.0852 ---N 867.951508 0 0.0001 721 | 7/11
40 h-m-p 0.0160 8.0000 12.2403 +++++ 867.951508 m 8.0000 742 | 7/11
41 h-m-p 0.0102 0.0512 160.6099 ++ 867.951508 m 0.0512 756 | 7/11
42 h-m-p -0.0000 -0.0000 108.3933
h-m-p: -0.00000000e+00 -0.00000000e+00 1.08393285e+02 867.951508
.. | 7/11
43 h-m-p 0.0160 8.0000 0.0126 ---Y 867.951508 0 0.0000 784 | 7/11
44 h-m-p 0.1782 8.0000 0.0000 ---Y 867.951508 0 0.0012 805
Out..
lnL = -867.951508
806 lfun, 3224 eigenQcodon, 14508 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -872.892450 S = -871.453600 -2.367411
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:05
did 20 / 58 patterns 0:05
did 30 / 58 patterns 0:05
did 40 / 58 patterns 0:05
did 50 / 58 patterns 0:05
did 58 / 58 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.031254 0.068088 0.060901 0.059207 0.068663 0.016186 0.000100 0.754919 1.684765
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.162325
np = 9
lnL0 = -927.472285
Iterating by ming2
Initial: fx= 927.472285
x= 0.03125 0.06809 0.06090 0.05921 0.06866 0.01619 0.00011 0.75492 1.68476
1 h-m-p 0.0000 0.0000 478.6721 ++ 926.842510 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0006 128.9946 ++YCYYYYYCCC 920.381909 10 0.0005 42 | 1/9
3 h-m-p 0.0014 0.0150 48.4911 ++ 910.798619 m 0.0150 54 | 1/9
4 h-m-p 0.2634 1.3171 1.7746 --YYCCC 908.863826 4 0.0053 74 | 1/9
5 h-m-p 0.0003 0.0014 4.3455 ----------.. | 1/9
6 h-m-p 0.0000 0.0000 803.6751 ++ 902.047629 m 0.0000 106 | 2/9
7 h-m-p 0.0000 0.0000 573.3061 ++ 890.671001 m 0.0000 118 | 3/9
8 h-m-p 0.0000 0.0000 16502.8900 ++ 874.648387 m 0.0000 130 | 4/9
9 h-m-p 0.0000 0.0000 17896.9368 ++ 873.991230 m 0.0000 142 | 5/9
10 h-m-p 0.0000 0.0000 188.7866 ++ 872.595412 m 0.0000 154 | 6/9
11 h-m-p 0.0043 2.1679 0.7565 +++++ 868.238673 m 2.1679 169 | 7/9
12 h-m-p 1.6000 8.0000 0.0005 +YCC 868.202445 2 4.7060 188 | 7/9
13 h-m-p 1.6000 8.0000 0.0002 ++ 868.196878 m 8.0000 202 | 7/9
14 h-m-p 1.6000 8.0000 0.0007 C 868.194575 0 1.4950 216 | 7/9
15 h-m-p 1.6000 8.0000 0.0004 +CC 868.193991 1 5.3307 233 | 7/9
16 h-m-p 1.6000 8.0000 0.0004 C 868.193860 0 1.5931 247 | 7/9
17 h-m-p 1.6000 8.0000 0.0004 +C 868.193780 0 6.0297 262 | 7/9
18 h-m-p 1.6000 8.0000 0.0004 C 868.193761 0 1.5287 276 | 7/9
19 h-m-p 1.5611 8.0000 0.0004 +C 868.193750 0 6.2444 291 | 7/9
20 h-m-p 1.6000 8.0000 0.0005 C 868.193748 0 1.5877 305 | 7/9
21 h-m-p 1.6000 8.0000 0.0005 +Y 868.193746 0 5.0579 320 | 7/9
22 h-m-p 1.6000 8.0000 0.0006 C 868.193746 0 1.9198 334 | 7/9
23 h-m-p 1.6000 8.0000 0.0006 Y 868.193745 0 3.2159 348 | 7/9
24 h-m-p 1.6000 8.0000 0.0009 ++ 868.193745 m 8.0000 362 | 7/9
25 h-m-p 1.6000 8.0000 0.0018 ------------C 868.193745 0 0.0000 388 | 7/9
26 h-m-p 0.0160 8.0000 0.0003 Y 868.193744 0 0.0263 402 | 7/9
27 h-m-p 1.6000 8.0000 0.0000 Y 868.193744 0 0.6466 416 | 7/9
28 h-m-p 0.2271 8.0000 0.0000 +C 868.193744 0 1.0684 431 | 7/9
29 h-m-p 0.4543 8.0000 0.0000 +C 868.193744 0 2.2355 446 | 7/9
30 h-m-p 0.7615 8.0000 0.0001 ++ 868.193744 m 8.0000 460 | 7/9
31 h-m-p 0.8037 8.0000 0.0006 ++ 868.193738 m 8.0000 474 | 7/9
32 h-m-p 0.8641 8.0000 0.0055 ---------------Y 868.193738 0 0.0000 503 | 7/9
33 h-m-p 0.0160 8.0000 0.0000 +++Y 868.193735 0 2.1571 520 | 7/9
34 h-m-p 1.6000 8.0000 0.0000 -----------Y 868.193735 0 0.0000 545
Out..
lnL = -868.193735
546 lfun, 6006 eigenQcodon, 32760 P(t)
Time used: 0:15
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.013096 0.072458 0.100615 0.070940 0.108848 0.021981 0.000100 0.900000 0.567158 1.258119 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.112527
np = 11
lnL0 = -889.511161
Iterating by ming2
Initial: fx= 889.511161
x= 0.01310 0.07246 0.10061 0.07094 0.10885 0.02198 0.00011 0.90000 0.56716 1.25812 951.42857
1 h-m-p 0.0000 0.0000 163.5731 ++ 889.389909 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 5604.5585 ++ 877.438507 m 0.0000 30 | 2/11
3 h-m-p 0.0001 0.0003 42.3558 ++ 876.108541 m 0.0003 44 | 3/11
4 h-m-p 0.0002 0.0025 45.6970 ++ 870.901989 m 0.0025 58 | 4/11
5 h-m-p 0.0000 0.0001 14.2187 ++ 870.866844 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0005 37.8098 +++ 870.534152 m 0.0005 87 | 6/11
7 h-m-p 0.0011 0.0255 5.6186 ++YYYCYYYCYY 868.618520 10 0.0243 115 | 6/11
8 h-m-p 0.0030 0.0148 0.8785 CC 868.617486 1 0.0010 131 | 6/11
9 h-m-p 0.0121 0.3329 0.0696 +++ 868.567717 m 0.3329 151 | 7/11
10 h-m-p 0.0256 1.5764 0.9056 ++YYYCCCC 868.442896 6 0.4490 181 | 7/11
11 h-m-p 0.1554 0.7770 0.8843 ---------------.. | 7/11
12 h-m-p 0.0013 0.6350 78.7359 --CYC 868.397763 2 0.0000 235 | 7/11
13 h-m-p 0.0133 6.6454 0.2812 ++++
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
+ 868.173114 m 6.6454 252
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38657, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38631, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38644, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
14 h-m-p 1.6000 8.0000 0.0010
QuantileBeta(0.85, 2.38491, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38032, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
C 868.173017 0 1.3355 270
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38529, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38503, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38516, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
15 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.38519, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38526, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
C 868.173017 0 1.3182 287
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38531, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38505, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
16 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
Y 868.173017 0 0.0016 308
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -868.173017
309 lfun, 3708 eigenQcodon, 20394 P(t)
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -868.676668 S = -865.105852 -3.056371
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:20
did 20 / 58 patterns 0:21
did 30 / 58 patterns 0:21
did 40 / 58 patterns 0:21
did 50 / 58 patterns 0:21
did 58 / 58 patterns 0:21
QuantileBeta(0.85, 2.38518, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=218
NC_011896_1_WP_010907629_1_253_MLBR_RS01240 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
NC_002677_1_NP_301305_1_177_lpqT MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI
**************************************************
NC_011896_1_WP_010907629_1_253_MLBR_RS01240 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
NC_002677_1_NP_301305_1_177_lpqT PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345 PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA
**************************************************
NC_011896_1_WP_010907629_1_253_MLBR_RS01240 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
NC_002677_1_NP_301305_1_177_lpqT KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300 KSGKYPTARIVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345 KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG
*********:****************************************
NC_011896_1_WP_010907629_1_253_MLBR_RS01240 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
NC_002677_1_NP_301305_1_177_lpqT FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345 FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV
**************************************************
NC_011896_1_WP_010907629_1_253_MLBR_RS01240 AQSNDIEAIIRGFVVAPK
NC_002677_1_NP_301305_1_177_lpqT AQSNDIEAIIRGFVVAPK
NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690 AQSNDIEAIIRGFVVAPK
NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595 AQSNDIEAIIRGFVVAPK
NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300 AQSNDIEAIIRGFVVAPK
NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345 AQSNDIEAIIRGFVVAPK
******************
>NC_011896_1_WP_010907629_1_253_MLBR_RS01240 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC CAAG >NC_002677_1_NP_301305_1_177_lpqT ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC CAAG >NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC CAAG >NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC CAAG >NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC AAAAGCGGCAAGTACCCGACGGCAAGGATCGTAGCGTTCAAGCTGCGCGG AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC CAAG >NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345 ATGCAGGCAATCCGTCTCGGGCTGCACACCGCTGCCGCGGTAGTCACGCT GAGCATATCCGCGGTCTCCTGCGGGACGAAAACCCCTGACTACCAATTAA TCCTGTCGAAAAGTTCTACAACCACTACGACCACACCCGACAAGCCCATC CCTTTGCCGCAATATCTGGAAAGTATCGGCGTCACCGGGCAGCAGGTGGC GCCGAGCTCCCTGCCCGGTCTGACCGTGTCGATACCGACCCCACCGGGCT GGTCGCCGTATAGCAATCCGAACATCACACCGGAGACGCTGATCATCGCC AAAAGCGGCAAGTACCCGACGGCAAGGCTCGTAGCGTTCAAGCTGCGCGG AGACTTCGACCCAACCCAAGTCATCAAACACGGGAACGACGATGCCCAAC TCTTCGAGAACTTCAGGCAGCTGGACGTTTCGACGGCAAACTACAACGGT TTTCCGTCGGCAATGATCCAAGGCAGCTATGACCTCGAGGGCAGGCGACT ACATGCCTGGAACCGAATCGTGATCCCCACCGGTCCACCACCCTCTAAGC AACAGTATCTCGTTCAGCTCACCATTACCAGCTTGGCCAACGAGGCGGTC GCACAATCAAACGATATCGAGGCTATCATCCGCGGCTTTGTCGTCGCCCC CAAG
>NC_011896_1_WP_010907629_1_253_MLBR_RS01240 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV AQSNDIEAIIRGFVVAPK >NC_002677_1_NP_301305_1_177_lpqT MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV AQSNDIEAIIRGFVVAPK >NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV AQSNDIEAIIRGFVVAPK >NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV AQSNDIEAIIRGFVVAPK >NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA KSGKYPTARIVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV AQSNDIEAIIRGFVVAPK >NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345 MQAIRLGLHTAAAVVTLSISAVSCGTKTPDYQLILSKSSTTTTTTPDKPI PLPQYLESIGVTGQQVAPSSLPGLTVSIPTPPGWSPYSNPNITPETLIIA KSGKYPTARLVAFKLRGDFDPTQVIKHGNDDAQLFENFRQLDVSTANYNG FPSAMIQGSYDLEGRRLHAWNRIVIPTGPPPSKQQYLVQLTITSLANEAV AQSNDIEAIIRGFVVAPK
#NEXUS
[ID: 0807127642]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907629_1_253_MLBR_RS01240
NC_002677_1_NP_301305_1_177_lpqT
NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690
NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595
NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300
NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907629_1_253_MLBR_RS01240,
2 NC_002677_1_NP_301305_1_177_lpqT,
3 NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690,
4 NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595,
5 NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300,
6 NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06437934,2:0.0625737,3:0.06397543,4:0.06103712,5:0.09682807,6:0.06833928);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06437934,2:0.0625737,3:0.06397543,4:0.06103712,5:0.09682807,6:0.06833928);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -902.69 -906.26
2 -902.75 -906.48
--------------------------------------
TOTAL -902.72 -906.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882135 0.089117 0.364375 1.508518 0.849445 1458.10 1472.74 1.000
r(A<->C){all} 0.208231 0.026429 0.000053 0.537697 0.170842 188.40 192.04 1.000
r(A<->G){all} 0.169149 0.018651 0.000064 0.439347 0.135059 174.84 178.03 1.000
r(A<->T){all} 0.151132 0.017970 0.000048 0.437361 0.114661 173.36 247.02 1.000
r(C<->G){all} 0.144970 0.017948 0.000104 0.414087 0.105025 268.61 272.99 1.000
r(C<->T){all} 0.161983 0.019203 0.000072 0.438920 0.122400 164.21 187.56 1.000
r(G<->T){all} 0.164535 0.020419 0.000080 0.457434 0.125515 247.30 252.38 1.000
pi(A){all} 0.242824 0.000291 0.210167 0.276506 0.242917 1249.10 1303.95 1.000
pi(C){all} 0.339865 0.000355 0.305563 0.378812 0.339614 1282.35 1304.37 1.000
pi(G){all} 0.243438 0.000284 0.211305 0.276657 0.243317 846.41 1081.69 1.000
pi(T){all} 0.173873 0.000209 0.144553 0.200758 0.173586 1143.96 1184.80 1.000
alpha{1,2} 0.344940 0.164062 0.000904 1.140021 0.215664 1137.52 1231.86 1.000
alpha{3} 0.424980 0.251453 0.000258 1.469676 0.250020 1147.22 1203.99 1.000
pinvar{all} 0.994903 0.000019 0.986545 0.999866 0.996117 1209.44 1318.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/lpqT/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 218
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 3 3 3 3 3 3 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 6 6 6 6 5 6 | CCC 6 6 6 6 6 6 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 4 4 4 4 4 4 | Gln CAA 7 7 7 7 7 7 | CGA 2 2 2 2 2 2
CTG 9 9 9 9 9 9 | CCG 9 9 9 9 9 9 | CAG 6 6 6 6 6 6 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 14 14 14 14 15 14 | ACC 11 11 11 11 11 11 | AAC 8 8 8 8 8 8 | AGC 6 6 6 6 6 6
ATA 2 2 2 2 2 2 | ACA 3 3 3 3 3 3 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 6 6 6 6 6 6 | AAG 5 5 5 5 5 5 | AGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 2 2 2 2 2 2 | Gly GGT 3 3 3 3 3 3
GTC 7 7 7 7 7 7 | GCC 6 6 6 6 6 6 | GAC 7 7 7 7 7 7 | GGC 6 6 6 6 6 6
GTA 2 2 2 2 2 2 | GCA 5 5 5 5 5 5 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 5 5 5 5 5 5 | GAG 5 5 5 5 5 5 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907629_1_253_MLBR_RS01240
position 1: T:0.13761 C:0.26606 A:0.31651 G:0.27982
position 2: T:0.26606 C:0.32569 A:0.25688 G:0.15138
position 3: T:0.11927 C:0.42202 A:0.15596 G:0.30275
Average T:0.17431 C:0.33792 A:0.24312 G:0.24465
#2: NC_002677_1_NP_301305_1_177_lpqT
position 1: T:0.13761 C:0.26606 A:0.31651 G:0.27982
position 2: T:0.26606 C:0.32569 A:0.25688 G:0.15138
position 3: T:0.11927 C:0.42202 A:0.15596 G:0.30275
Average T:0.17431 C:0.33792 A:0.24312 G:0.24465
#3: NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690
position 1: T:0.13761 C:0.26606 A:0.31651 G:0.27982
position 2: T:0.26606 C:0.32569 A:0.25688 G:0.15138
position 3: T:0.11927 C:0.42202 A:0.15596 G:0.30275
Average T:0.17431 C:0.33792 A:0.24312 G:0.24465
#4: NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595
position 1: T:0.13761 C:0.26606 A:0.31651 G:0.27982
position 2: T:0.26606 C:0.32569 A:0.25688 G:0.15138
position 3: T:0.11927 C:0.42202 A:0.15596 G:0.30275
Average T:0.17431 C:0.33792 A:0.24312 G:0.24465
#5: NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300
position 1: T:0.13761 C:0.26147 A:0.32110 G:0.27982
position 2: T:0.26606 C:0.32569 A:0.25688 G:0.15138
position 3: T:0.11927 C:0.42202 A:0.15596 G:0.30275
Average T:0.17431 C:0.33639 A:0.24465 G:0.24465
#6: NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345
position 1: T:0.13761 C:0.26606 A:0.31651 G:0.27982
position 2: T:0.26606 C:0.32569 A:0.25688 G:0.15138
position 3: T:0.11927 C:0.42202 A:0.15596 G:0.30275
Average T:0.17431 C:0.33792 A:0.24312 G:0.24465
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 24 | Cys C TGT 0
TTC 24 | TCC 18 | TAC 18 | TGC 6
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 30 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 6
CTC 35 | CCC 36 | CAC 12 | CGC 12
CTA 6 | CCA 24 | Gln Q CAA 42 | CGA 12
CTG 54 | CCG 54 | CAG 36 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 12
ATC 85 | ACC 66 | AAC 48 | AGC 36
ATA 12 | ACA 18 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 12 | ACG 36 | AAG 30 | AGG 18
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 12 | Gly G GGT 18
GTC 42 | GCC 36 | GAC 42 | GGC 36
GTA 12 | GCA 30 | Glu E GAA 6 | GGA 6
GTG 18 | GCG 30 | GAG 30 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13761 C:0.26529 A:0.31728 G:0.27982
position 2: T:0.26606 C:0.32569 A:0.25688 G:0.15138
position 3: T:0.11927 C:0.42202 A:0.15596 G:0.30275
Average T:0.17431 C:0.33767 A:0.24337 G:0.24465
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -867.951496 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.004609 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004629
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.004609, 6: 0.000004);
(NC_011896_1_WP_010907629_1_253_MLBR_RS01240: 0.000004, NC_002677_1_NP_301305_1_177_lpqT: 0.000004, NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690: 0.000004, NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595: 0.000004, NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300: 0.004609, NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 521.4 132.6 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 521.4 132.6 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 521.4 132.6 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 521.4 132.6 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.005 521.4 132.6 999.0000 0.0019 0.0000 1.0 0.0
7..6 0.000 521.4 132.6 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0019
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -868.171712 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.004636 0.000004 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004656
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.004636, 6: 0.000004);
(NC_011896_1_WP_010907629_1_253_MLBR_RS01240: 0.000004, NC_002677_1_NP_301305_1_177_lpqT: 0.000004, NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690: 0.000004, NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595: 0.000004, NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300: 0.004636, NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 521.4 132.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 521.4 132.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 521.4 132.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 521.4 132.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.005 521.4 132.6 1.0000 0.0015 0.0015 0.8 0.2
7..6 0.000 521.4 132.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -867.951508 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.004609 0.000004 0.000100 0.000000 0.000000 1.000000 951.528952
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004629
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.004609, 6: 0.000004);
(NC_011896_1_WP_010907629_1_253_MLBR_RS01240: 0.000004, NC_002677_1_NP_301305_1_177_lpqT: 0.000004, NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690: 0.000004, NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595: 0.000004, NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300: 0.004609, NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 951.52895
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 521.4 132.6 951.5290 0.0000 0.0000 0.0 0.0
7..2 0.000 521.4 132.6 951.5290 0.0000 0.0000 0.0 0.0
7..3 0.000 521.4 132.6 951.5290 0.0000 0.0000 0.0 0.0
7..4 0.000 521.4 132.6 951.5290 0.0000 0.0000 0.0 0.0
7..5 0.005 521.4 132.6 951.5290 0.0019 0.0000 1.0 0.0
7..6 0.000 521.4 132.6 951.5290 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907629_1_253_MLBR_RS01240)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.529
2 Q 1.000** 951.529
3 A 1.000** 951.529
4 I 1.000** 951.529
5 R 1.000** 951.529
6 L 1.000** 951.529
7 G 1.000** 951.529
8 L 1.000** 951.529
9 H 1.000** 951.529
10 T 1.000** 951.529
11 A 1.000** 951.529
12 A 1.000** 951.529
13 A 1.000** 951.529
14 V 1.000** 951.529
15 V 1.000** 951.529
16 T 1.000** 951.529
17 L 1.000** 951.529
18 S 1.000** 951.529
19 I 1.000** 951.529
20 S 1.000** 951.529
21 A 1.000** 951.529
22 V 1.000** 951.529
23 S 1.000** 951.529
24 C 1.000** 951.529
25 G 1.000** 951.529
26 T 1.000** 951.529
27 K 1.000** 951.529
28 T 1.000** 951.529
29 P 1.000** 951.529
30 D 1.000** 951.529
31 Y 1.000** 951.529
32 Q 1.000** 951.529
33 L 1.000** 951.529
34 I 1.000** 951.529
35 L 1.000** 951.529
36 S 1.000** 951.529
37 K 1.000** 951.529
38 S 1.000** 951.529
39 S 1.000** 951.529
40 T 1.000** 951.529
41 T 1.000** 951.529
42 T 1.000** 951.529
43 T 1.000** 951.529
44 T 1.000** 951.529
45 T 1.000** 951.529
46 P 1.000** 951.529
47 D 1.000** 951.529
48 K 1.000** 951.529
49 P 1.000** 951.529
50 I 1.000** 951.529
51 P 1.000** 951.529
52 L 1.000** 951.529
53 P 1.000** 951.529
54 Q 1.000** 951.529
55 Y 1.000** 951.529
56 L 1.000** 951.529
57 E 1.000** 951.529
58 S 1.000** 951.529
59 I 1.000** 951.529
60 G 1.000** 951.529
61 V 1.000** 951.529
62 T 1.000** 951.529
63 G 1.000** 951.529
64 Q 1.000** 951.529
65 Q 1.000** 951.529
66 V 1.000** 951.529
67 A 1.000** 951.529
68 P 1.000** 951.529
69 S 1.000** 951.529
70 S 1.000** 951.529
71 L 1.000** 951.529
72 P 1.000** 951.529
73 G 1.000** 951.529
74 L 1.000** 951.529
75 T 1.000** 951.529
76 V 1.000** 951.529
77 S 1.000** 951.529
78 I 1.000** 951.529
79 P 1.000** 951.529
80 T 1.000** 951.529
81 P 1.000** 951.529
82 P 1.000** 951.529
83 G 1.000** 951.529
84 W 1.000** 951.529
85 S 1.000** 951.529
86 P 1.000** 951.529
87 Y 1.000** 951.529
88 S 1.000** 951.529
89 N 1.000** 951.529
90 P 1.000** 951.529
91 N 1.000** 951.529
92 I 1.000** 951.529
93 T 1.000** 951.529
94 P 1.000** 951.529
95 E 1.000** 951.529
96 T 1.000** 951.529
97 L 1.000** 951.529
98 I 1.000** 951.529
99 I 1.000** 951.529
100 A 1.000** 951.529
101 K 1.000** 951.529
102 S 1.000** 951.529
103 G 1.000** 951.529
104 K 1.000** 951.529
105 Y 1.000** 951.529
106 P 1.000** 951.529
107 T 1.000** 951.529
108 A 1.000** 951.529
109 R 1.000** 951.529
110 L 1.000** 951.529
111 V 1.000** 951.529
112 A 1.000** 951.529
113 F 1.000** 951.529
114 K 1.000** 951.529
115 L 1.000** 951.529
116 R 1.000** 951.529
117 G 1.000** 951.529
118 D 1.000** 951.529
119 F 1.000** 951.529
120 D 1.000** 951.529
121 P 1.000** 951.529
122 T 1.000** 951.529
123 Q 1.000** 951.529
124 V 1.000** 951.529
125 I 1.000** 951.529
126 K 1.000** 951.529
127 H 1.000** 951.529
128 G 1.000** 951.529
129 N 1.000** 951.529
130 D 1.000** 951.529
131 D 1.000** 951.529
132 A 1.000** 951.529
133 Q 1.000** 951.529
134 L 1.000** 951.529
135 F 1.000** 951.529
136 E 1.000** 951.529
137 N 1.000** 951.529
138 F 1.000** 951.529
139 R 1.000** 951.529
140 Q 1.000** 951.529
141 L 1.000** 951.529
142 D 1.000** 951.529
143 V 1.000** 951.529
144 S 1.000** 951.529
145 T 1.000** 951.529
146 A 1.000** 951.529
147 N 1.000** 951.529
148 Y 1.000** 951.529
149 N 1.000** 951.529
150 G 1.000** 951.529
151 F 1.000** 951.529
152 P 1.000** 951.529
153 S 1.000** 951.529
154 A 1.000** 951.529
155 M 1.000** 951.529
156 I 1.000** 951.529
157 Q 1.000** 951.529
158 G 1.000** 951.529
159 S 1.000** 951.529
160 Y 1.000** 951.529
161 D 1.000** 951.529
162 L 1.000** 951.529
163 E 1.000** 951.529
164 G 1.000** 951.529
165 R 1.000** 951.529
166 R 1.000** 951.529
167 L 1.000** 951.529
168 H 1.000** 951.529
169 A 1.000** 951.529
170 W 1.000** 951.529
171 N 1.000** 951.529
172 R 1.000** 951.529
173 I 1.000** 951.529
174 V 1.000** 951.529
175 I 1.000** 951.529
176 P 1.000** 951.529
177 T 1.000** 951.529
178 G 1.000** 951.529
179 P 1.000** 951.529
180 P 1.000** 951.529
181 P 1.000** 951.529
182 S 1.000** 951.529
183 K 1.000** 951.529
184 Q 1.000** 951.529
185 Q 1.000** 951.529
186 Y 1.000** 951.529
187 L 1.000** 951.529
188 V 1.000** 951.529
189 Q 1.000** 951.529
190 L 1.000** 951.529
191 T 1.000** 951.529
192 I 1.000** 951.529
193 T 1.000** 951.529
194 S 1.000** 951.529
195 L 1.000** 951.529
196 A 1.000** 951.529
197 N 1.000** 951.529
198 E 1.000** 951.529
199 A 1.000** 951.529
200 V 1.000** 951.529
201 A 1.000** 951.529
202 Q 1.000** 951.529
203 S 1.000** 951.529
204 N 1.000** 951.529
205 D 1.000** 951.529
206 I 1.000** 951.529
207 E 1.000** 951.529
208 A 1.000** 951.529
209 I 1.000** 951.529
210 I 1.000** 951.529
211 R 1.000** 951.529
212 G 1.000** 951.529
213 F 1.000** 951.529
214 V 1.000** 951.529
215 V 1.000** 951.529
216 A 1.000** 951.529
217 P 1.000** 951.529
218 K 1.000** 951.529
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907629_1_253_MLBR_RS01240)
Pr(w>1) post mean +- SE for w
110 L 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -868.193735 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.004638 0.000004 0.000100 0.058368 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004658
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.004638, 6: 0.000004);
(NC_011896_1_WP_010907629_1_253_MLBR_RS01240: 0.000004, NC_002677_1_NP_301305_1_177_lpqT: 0.000004, NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690: 0.000004, NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595: 0.000004, NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300: 0.004638, NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.05837 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00040 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 521.4 132.6 0.9000 0.0000 0.0000 0.0 0.0
7..2 0.000 521.4 132.6 0.9000 0.0000 0.0000 0.0 0.0
7..3 0.000 521.4 132.6 0.9000 0.0000 0.0000 0.0 0.0
7..4 0.000 521.4 132.6 0.9000 0.0000 0.0000 0.0 0.0
7..5 0.005 521.4 132.6 0.9000 0.0015 0.0017 0.8 0.2
7..6 0.000 521.4 132.6 0.9000 0.0000 0.0000 0.0 0.0
Time used: 0:15
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -868.173017 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.004666 0.000004 0.000100 0.999990 2.385181 0.005000 951.431026
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004686
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.004666, 6: 0.000004);
(NC_011896_1_WP_010907629_1_253_MLBR_RS01240: 0.000004, NC_002677_1_NP_301305_1_177_lpqT: 0.000004, NZ_LVXE01000009_1_WP_010907629_1_2852_A3216_RS04690: 0.000004, NZ_LYPH01000016_1_WP_010907629_1_551_A8144_RS02595: 0.000004, NZ_CP029543_1_WP_111481126_1_252_DIJ64_RS01300: 0.004666, NZ_AP014567_1_WP_010907629_1_261_JK2ML_RS01345: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 2.38518 q = 0.00500
(p1 = 0.00001) w = 951.43103
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 951.43103
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 521.4 132.6 1.0095 0.0000 0.0000 0.0 0.0
7..2 0.000 521.4 132.6 1.0095 0.0000 0.0000 0.0 0.0
7..3 0.000 521.4 132.6 1.0095 0.0000 0.0000 0.0 0.0
7..4 0.000 521.4 132.6 1.0095 0.0000 0.0000 0.0 0.0
7..5 0.005 521.4 132.6 1.0095 0.0016 0.0015 0.8 0.2
7..6 0.000 521.4 132.6 1.0095 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907629_1_253_MLBR_RS01240)
Pr(w>1) post mean +- SE for w
110 L 0.761 3.998 +- 3.014
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.049 0.056 0.064 0.074 0.087 0.103 0.122 0.142 0.157 0.146
p : 0.098 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.157 0.152 0.134 0.116 0.099 0.086 0.075 0.067 0.060 0.054
Time used: 0:21
Model 1: NearlyNeutral -868.171712 Model 2: PositiveSelection -867.951508 Model 0: one-ratio -867.951496 Model 7: beta -868.193735 Model 8: beta&w>1 -868.173017 Model 0 vs 1 0.44043199999987337 Model 2 vs 1 0.44040799999993396 Model 8 vs 7 0.04143599999997605
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
