--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:09:50 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lsr2/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -454.12 -457.17
2 -454.12 -457.58
--------------------------------------
TOTAL -454.12 -457.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904228 0.090900 0.383146 1.522487 0.868954 1372.99 1436.99 1.000
r(A<->C){all} 0.175587 0.021612 0.000112 0.472429 0.135603 161.57 214.69 1.000
r(A<->G){all} 0.163768 0.019740 0.000079 0.445035 0.126381 228.74 317.27 1.000
r(A<->T){all} 0.175010 0.021252 0.000122 0.464779 0.135511 218.51 221.70 1.002
r(C<->G){all} 0.160719 0.018957 0.000097 0.433414 0.125021 231.20 246.34 1.001
r(C<->T){all} 0.153467 0.016551 0.000114 0.415632 0.119684 231.26 238.59 1.001
r(G<->T){all} 0.171449 0.021724 0.000002 0.465562 0.129309 130.54 147.42 1.008
pi(A){all} 0.194257 0.000458 0.152742 0.236984 0.193655 1348.57 1352.05 1.000
pi(C){all} 0.262369 0.000541 0.214440 0.305420 0.261892 1057.80 1082.97 1.000
pi(G){all} 0.361054 0.000683 0.313022 0.416574 0.361167 1193.92 1269.64 1.000
pi(T){all} 0.182320 0.000424 0.145003 0.223687 0.181878 1002.92 1119.31 1.000
alpha{1,2} 0.407288 0.210734 0.000105 1.350321 0.244646 1099.26 1156.82 1.000
alpha{3} 0.452887 0.229311 0.000148 1.368754 0.298860 1213.04 1267.90 1.000
pinvar{all} 0.994992 0.000037 0.983474 0.999998 0.996902 1281.53 1381.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -438.932945
Model 2: PositiveSelection -438.932911
Model 0: one-ratio -438.932911
Model 7: beta -438.932963
Model 8: beta&w>1 -438.932911
Model 0 vs 1 6.800000005569018E-5
Model 2 vs 1 6.800000005569018E-5
Model 8 vs 7 1.0399999996479892E-4
>C1
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C2
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C3
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C4
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C5
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C6
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=112
C1 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C2 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C3 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C4 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C5 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C6 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
**************************************************
C1 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C2 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C3 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C4 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C5 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C6 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
**************************************************
C1 PADVIDAFHAAT
C2 PADVIDAFHAAT
C3 PADVIDAFHAAT
C4 PADVIDAFHAAT
C5 PADVIDAFHAAT
C6 PADVIDAFHAAT
************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3360]--->[3360]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.639 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C2 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C3 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C4 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C5 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C6 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
**************************************************
C1 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C2 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C3 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C4 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C5 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C6 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
**************************************************
C1 PADVIDAFHAAT
C2 PADVIDAFHAAT
C3 PADVIDAFHAAT
C4 PADVIDAFHAAT
C5 PADVIDAFHAAT
C6 PADVIDAFHAAT
************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C2 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C3 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C4 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C5 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C6 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
**************************************************
C1 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C2 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C3 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C4 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C5 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C6 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
**************************************************
C1 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C2 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C3 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C4 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C5 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C6 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
**************************************************
C1 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C2 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C3 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C4 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C5 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C6 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
**************************************************
C1 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C2 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C3 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C4 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C5 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C6 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
**************************************************
C1 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C2 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C3 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C4 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C5 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C6 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
**************************************************
C1 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C2 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C3 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C4 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C5 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C6 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
************************************
>C1
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C2
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C3
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C4
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C5
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C6
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C1
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C2
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C3
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C4
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C5
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C6
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 336 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792111
Setting output file names to "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 338243029
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0001615192
Seed = 1532052708
Swapseed = 1579792111
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -751.984107 -- -24.965149
Chain 2 -- -751.984107 -- -24.965149
Chain 3 -- -751.983992 -- -24.965149
Chain 4 -- -751.984107 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -751.984107 -- -24.965149
Chain 2 -- -751.983992 -- -24.965149
Chain 3 -- -751.984107 -- -24.965149
Chain 4 -- -751.984107 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-751.984] (-751.984) (-751.984) (-751.984) * [-751.984] (-751.984) (-751.984) (-751.984)
500 -- (-472.853) [-471.552] (-473.227) (-464.764) * [-468.180] (-473.165) (-463.852) (-464.701) -- 0:00:00
1000 -- (-465.796) [-460.995] (-475.379) (-471.667) * [-460.072] (-484.642) (-463.918) (-463.187) -- 0:00:00
1500 -- (-465.951) [-461.243] (-471.618) (-465.191) * (-459.575) (-473.962) [-458.945] (-467.239) -- 0:00:00
2000 -- [-463.033] (-464.115) (-462.877) (-466.251) * (-463.852) (-478.438) (-462.195) [-467.897] -- 0:00:00
2500 -- (-473.250) [-466.483] (-463.021) (-462.699) * (-460.130) [-460.537] (-464.170) (-466.242) -- 0:00:00
3000 -- (-465.741) (-463.624) (-458.873) [-464.607] * [-460.661] (-464.004) (-466.724) (-464.967) -- 0:00:00
3500 -- (-459.181) [-460.181] (-466.904) (-457.949) * (-475.384) (-462.722) (-458.350) [-464.675] -- 0:00:00
4000 -- (-467.621) [-460.690] (-464.388) (-467.174) * (-460.844) (-462.646) (-466.040) [-469.409] -- 0:00:00
4500 -- (-460.664) (-472.336) (-469.324) [-461.016] * (-471.175) (-469.554) (-471.203) [-458.899] -- 0:00:00
5000 -- (-467.068) (-460.127) (-458.574) [-461.432] * [-461.979] (-459.347) (-466.959) (-468.268) -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-460.747) (-465.512) [-469.731] (-459.962) * (-460.807) (-460.186) [-459.737] (-465.109) -- 0:00:00
6000 -- (-464.399) (-464.867) (-468.716) [-459.760] * (-464.425) (-463.119) (-465.462) [-467.137] -- 0:00:00
6500 -- [-462.255] (-461.840) (-461.234) (-465.765) * [-463.217] (-463.281) (-470.515) (-475.337) -- 0:00:00
7000 -- (-471.043) [-457.133] (-463.090) (-474.555) * [-466.226] (-467.462) (-464.699) (-466.903) -- 0:00:00
7500 -- (-467.021) (-468.405) [-461.571] (-464.080) * (-466.022) [-462.430] (-467.270) (-477.790) -- 0:00:00
8000 -- (-466.611) [-473.334] (-473.232) (-463.027) * [-465.278] (-460.342) (-462.872) (-466.732) -- 0:00:00
8500 -- (-468.758) [-459.498] (-468.710) (-460.874) * (-461.153) (-464.713) (-463.860) [-469.221] -- 0:01:56
9000 -- [-458.970] (-465.236) (-464.080) (-460.786) * (-466.613) (-463.279) [-463.492] (-463.812) -- 0:01:50
9500 -- (-469.226) [-462.675] (-461.218) (-466.435) * (-464.002) [-461.526] (-459.567) (-470.580) -- 0:01:44
10000 -- (-477.456) (-466.512) (-464.000) [-459.156] * [-463.139] (-479.716) (-471.809) (-466.256) -- 0:01:39
Average standard deviation of split frequencies: 0.069780
10500 -- [-464.768] (-456.103) (-460.859) (-466.298) * (-457.614) (-462.995) [-462.691] (-473.133) -- 0:01:34
11000 -- (-472.527) (-463.771) (-460.827) [-465.158] * (-453.826) [-459.731] (-470.932) (-462.493) -- 0:01:29
11500 -- (-464.451) (-463.397) (-461.390) [-463.822] * [-455.817] (-463.324) (-465.908) (-470.724) -- 0:01:25
12000 -- (-456.352) (-462.801) (-470.094) [-463.448] * (-456.405) [-459.869] (-462.593) (-470.339) -- 0:01:22
12500 -- (-454.531) (-463.831) (-459.704) [-465.768] * (-453.583) (-466.323) [-464.746] (-460.598) -- 0:01:19
13000 -- (-453.422) [-456.778] (-466.935) (-458.837) * (-459.986) (-465.510) [-464.223] (-466.645) -- 0:01:15
13500 -- [-456.935] (-479.296) (-461.964) (-462.626) * (-456.897) (-465.637) (-470.300) [-468.159] -- 0:01:13
14000 -- [-455.005] (-473.019) (-466.224) (-462.394) * [-454.088] (-468.273) (-463.969) (-464.227) -- 0:01:10
14500 -- [-454.194] (-458.317) (-465.812) (-470.500) * (-454.757) (-467.202) [-456.447] (-464.214) -- 0:01:07
15000 -- (-455.672) (-459.698) (-466.467) [-463.071] * (-454.065) (-468.764) (-461.625) [-460.973] -- 0:01:05
Average standard deviation of split frequencies: 0.057192
15500 -- (-458.390) [-456.293] (-467.309) (-469.153) * (-453.993) [-461.901] (-470.252) (-470.971) -- 0:01:03
16000 -- (-458.778) (-456.922) (-482.227) [-463.844] * (-453.748) (-463.345) (-468.488) [-461.747] -- 0:01:01
16500 -- (-455.602) (-452.609) (-466.888) [-460.415] * (-454.542) [-462.160] (-469.068) (-464.060) -- 0:00:59
17000 -- (-454.475) (-453.782) (-468.704) [-464.272] * (-453.855) (-468.046) [-461.515] (-473.532) -- 0:00:57
17500 -- (-452.740) [-456.660] (-471.697) (-461.405) * (-455.849) (-471.829) (-464.893) [-466.563] -- 0:00:56
18000 -- (-453.664) (-453.287) (-461.672) [-460.609] * (-456.554) [-458.906] (-463.019) (-475.241) -- 0:00:54
18500 -- (-454.244) (-452.493) [-461.300] (-472.640) * (-456.766) (-466.916) (-460.391) [-462.764] -- 0:00:53
19000 -- (-456.814) (-457.981) [-467.909] (-465.836) * (-457.705) (-466.750) [-461.637] (-467.852) -- 0:00:51
19500 -- [-453.242] (-458.772) (-457.036) (-463.712) * (-453.631) [-463.840] (-475.414) (-464.514) -- 0:00:50
20000 -- (-456.490) (-456.553) [-467.182] (-460.853) * (-455.306) (-463.588) [-458.351] (-463.447) -- 0:00:49
Average standard deviation of split frequencies: 0.071113
20500 -- (-453.934) (-453.160) (-469.534) [-460.466] * [-454.286] (-459.987) (-460.474) (-459.314) -- 0:00:47
21000 -- (-454.964) (-453.423) (-471.716) [-460.498] * (-460.828) [-465.764] (-457.835) (-475.831) -- 0:00:46
21500 -- [-455.344] (-453.054) (-464.534) (-468.678) * (-456.020) (-462.147) (-474.465) [-461.126] -- 0:00:45
22000 -- [-456.234] (-452.935) (-460.360) (-462.425) * [-456.514] (-462.625) (-469.557) (-477.760) -- 0:00:44
22500 -- [-455.337] (-453.980) (-462.895) (-463.645) * (-456.454) [-459.583] (-458.547) (-472.267) -- 0:00:43
23000 -- (-458.321) [-454.295] (-464.582) (-464.844) * (-454.989) (-476.626) (-465.140) [-461.551] -- 0:01:24
23500 -- (-454.314) (-453.984) [-462.528] (-458.912) * [-453.968] (-461.726) (-466.322) (-469.804) -- 0:01:23
24000 -- (-455.396) [-453.476] (-460.415) (-462.653) * (-454.504) (-460.043) (-466.692) [-460.987] -- 0:01:21
24500 -- [-455.706] (-453.007) (-471.852) (-466.136) * (-454.614) (-469.582) (-461.758) [-462.399] -- 0:01:19
25000 -- (-453.888) (-454.698) [-458.552] (-468.482) * [-454.632] (-464.401) (-463.118) (-468.063) -- 0:01:18
Average standard deviation of split frequencies: 0.055256
25500 -- (-461.948) (-454.126) [-465.698] (-470.406) * [-455.766] (-465.400) (-460.783) (-475.522) -- 0:01:16
26000 -- (-453.554) (-454.810) [-467.950] (-467.263) * (-454.954) (-472.239) (-462.429) [-458.146] -- 0:01:14
26500 -- (-455.008) [-456.377] (-473.883) (-457.476) * (-457.532) (-464.850) [-460.780] (-454.372) -- 0:01:13
27000 -- (-454.362) (-456.628) (-467.542) [-459.870] * (-455.351) (-467.419) [-461.622] (-453.395) -- 0:01:12
27500 -- [-455.045] (-457.231) (-467.637) (-463.559) * (-457.377) (-464.794) [-462.978] (-455.212) -- 0:01:10
28000 -- (-455.261) [-455.564] (-462.052) (-469.807) * (-453.931) (-464.320) [-460.524] (-453.790) -- 0:01:09
28500 -- [-457.776] (-454.460) (-469.121) (-464.240) * (-454.309) [-462.931] (-463.274) (-452.825) -- 0:01:08
29000 -- (-453.251) (-456.209) [-463.836] (-465.366) * (-453.673) [-462.584] (-464.888) (-455.738) -- 0:01:06
29500 -- (-456.829) [-452.834] (-468.346) (-459.840) * [-453.482] (-463.450) (-475.231) (-455.439) -- 0:01:05
30000 -- (-463.192) [-455.532] (-462.990) (-463.729) * (-453.359) (-467.380) [-465.158] (-457.098) -- 0:01:04
Average standard deviation of split frequencies: 0.052588
30500 -- (-454.798) (-455.608) (-462.841) [-461.503] * [-453.246] (-464.012) (-463.953) (-456.245) -- 0:01:03
31000 -- (-455.926) (-457.271) (-456.847) [-464.685] * (-459.551) (-467.548) (-463.970) [-454.153] -- 0:01:02
31500 -- (-455.321) (-455.255) (-466.743) [-462.133] * (-454.019) (-471.983) (-465.650) [-452.861] -- 0:01:01
32000 -- (-455.617) (-453.131) [-465.706] (-462.651) * (-453.442) (-468.210) (-461.484) [-453.059] -- 0:01:00
32500 -- (-455.683) (-453.850) [-461.368] (-467.172) * (-455.811) [-468.000] (-462.176) (-456.974) -- 0:00:59
33000 -- (-454.721) (-455.677) [-460.924] (-469.311) * [-457.741] (-466.002) (-461.633) (-453.889) -- 0:00:58
33500 -- [-455.775] (-455.339) (-465.394) (-463.434) * (-455.016) (-468.722) (-464.678) [-453.390] -- 0:00:57
34000 -- (-455.494) [-453.229] (-462.490) (-467.892) * (-455.751) (-463.781) [-461.927] (-453.140) -- 0:00:56
34500 -- [-452.733] (-454.878) (-458.283) (-470.253) * (-456.694) [-467.950] (-464.028) (-455.065) -- 0:00:55
35000 -- (-452.865) [-453.390] (-475.398) (-463.600) * (-456.445) (-458.132) [-463.315] (-455.557) -- 0:00:55
Average standard deviation of split frequencies: 0.044108
35500 -- (-456.285) [-453.588] (-454.068) (-462.596) * (-453.578) (-468.024) [-459.866] (-453.810) -- 0:00:54
36000 -- [-453.359] (-454.473) (-455.169) (-460.725) * [-453.098] (-460.147) (-465.725) (-454.358) -- 0:00:53
36500 -- (-455.845) [-454.830] (-453.521) (-454.891) * (-453.244) (-466.623) (-462.651) [-454.203] -- 0:00:52
37000 -- (-454.375) (-458.777) [-453.635] (-454.976) * (-455.309) (-465.366) [-463.637] (-455.295) -- 0:00:52
37500 -- [-457.343] (-458.812) (-453.796) (-458.220) * [-455.592] (-465.994) (-464.354) (-456.383) -- 0:00:51
38000 -- (-453.584) [-456.113] (-453.932) (-453.731) * [-456.963] (-460.911) (-468.138) (-457.293) -- 0:01:15
38500 -- (-454.959) [-458.353] (-453.865) (-456.169) * (-453.076) (-465.366) (-464.665) [-453.852] -- 0:01:14
39000 -- [-454.523] (-454.391) (-452.859) (-456.382) * (-453.226) (-466.553) [-461.243] (-454.056) -- 0:01:13
39500 -- (-455.262) (-453.994) [-452.932] (-455.228) * [-453.849] (-468.164) (-465.803) (-457.262) -- 0:01:12
40000 -- (-456.920) (-455.759) [-452.548] (-456.346) * (-460.383) [-459.124] (-464.392) (-453.943) -- 0:01:12
Average standard deviation of split frequencies: 0.039657
40500 -- [-454.516] (-454.857) (-454.725) (-453.334) * (-453.827) (-468.140) [-460.508] (-456.168) -- 0:01:11
41000 -- (-455.303) (-453.673) [-455.467] (-454.969) * (-456.540) (-464.762) [-462.272] (-454.678) -- 0:01:10
41500 -- (-455.078) (-454.215) (-455.245) [-452.747] * (-458.696) [-463.211] (-464.031) (-453.063) -- 0:01:09
42000 -- (-452.886) (-457.132) [-456.343] (-456.340) * (-463.095) (-469.929) [-457.051] (-456.449) -- 0:01:08
42500 -- (-453.685) [-453.501] (-456.549) (-457.835) * (-462.223) (-472.100) [-460.237] (-458.575) -- 0:01:07
43000 -- [-454.030] (-454.482) (-461.278) (-457.055) * (-459.310) (-465.653) [-467.756] (-454.762) -- 0:01:06
43500 -- (-456.355) (-455.125) (-456.618) [-454.431] * (-455.173) (-466.298) (-477.375) [-455.744] -- 0:01:05
44000 -- [-453.023] (-456.990) (-456.107) (-455.469) * (-454.971) (-463.660) (-464.074) [-453.159] -- 0:01:05
44500 -- (-462.414) [-456.155] (-454.339) (-453.441) * (-457.673) (-460.822) [-463.660] (-457.818) -- 0:01:04
45000 -- [-458.248] (-455.504) (-454.764) (-454.376) * (-454.044) [-459.596] (-464.650) (-454.339) -- 0:01:03
Average standard deviation of split frequencies: 0.027157
45500 -- (-456.541) (-454.787) [-453.723] (-453.829) * (-456.881) (-459.313) (-473.020) [-454.729] -- 0:01:02
46000 -- (-454.115) (-457.694) (-452.988) [-453.028] * (-459.717) (-461.761) [-462.008] (-457.135) -- 0:01:02
46500 -- (-454.297) [-455.604] (-453.733) (-456.090) * (-458.306) (-466.287) [-463.333] (-455.481) -- 0:01:01
47000 -- (-453.286) (-454.858) [-453.993] (-456.500) * (-453.176) (-461.404) (-468.070) [-452.571] -- 0:01:00
47500 -- (-454.160) (-453.397) (-453.849) [-455.676] * (-456.466) (-462.594) [-465.913] (-457.009) -- 0:01:00
48000 -- (-454.449) [-454.150] (-452.936) (-455.645) * (-458.071) (-464.365) [-464.078] (-454.564) -- 0:00:59
48500 -- (-457.496) (-456.506) [-455.256] (-455.670) * [-457.210] (-467.942) (-463.241) (-455.266) -- 0:00:58
49000 -- (-453.916) (-458.615) [-454.516] (-454.475) * (-458.594) [-464.147] (-465.466) (-455.645) -- 0:00:58
49500 -- (-453.116) (-453.594) (-456.238) [-452.794] * (-455.008) [-453.811] (-465.639) (-454.626) -- 0:00:57
50000 -- [-454.825] (-453.473) (-455.273) (-453.145) * (-453.908) (-458.255) (-470.454) [-454.918] -- 0:00:57
Average standard deviation of split frequencies: 0.023260
50500 -- (-459.059) (-457.546) [-456.180] (-455.537) * (-459.618) (-456.546) (-474.262) [-453.383] -- 0:00:56
51000 -- (-458.367) [-454.538] (-453.287) (-455.206) * (-455.965) [-455.440] (-464.840) (-454.577) -- 0:00:55
51500 -- (-456.923) [-453.639] (-455.974) (-455.162) * (-456.467) (-453.784) (-467.683) [-455.368] -- 0:01:13
52000 -- (-455.396) (-455.505) [-452.626] (-456.296) * (-455.771) (-454.180) (-469.109) [-457.733] -- 0:01:12
52500 -- [-455.422] (-454.707) (-454.976) (-455.320) * [-452.864] (-454.787) (-465.200) (-453.572) -- 0:01:12
53000 -- (-454.380) (-455.531) (-453.553) [-453.078] * (-455.510) (-454.306) (-464.640) [-453.134] -- 0:01:11
53500 -- (-453.773) [-455.723] (-453.318) (-455.467) * (-454.980) [-453.531] (-460.162) (-455.537) -- 0:01:10
54000 -- (-457.029) (-455.029) [-453.347] (-454.373) * (-454.266) [-456.941] (-461.525) (-455.654) -- 0:01:10
54500 -- (-459.704) [-453.352] (-453.296) (-458.428) * (-456.569) (-454.424) (-463.562) [-453.146] -- 0:01:09
55000 -- [-455.744] (-454.591) (-454.116) (-453.488) * (-453.909) [-457.389] (-463.902) (-453.538) -- 0:01:08
Average standard deviation of split frequencies: 0.023925
55500 -- (-454.555) [-453.551] (-453.167) (-463.591) * (-456.166) (-454.262) [-462.419] (-454.206) -- 0:01:08
56000 -- (-459.127) [-455.846] (-455.507) (-455.155) * (-456.031) (-453.651) (-464.858) [-453.027] -- 0:01:07
56500 -- (-452.928) (-455.553) (-455.529) [-453.904] * [-453.057] (-453.881) (-463.640) (-452.851) -- 0:01:06
57000 -- (-453.653) [-453.543] (-459.691) (-452.917) * (-453.635) (-454.533) [-465.412] (-454.110) -- 0:01:06
57500 -- [-456.903] (-456.729) (-453.564) (-455.533) * (-454.187) [-456.230] (-469.582) (-454.311) -- 0:01:05
58000 -- (-454.243) (-453.958) (-454.809) [-454.434] * (-455.885) (-461.414) (-461.417) [-454.822] -- 0:01:04
58500 -- [-453.647] (-453.731) (-453.863) (-454.294) * (-454.341) [-458.662] (-463.041) (-454.313) -- 0:01:04
59000 -- (-454.023) [-454.850] (-453.955) (-458.044) * [-454.132] (-455.753) (-473.072) (-453.982) -- 0:01:03
59500 -- (-453.878) (-454.474) (-454.217) [-454.574] * (-455.192) (-453.374) [-462.610] (-453.790) -- 0:01:03
60000 -- (-456.318) [-455.053] (-455.634) (-452.630) * (-457.185) (-454.444) [-462.436] (-454.200) -- 0:01:02
Average standard deviation of split frequencies: 0.022880
60500 -- (-452.752) [-456.116] (-454.785) (-458.249) * (-453.124) (-456.577) [-458.810] (-454.775) -- 0:01:02
61000 -- (-453.759) (-456.453) (-454.283) [-458.878] * [-459.224] (-456.630) (-468.260) (-453.964) -- 0:01:01
61500 -- (-453.555) [-456.139] (-453.411) (-453.615) * [-454.282] (-456.353) (-479.166) (-453.569) -- 0:01:01
62000 -- (-455.449) [-453.628] (-452.883) (-456.484) * (-457.970) [-454.413] (-466.288) (-453.498) -- 0:01:00
62500 -- (-455.794) (-453.753) [-454.223] (-454.714) * (-455.531) [-454.234] (-464.665) (-454.799) -- 0:01:00
63000 -- (-453.126) (-454.231) (-456.078) [-454.079] * (-455.310) [-453.855] (-469.819) (-455.801) -- 0:00:59
63500 -- [-455.977] (-454.145) (-455.550) (-453.877) * (-458.129) [-453.626] (-464.088) (-461.199) -- 0:00:58
64000 -- [-454.899] (-452.987) (-455.173) (-456.297) * (-455.798) [-454.147] (-466.159) (-457.475) -- 0:00:58
64500 -- (-454.351) (-454.552) (-454.447) [-452.534] * (-456.225) [-454.603] (-465.112) (-452.859) -- 0:00:58
65000 -- (-458.309) (-459.909) (-455.030) [-453.581] * [-454.163] (-454.811) (-459.341) (-457.977) -- 0:00:57
Average standard deviation of split frequencies: 0.022788
65500 -- (-461.192) (-458.492) [-460.115] (-455.037) * [-457.351] (-455.835) (-467.892) (-456.256) -- 0:00:57
66000 -- (-456.140) [-454.810] (-458.072) (-452.477) * (-454.858) (-456.547) [-456.278] (-455.498) -- 0:00:56
66500 -- (-458.110) (-455.078) [-454.038] (-453.199) * (-452.667) (-456.378) (-454.484) [-453.878] -- 0:00:56
67000 -- (-458.188) (-455.234) [-454.521] (-457.547) * [-453.282] (-455.676) (-453.435) (-455.791) -- 0:00:55
67500 -- (-459.021) (-453.139) (-455.110) [-453.393] * (-454.958) [-453.729] (-456.584) (-456.612) -- 0:01:09
68000 -- (-458.926) [-453.803] (-453.322) (-455.211) * [-454.116] (-454.073) (-454.510) (-455.272) -- 0:01:08
68500 -- [-455.696] (-455.612) (-457.644) (-453.114) * (-458.630) (-454.647) [-454.894] (-457.851) -- 0:01:07
69000 -- (-454.040) (-456.194) (-453.315) [-452.907] * (-457.789) [-456.376] (-452.630) (-454.562) -- 0:01:07
69500 -- [-455.277] (-460.062) (-453.308) (-453.725) * (-457.246) (-459.004) [-453.287] (-453.630) -- 0:01:06
70000 -- (-454.610) [-455.319] (-454.346) (-454.200) * (-459.405) (-454.798) (-452.462) [-453.534] -- 0:01:06
Average standard deviation of split frequencies: 0.024460
70500 -- (-456.397) (-460.368) (-452.798) [-453.450] * [-454.882] (-453.212) (-453.734) (-457.756) -- 0:01:05
71000 -- (-454.752) [-453.543] (-452.955) (-458.955) * (-453.601) (-454.651) [-455.499] (-457.407) -- 0:01:05
71500 -- [-455.232] (-454.132) (-457.656) (-453.638) * [-454.345] (-453.229) (-453.564) (-454.928) -- 0:01:04
72000 -- (-454.639) [-456.310] (-454.783) (-454.552) * (-455.044) (-459.352) (-456.122) [-454.331] -- 0:01:04
72500 -- (-454.826) (-454.472) [-455.886] (-454.857) * (-455.153) (-456.458) (-452.903) [-454.904] -- 0:01:03
73000 -- [-454.670] (-452.902) (-455.267) (-456.393) * (-459.384) (-452.576) (-453.132) [-457.333] -- 0:01:03
73500 -- (-453.149) (-453.647) (-453.256) [-454.275] * (-453.612) [-452.706] (-454.364) (-453.508) -- 0:01:03
74000 -- (-457.708) (-453.318) [-454.360] (-454.222) * [-453.836] (-455.408) (-457.543) (-454.953) -- 0:01:02
74500 -- (-454.758) (-454.908) (-461.247) [-457.544] * (-454.220) (-454.228) (-454.521) [-453.905] -- 0:01:02
75000 -- (-456.771) (-454.672) (-454.853) [-456.337] * [-459.020] (-454.137) (-453.344) (-453.407) -- 0:01:01
Average standard deviation of split frequencies: 0.023831
75500 -- (-454.015) (-454.153) [-453.518] (-458.412) * [-454.569] (-458.861) (-456.971) (-453.488) -- 0:01:01
76000 -- (-456.049) [-453.575] (-455.224) (-454.619) * (-454.169) [-454.254] (-455.509) (-454.782) -- 0:01:00
76500 -- (-457.084) (-453.601) (-455.860) [-455.853] * (-452.644) (-454.740) (-455.536) [-454.150] -- 0:01:00
77000 -- [-453.664] (-457.247) (-454.425) (-454.731) * (-453.206) [-454.465] (-457.130) (-453.278) -- 0:00:59
77500 -- (-455.138) [-457.482] (-453.656) (-457.196) * [-453.134] (-455.089) (-456.203) (-453.172) -- 0:00:59
78000 -- [-454.236] (-454.799) (-456.333) (-453.975) * [-455.332] (-456.479) (-455.896) (-455.021) -- 0:00:59
78500 -- [-455.048] (-456.267) (-453.625) (-456.581) * (-455.065) [-455.423] (-454.946) (-454.697) -- 0:00:58
79000 -- [-453.776] (-454.675) (-453.585) (-453.515) * (-454.461) (-453.777) [-453.042] (-454.829) -- 0:00:58
79500 -- [-453.346] (-454.911) (-460.101) (-454.253) * (-453.932) (-457.546) [-456.134] (-454.552) -- 0:00:57
80000 -- (-454.126) [-452.726] (-454.530) (-453.751) * (-456.986) [-456.716] (-453.221) (-453.782) -- 0:00:57
Average standard deviation of split frequencies: 0.020454
80500 -- (-456.771) [-457.665] (-454.358) (-453.153) * (-454.954) [-455.935] (-453.565) (-454.215) -- 0:00:57
81000 -- (-453.401) [-456.198] (-453.555) (-453.603) * (-460.936) (-453.173) (-454.010) [-453.891] -- 0:00:56
81500 -- (-457.782) (-453.805) (-454.114) [-455.833] * (-457.946) (-455.124) [-456.129] (-453.064) -- 0:00:56
82000 -- [-456.165] (-452.955) (-455.948) (-462.116) * (-454.216) (-454.160) [-453.999] (-454.162) -- 0:00:55
82500 -- (-453.381) [-455.290] (-454.857) (-455.440) * (-455.509) (-454.234) (-455.660) [-452.936] -- 0:00:55
83000 -- [-454.676] (-453.755) (-458.001) (-462.593) * [-454.536] (-455.218) (-461.039) (-454.824) -- 0:00:55
83500 -- (-453.058) [-453.068] (-460.672) (-455.890) * (-457.898) (-456.738) (-457.193) [-456.946] -- 0:00:54
84000 -- (-454.872) (-452.713) (-456.640) [-455.222] * (-457.828) (-454.750) [-454.791] (-455.202) -- 0:00:54
84500 -- (-455.151) [-453.429] (-455.832) (-456.055) * (-454.114) (-454.388) (-454.376) [-453.048] -- 0:01:05
85000 -- (-457.845) [-454.095] (-455.157) (-453.538) * [-454.305] (-453.959) (-453.907) (-454.886) -- 0:01:04
Average standard deviation of split frequencies: 0.020483
85500 -- (-454.844) (-454.708) [-456.814] (-454.052) * [-456.390] (-456.649) (-454.366) (-460.343) -- 0:01:04
86000 -- (-453.923) (-454.916) (-453.692) [-455.896] * (-455.349) [-453.460] (-453.522) (-454.881) -- 0:01:03
86500 -- [-454.209] (-455.710) (-460.333) (-456.086) * [-453.272] (-454.372) (-454.858) (-453.944) -- 0:01:03
87000 -- (-455.554) (-454.189) (-456.210) [-454.673] * (-453.467) (-454.326) [-453.809] (-455.864) -- 0:01:02
87500 -- (-453.147) (-455.945) [-453.914] (-454.095) * [-454.557] (-455.139) (-458.039) (-455.320) -- 0:01:02
88000 -- [-453.310] (-454.114) (-453.339) (-453.550) * [-453.287] (-457.438) (-459.401) (-452.707) -- 0:01:02
88500 -- (-454.026) [-454.828] (-453.147) (-457.734) * (-453.515) [-452.985] (-453.910) (-455.358) -- 0:01:01
89000 -- (-455.109) (-457.394) (-455.920) [-458.551] * (-456.594) [-453.678] (-454.810) (-455.181) -- 0:01:01
89500 -- (-454.646) (-453.933) [-454.250] (-458.615) * (-457.771) (-453.848) [-454.096] (-454.681) -- 0:01:01
90000 -- (-455.385) [-453.932] (-454.000) (-459.379) * [-457.565] (-456.279) (-454.696) (-459.237) -- 0:01:00
Average standard deviation of split frequencies: 0.020250
90500 -- (-454.474) (-454.571) (-455.340) [-454.518] * (-456.986) (-455.638) (-455.978) [-455.427] -- 0:01:00
91000 -- (-454.679) (-454.789) [-456.875] (-454.212) * (-456.655) (-455.275) [-454.048] (-453.408) -- 0:00:59
91500 -- [-453.850] (-455.411) (-454.567) (-454.336) * (-457.406) [-455.680] (-454.278) (-457.009) -- 0:00:59
92000 -- (-453.517) (-461.359) (-452.920) [-453.633] * (-456.370) [-455.641] (-453.937) (-455.968) -- 0:00:59
92500 -- (-455.318) (-457.627) [-453.261] (-455.477) * (-458.765) (-454.439) [-459.248] (-454.158) -- 0:00:58
93000 -- (-454.917) (-453.557) [-454.170] (-458.778) * (-457.550) (-454.590) [-453.383] (-456.134) -- 0:00:58
93500 -- [-456.037] (-455.134) (-457.755) (-455.634) * (-458.470) (-456.460) (-456.097) [-456.338] -- 0:00:58
94000 -- (-456.546) (-455.971) (-456.222) [-456.228] * (-455.264) (-453.880) (-456.719) [-454.502] -- 0:00:57
94500 -- (-455.113) [-454.160] (-453.895) (-457.720) * (-457.029) (-454.051) [-456.768] (-455.406) -- 0:00:57
95000 -- [-453.147] (-457.932) (-454.427) (-455.210) * (-454.420) [-452.627] (-455.865) (-454.846) -- 0:00:57
Average standard deviation of split frequencies: 0.021709
95500 -- [-452.893] (-455.470) (-456.061) (-454.210) * (-455.879) [-452.878] (-458.698) (-454.670) -- 0:00:56
96000 -- [-454.405] (-452.983) (-454.492) (-455.658) * (-457.027) (-454.065) [-453.765] (-459.900) -- 0:00:56
96500 -- (-453.671) (-456.946) (-454.792) [-457.978] * [-455.313] (-454.403) (-455.794) (-457.065) -- 0:00:56
97000 -- (-454.684) (-455.915) (-452.829) [-453.797] * (-454.369) (-453.802) [-454.041] (-455.868) -- 0:00:55
97500 -- (-453.440) (-453.820) [-455.447] (-453.936) * (-455.593) (-454.390) (-456.177) [-453.611] -- 0:00:55
98000 -- (-452.957) (-456.027) (-453.138) [-453.193] * (-453.848) [-452.897] (-454.912) (-452.931) -- 0:00:55
98500 -- (-453.200) [-453.650] (-455.293) (-453.148) * (-455.535) [-453.428] (-456.431) (-455.589) -- 0:00:54
99000 -- (-453.183) (-454.851) [-453.358] (-454.228) * (-455.652) (-455.584) [-458.120] (-458.463) -- 0:00:54
99500 -- (-453.196) (-454.915) (-454.474) [-456.825] * [-453.658] (-456.403) (-453.079) (-457.412) -- 0:00:54
100000 -- [-456.616] (-454.676) (-455.595) (-453.711) * (-453.995) (-457.815) (-453.099) [-454.533] -- 0:00:54
Average standard deviation of split frequencies: 0.020032
100500 -- (-458.386) [-455.918] (-453.605) (-453.011) * (-452.599) [-458.206] (-453.223) (-454.436) -- 0:00:53
101000 -- (-454.799) [-455.263] (-455.444) (-456.329) * [-452.818] (-456.446) (-454.521) (-453.154) -- 0:00:53
101500 -- (-453.936) (-458.088) (-453.050) [-455.297] * (-457.333) (-456.271) (-463.533) [-453.136] -- 0:01:01
102000 -- (-455.854) [-454.579] (-453.743) (-454.144) * [-453.514] (-457.792) (-452.640) (-453.733) -- 0:01:01
102500 -- [-455.328] (-457.513) (-456.225) (-452.545) * (-455.383) (-458.191) [-453.942] (-457.254) -- 0:01:01
103000 -- (-454.338) [-454.402] (-459.921) (-453.090) * (-454.176) [-458.564] (-458.270) (-453.317) -- 0:01:00
103500 -- (-455.578) (-454.768) [-454.480] (-457.947) * (-457.131) (-457.392) [-456.017] (-454.565) -- 0:01:00
104000 -- (-454.460) [-456.039] (-454.528) (-453.245) * (-456.022) (-453.632) (-453.379) [-453.448] -- 0:01:00
104500 -- (-461.868) (-458.660) [-456.190] (-456.364) * (-454.676) (-454.389) [-453.940] (-455.039) -- 0:00:59
105000 -- [-461.247] (-457.423) (-460.025) (-453.178) * (-452.982) (-452.921) [-452.785] (-457.432) -- 0:00:59
Average standard deviation of split frequencies: 0.021495
105500 -- (-458.319) [-454.473] (-458.637) (-455.810) * (-455.720) [-453.323] (-456.296) (-454.302) -- 0:00:59
106000 -- (-454.375) (-455.966) (-454.227) [-456.965] * [-455.918] (-456.936) (-454.505) (-453.218) -- 0:00:59
106500 -- (-455.576) [-453.425] (-456.666) (-454.632) * [-453.623] (-456.099) (-454.376) (-452.849) -- 0:00:58
107000 -- (-455.123) [-455.952] (-454.179) (-455.577) * (-455.897) (-459.322) (-456.864) [-453.558] -- 0:00:58
107500 -- [-457.297] (-455.190) (-456.855) (-454.309) * [-453.347] (-455.487) (-453.132) (-455.660) -- 0:00:58
108000 -- (-457.798) (-452.594) (-454.919) [-454.473] * (-453.316) (-458.527) [-454.848] (-457.879) -- 0:00:57
108500 -- (-457.284) (-455.257) (-455.306) [-454.888] * (-453.889) (-454.854) [-454.648] (-455.744) -- 0:00:57
109000 -- (-458.340) (-457.181) (-455.479) [-456.135] * (-454.385) (-456.424) [-455.806] (-457.124) -- 0:00:57
109500 -- (-457.422) (-455.252) (-454.227) [-453.123] * (-455.691) [-454.561] (-454.206) (-454.114) -- 0:00:56
110000 -- (-454.308) (-454.210) (-455.917) [-454.512] * (-454.536) (-456.479) (-456.863) [-454.648] -- 0:00:56
Average standard deviation of split frequencies: 0.019642
110500 -- [-456.792] (-453.881) (-457.833) (-458.677) * (-453.644) (-453.279) [-453.484] (-453.342) -- 0:00:56
111000 -- (-454.730) (-454.143) [-456.283] (-457.864) * [-455.506] (-458.811) (-453.551) (-453.668) -- 0:00:56
111500 -- (-454.284) (-453.413) (-453.850) [-457.121] * [-453.037] (-453.377) (-455.357) (-456.346) -- 0:00:55
112000 -- [-454.481] (-455.868) (-458.240) (-456.826) * (-453.672) (-453.705) [-453.837] (-456.304) -- 0:00:55
112500 -- [-454.860] (-455.615) (-452.712) (-456.331) * (-453.805) [-452.764] (-454.615) (-455.853) -- 0:00:55
113000 -- (-453.939) [-455.119] (-458.422) (-457.360) * (-453.088) (-453.398) [-455.692] (-457.827) -- 0:00:54
113500 -- [-456.011] (-453.019) (-456.203) (-456.695) * (-455.176) [-453.686] (-454.785) (-458.717) -- 0:00:54
114000 -- (-456.334) (-453.277) (-455.069) [-454.663] * (-456.330) (-454.094) [-453.323] (-458.854) -- 0:00:54
114500 -- (-455.070) [-454.163] (-454.516) (-455.672) * (-456.367) (-454.952) [-456.395] (-456.627) -- 0:00:54
115000 -- (-454.184) (-456.032) (-458.040) [-455.435] * [-456.288] (-452.580) (-452.957) (-455.580) -- 0:00:53
Average standard deviation of split frequencies: 0.019642
115500 -- [-452.708] (-453.475) (-456.668) (-455.670) * (-455.339) (-452.934) (-455.869) [-457.521] -- 0:00:53
116000 -- (-456.219) [-457.965] (-457.021) (-457.390) * (-455.810) (-457.829) (-458.681) [-454.974] -- 0:00:53
116500 -- (-457.534) (-454.675) [-455.635] (-456.918) * [-454.628] (-454.125) (-454.195) (-454.245) -- 0:00:53
117000 -- (-457.572) (-453.950) [-455.212] (-457.903) * (-456.942) (-456.446) (-456.342) [-457.493] -- 0:00:52
117500 -- (-455.010) (-458.413) (-454.922) [-453.068] * (-457.798) (-456.289) (-454.257) [-455.271] -- 0:00:52
118000 -- [-454.165] (-456.972) (-456.095) (-454.002) * (-455.080) (-455.000) (-455.525) [-454.984] -- 0:00:52
118500 -- (-454.918) (-455.984) [-455.747] (-453.170) * (-457.736) (-453.104) (-454.836) [-454.604] -- 0:00:59
119000 -- (-453.449) [-454.069] (-454.395) (-455.400) * (-455.281) (-452.732) (-456.849) [-457.003] -- 0:00:59
119500 -- (-454.462) [-454.493] (-454.747) (-455.406) * [-455.022] (-455.944) (-458.143) (-455.255) -- 0:00:58
120000 -- (-460.048) (-452.808) [-453.597] (-457.821) * (-453.294) (-454.001) [-454.926] (-454.079) -- 0:00:58
Average standard deviation of split frequencies: 0.021270
120500 -- (-454.427) (-455.737) (-453.405) [-453.395] * (-453.893) (-454.559) (-455.564) [-457.872] -- 0:00:58
121000 -- (-454.270) (-456.980) [-457.532] (-457.771) * (-455.001) (-458.891) (-455.048) [-455.070] -- 0:00:58
121500 -- (-457.590) (-455.528) (-455.102) [-458.734] * (-454.068) (-455.283) (-453.571) [-455.503] -- 0:00:57
122000 -- [-454.500] (-455.916) (-454.311) (-463.016) * (-454.509) [-453.731] (-453.690) (-454.289) -- 0:00:57
122500 -- (-453.207) (-458.008) [-453.475] (-460.185) * (-457.510) (-457.260) [-453.290] (-457.745) -- 0:00:57
123000 -- (-454.765) (-455.014) (-454.818) [-459.328] * (-453.977) (-456.227) (-454.668) [-454.147] -- 0:00:57
123500 -- [-453.533] (-453.389) (-455.589) (-454.242) * (-457.322) (-460.069) [-456.042] (-456.988) -- 0:00:56
124000 -- (-453.458) [-452.940] (-457.282) (-453.718) * (-454.592) [-453.930] (-455.472) (-453.213) -- 0:00:56
124500 -- (-454.380) [-454.327] (-454.552) (-458.508) * (-454.845) (-452.819) (-454.895) [-453.620] -- 0:00:56
125000 -- (-454.656) (-453.332) [-455.138] (-454.220) * (-454.874) (-454.263) (-453.341) [-454.011] -- 0:00:56
Average standard deviation of split frequencies: 0.021857
125500 -- (-454.661) (-453.369) [-455.304] (-454.891) * (-454.907) (-457.871) [-454.819] (-453.072) -- 0:00:55
126000 -- (-455.382) (-453.913) [-454.579] (-453.514) * (-455.077) (-453.704) (-454.992) [-453.083] -- 0:00:55
126500 -- (-454.255) [-453.791] (-456.510) (-453.707) * [-453.486] (-453.857) (-453.629) (-454.190) -- 0:00:55
127000 -- (-453.987) (-455.399) (-456.664) [-454.519] * [-455.442] (-461.414) (-453.327) (-454.982) -- 0:00:54
127500 -- [-455.280] (-454.718) (-454.276) (-453.690) * (-452.893) [-453.273] (-453.258) (-455.798) -- 0:00:54
128000 -- (-455.002) (-458.600) (-458.216) [-455.438] * (-453.063) (-455.228) [-453.522] (-456.165) -- 0:00:54
128500 -- (-453.494) [-455.469] (-455.654) (-454.767) * (-453.947) [-456.329] (-455.592) (-453.445) -- 0:00:54
129000 -- (-454.242) (-456.105) [-456.257] (-454.146) * (-460.370) (-454.929) [-454.961] (-453.361) -- 0:00:54
129500 -- (-454.285) (-453.738) [-453.574] (-453.022) * (-454.133) (-455.887) [-455.247] (-454.200) -- 0:00:53
130000 -- (-454.448) (-454.810) (-454.783) [-453.510] * (-456.023) (-452.901) (-454.532) [-452.962] -- 0:00:53
Average standard deviation of split frequencies: 0.021646
130500 -- (-454.744) [-457.014] (-453.548) (-455.746) * (-453.643) [-453.604] (-458.391) (-455.372) -- 0:00:53
131000 -- (-453.193) (-453.646) [-453.461] (-455.441) * [-454.179] (-455.285) (-453.699) (-460.274) -- 0:00:53
131500 -- (-456.193) (-453.612) [-452.824] (-455.652) * (-455.366) (-462.749) [-453.700] (-453.591) -- 0:00:52
132000 -- (-457.473) (-452.894) [-453.876] (-454.519) * (-453.856) (-457.300) (-456.088) [-455.308] -- 0:00:52
132500 -- (-457.596) (-453.463) (-456.177) [-455.980] * (-454.426) (-454.878) (-453.461) [-454.035] -- 0:00:52
133000 -- (-460.962) (-452.591) [-454.074] (-456.504) * (-454.053) (-453.319) (-454.196) [-455.726] -- 0:00:52
133500 -- (-457.175) (-453.097) (-454.621) [-454.971] * (-455.080) (-453.893) (-455.268) [-457.295] -- 0:00:51
134000 -- (-458.185) [-453.273] (-454.762) (-454.575) * (-454.844) (-453.124) [-454.487] (-454.717) -- 0:00:51
134500 -- (-456.479) [-453.055] (-454.131) (-453.494) * [-453.590] (-455.172) (-454.066) (-454.906) -- 0:00:51
135000 -- (-454.652) [-454.011] (-453.910) (-453.684) * (-456.114) (-454.714) [-457.150] (-459.359) -- 0:00:51
Average standard deviation of split frequencies: 0.021345
135500 -- (-453.904) (-453.135) [-454.980] (-454.168) * [-454.093] (-456.905) (-454.955) (-453.260) -- 0:00:57
136000 -- (-460.707) [-452.736] (-456.630) (-457.310) * (-452.882) [-455.913] (-454.115) (-455.098) -- 0:00:57
136500 -- (-453.500) [-456.304] (-454.802) (-457.404) * (-452.841) (-454.601) (-455.557) [-453.154] -- 0:00:56
137000 -- [-453.306] (-454.213) (-454.512) (-453.170) * (-457.029) (-457.352) [-454.981] (-453.920) -- 0:00:56
137500 -- (-454.237) (-453.793) (-456.632) [-454.794] * (-455.581) (-454.500) [-459.284] (-455.537) -- 0:00:56
138000 -- (-453.327) (-455.856) [-457.324] (-458.967) * (-454.131) [-453.225] (-457.135) (-456.268) -- 0:00:56
138500 -- (-455.557) (-454.498) [-452.707] (-458.955) * (-456.681) (-452.911) (-456.349) [-455.709] -- 0:00:55
139000 -- [-453.404] (-452.777) (-457.812) (-454.810) * [-455.343] (-458.256) (-454.223) (-459.536) -- 0:00:55
139500 -- [-452.835] (-453.283) (-455.619) (-455.097) * (-454.557) [-453.659] (-454.311) (-454.671) -- 0:00:55
140000 -- (-452.954) (-453.402) [-452.937] (-462.330) * (-453.888) [-454.641] (-453.627) (-455.098) -- 0:00:55
Average standard deviation of split frequencies: 0.018873
140500 -- (-455.067) (-453.532) [-453.660] (-457.326) * [-454.356] (-454.457) (-452.978) (-453.520) -- 0:00:55
141000 -- (-455.516) [-458.301] (-453.122) (-462.038) * (-456.360) (-454.770) (-452.741) [-454.888] -- 0:00:54
141500 -- (-453.397) (-457.806) (-453.541) [-461.993] * [-454.018] (-454.350) (-458.047) (-452.817) -- 0:00:54
142000 -- (-453.391) (-458.132) [-454.856] (-454.560) * [-455.907] (-454.862) (-458.449) (-453.015) -- 0:00:54
142500 -- [-453.451] (-456.131) (-454.751) (-459.131) * (-455.644) (-456.608) (-457.091) [-453.935] -- 0:00:54
143000 -- (-456.315) [-458.817] (-455.895) (-458.491) * (-456.277) (-455.321) [-455.844] (-456.180) -- 0:00:53
143500 -- (-456.565) (-455.081) [-460.493] (-454.399) * (-453.133) (-455.504) [-454.285] (-454.369) -- 0:00:53
144000 -- (-461.003) (-455.446) (-454.698) [-459.230] * (-453.577) (-459.031) (-454.986) [-454.905] -- 0:00:53
144500 -- (-457.117) (-456.701) [-452.757] (-455.648) * (-453.710) (-454.204) [-453.489] (-455.313) -- 0:00:53
145000 -- (-460.210) (-455.786) [-453.112] (-461.373) * (-455.208) (-454.681) [-457.352] (-453.376) -- 0:00:53
Average standard deviation of split frequencies: 0.016314
145500 -- (-460.749) [-452.646] (-455.184) (-458.000) * (-452.989) (-452.947) [-458.016] (-455.090) -- 0:00:52
146000 -- (-462.800) (-452.955) (-457.722) [-453.448] * (-452.903) (-453.536) [-452.913] (-454.452) -- 0:00:52
146500 -- [-457.593] (-453.840) (-454.931) (-456.610) * (-454.707) [-452.910] (-456.007) (-459.260) -- 0:00:52
147000 -- [-455.149] (-456.138) (-455.054) (-455.455) * (-456.612) (-455.617) (-454.486) [-459.038] -- 0:00:52
147500 -- (-454.598) (-455.548) (-457.092) [-455.428] * (-455.378) [-455.315] (-455.138) (-459.621) -- 0:00:52
148000 -- (-456.450) (-453.309) (-458.319) [-456.524] * [-453.368] (-453.845) (-452.833) (-455.850) -- 0:00:51
148500 -- (-453.998) (-456.247) (-461.484) [-455.815] * (-453.460) (-459.091) (-453.560) [-454.832] -- 0:00:51
149000 -- (-454.143) [-453.865] (-460.253) (-457.786) * (-455.770) (-457.017) [-452.866] (-454.144) -- 0:00:51
149500 -- (-456.348) (-455.361) [-457.645] (-457.671) * (-454.455) [-454.226] (-455.482) (-458.624) -- 0:00:51
150000 -- (-455.494) (-455.819) [-454.753] (-454.603) * (-455.141) (-453.526) [-453.903] (-454.750) -- 0:00:51
Average standard deviation of split frequencies: 0.014775
150500 -- (-456.594) (-455.023) [-456.549] (-454.043) * (-453.529) (-453.119) (-459.762) [-453.208] -- 0:00:50
151000 -- (-457.217) [-455.414] (-454.873) (-453.979) * (-457.708) (-455.007) [-455.765] (-456.216) -- 0:00:50
151500 -- (-454.886) [-455.589] (-455.062) (-454.280) * (-455.268) [-456.306] (-454.428) (-456.805) -- 0:00:50
152000 -- (-455.348) [-456.586] (-460.708) (-454.790) * (-454.164) (-455.313) [-454.688] (-454.703) -- 0:00:50
152500 -- (-459.233) [-454.527] (-456.431) (-455.285) * (-455.558) [-453.866] (-455.271) (-455.529) -- 0:00:55
153000 -- (-457.585) (-456.331) (-456.516) [-454.438] * (-456.160) (-455.550) [-455.660] (-454.940) -- 0:00:55
153500 -- (-454.346) (-453.334) [-457.433] (-455.432) * (-453.924) [-453.809] (-453.631) (-453.414) -- 0:00:55
154000 -- [-454.931] (-454.410) (-454.952) (-457.841) * (-454.875) (-456.398) [-455.351] (-455.114) -- 0:00:54
154500 -- (-457.475) (-455.811) [-454.770] (-456.137) * (-454.820) (-455.656) [-455.247] (-458.266) -- 0:00:54
155000 -- [-453.613] (-457.196) (-454.984) (-457.938) * (-455.785) (-453.624) [-453.391] (-458.950) -- 0:00:54
Average standard deviation of split frequencies: 0.015277
155500 -- (-453.646) (-454.918) (-456.086) [-455.945] * (-452.662) [-456.197] (-456.119) (-453.330) -- 0:00:54
156000 -- (-454.424) [-458.278] (-459.778) (-453.549) * [-460.151] (-454.628) (-455.112) (-456.198) -- 0:00:54
156500 -- (-456.264) [-452.935] (-456.439) (-454.674) * (-460.597) (-454.040) [-453.524] (-457.258) -- 0:00:53
157000 -- (-454.604) (-453.242) [-456.055] (-458.121) * (-456.325) (-456.189) [-455.302] (-456.250) -- 0:00:53
157500 -- (-455.044) [-454.592] (-456.135) (-455.997) * (-455.239) [-454.717] (-454.534) (-453.339) -- 0:00:53
158000 -- [-453.942] (-454.572) (-453.609) (-454.769) * [-456.200] (-455.483) (-454.380) (-453.273) -- 0:00:53
158500 -- (-455.390) [-455.767] (-455.910) (-456.758) * [-456.141] (-456.072) (-459.044) (-453.186) -- 0:00:53
159000 -- (-458.195) (-453.790) (-453.999) [-454.545] * [-454.693] (-453.772) (-454.435) (-456.859) -- 0:00:52
159500 -- (-457.758) (-453.305) (-453.766) [-454.271] * (-454.211) (-455.697) [-453.476] (-460.371) -- 0:00:52
160000 -- (-461.997) (-452.870) [-457.477] (-454.451) * [-454.004] (-456.504) (-458.366) (-456.713) -- 0:00:52
Average standard deviation of split frequencies: 0.017441
160500 -- (-456.916) (-453.066) [-456.818] (-456.744) * (-457.525) [-455.781] (-454.210) (-459.257) -- 0:00:52
161000 -- (-454.281) [-454.321] (-457.286) (-456.295) * (-459.878) (-453.278) [-453.770] (-453.680) -- 0:00:52
161500 -- (-455.376) (-454.247) (-459.171) [-452.948] * (-456.054) [-453.677] (-454.265) (-455.642) -- 0:00:51
162000 -- (-456.922) [-453.288] (-454.342) (-455.841) * (-458.103) (-457.087) [-454.154] (-457.431) -- 0:00:51
162500 -- (-458.094) (-454.391) [-454.817] (-455.404) * (-455.003) [-454.045] (-454.082) (-452.937) -- 0:00:51
163000 -- (-456.435) (-454.007) [-456.567] (-457.994) * (-456.092) (-456.643) [-454.443] (-454.633) -- 0:00:51
163500 -- (-452.774) [-454.299] (-454.378) (-458.477) * (-456.248) [-455.620] (-453.850) (-455.411) -- 0:00:51
164000 -- (-454.561) [-453.182] (-454.937) (-454.607) * [-453.693] (-458.621) (-455.333) (-454.801) -- 0:00:50
164500 -- (-456.924) (-453.522) [-455.669] (-454.531) * (-452.970) [-456.414] (-454.904) (-453.545) -- 0:00:50
165000 -- (-455.498) (-453.629) (-455.131) [-454.409] * (-454.726) (-452.864) [-453.487] (-453.102) -- 0:00:50
Average standard deviation of split frequencies: 0.015303
165500 -- (-456.867) (-453.273) [-456.450] (-454.329) * (-453.377) [-453.953] (-452.836) (-454.753) -- 0:00:50
166000 -- (-455.939) (-454.532) [-453.189] (-456.318) * (-453.244) (-454.209) (-455.627) [-453.680] -- 0:00:50
166500 -- (-454.150) [-454.196] (-454.222) (-455.815) * (-454.572) [-457.857] (-456.060) (-453.509) -- 0:00:50
167000 -- (-455.452) (-453.926) (-455.073) [-453.809] * (-455.858) (-457.586) [-455.769] (-454.476) -- 0:00:49
167500 -- (-456.642) (-454.441) (-456.948) [-454.267] * (-453.230) (-456.103) (-458.902) [-455.483] -- 0:00:49
168000 -- (-454.660) [-456.901] (-455.420) (-453.466) * (-460.904) (-458.680) [-456.818] (-453.046) -- 0:00:49
168500 -- (-455.984) (-456.987) (-454.019) [-454.630] * (-458.309) [-453.443] (-461.410) (-453.965) -- 0:00:49
169000 -- (-457.344) (-453.930) [-454.741] (-454.024) * (-457.078) [-454.304] (-455.187) (-459.393) -- 0:00:54
169500 -- (-453.262) (-455.706) (-456.291) [-453.731] * (-454.369) [-454.451] (-453.837) (-456.490) -- 0:00:53
170000 -- (-454.185) [-455.771] (-453.986) (-452.494) * (-452.891) [-455.149] (-454.651) (-454.258) -- 0:00:53
Average standard deviation of split frequencies: 0.014623
170500 -- [-454.278] (-455.921) (-458.318) (-457.947) * (-452.940) (-454.485) (-454.401) [-454.732] -- 0:00:53
171000 -- (-455.355) (-460.614) (-457.861) [-457.551] * [-452.925] (-454.683) (-453.321) (-458.161) -- 0:00:53
171500 -- (-455.689) (-456.739) (-462.740) [-453.361] * (-456.445) [-455.499] (-453.063) (-458.015) -- 0:00:53
172000 -- (-457.913) (-458.104) [-454.239] (-455.757) * (-457.004) (-453.827) [-454.615] (-454.768) -- 0:00:52
172500 -- (-453.090) (-454.250) [-455.798] (-452.948) * (-455.468) (-453.064) [-453.438] (-454.853) -- 0:00:52
173000 -- (-454.410) (-456.039) (-453.503) [-453.666] * [-454.034] (-453.949) (-454.763) (-457.755) -- 0:00:52
173500 -- (-456.444) (-457.234) [-456.952] (-453.965) * [-453.509] (-455.997) (-454.055) (-457.186) -- 0:00:52
174000 -- (-455.884) [-453.648] (-460.014) (-454.245) * (-454.011) (-454.826) [-454.610] (-460.791) -- 0:00:52
174500 -- [-453.356] (-455.613) (-454.910) (-460.897) * [-454.325] (-453.297) (-456.325) (-454.448) -- 0:00:52
175000 -- (-453.406) (-455.170) (-454.286) [-453.565] * [-453.837] (-452.894) (-457.269) (-453.583) -- 0:00:51
Average standard deviation of split frequencies: 0.015283
175500 -- [-457.271] (-455.048) (-452.760) (-454.787) * (-456.596) [-454.747] (-458.284) (-454.128) -- 0:00:51
176000 -- (-458.609) (-460.013) (-452.851) [-453.336] * [-457.043] (-453.752) (-453.419) (-454.172) -- 0:00:51
176500 -- [-454.498] (-457.169) (-453.602) (-455.914) * (-454.361) (-459.300) [-452.938] (-454.160) -- 0:00:51
177000 -- (-453.411) (-456.608) [-453.689] (-454.692) * [-454.062] (-458.231) (-456.546) (-455.523) -- 0:00:51
177500 -- (-457.064) (-454.366) (-452.958) [-454.295] * (-457.733) [-454.588] (-457.166) (-455.160) -- 0:00:50
178000 -- (-453.339) (-455.811) (-452.548) [-453.843] * (-454.473) (-453.433) (-452.958) [-453.195] -- 0:00:50
178500 -- [-452.777] (-455.677) (-455.024) (-453.699) * [-455.079] (-455.826) (-454.041) (-453.694) -- 0:00:50
179000 -- (-457.851) [-454.960] (-455.689) (-455.752) * (-454.738) (-453.023) (-454.580) [-454.599] -- 0:00:50
179500 -- (-455.853) (-457.244) (-453.349) [-453.087] * (-454.271) (-453.864) (-454.592) [-454.416] -- 0:00:50
180000 -- (-456.799) (-458.553) [-452.863] (-457.419) * (-453.861) [-457.786] (-455.985) (-454.339) -- 0:00:50
Average standard deviation of split frequencies: 0.015518
180500 -- (-454.102) [-457.549] (-453.592) (-456.719) * (-457.757) (-456.412) (-456.204) [-455.708] -- 0:00:49
181000 -- (-459.377) (-456.335) [-453.716] (-454.275) * (-453.556) (-454.123) (-456.742) [-455.851] -- 0:00:49
181500 -- (-456.738) (-455.294) (-457.730) [-458.031] * (-458.966) [-454.057] (-460.669) (-455.089) -- 0:00:49
182000 -- [-455.513] (-453.951) (-453.277) (-455.306) * (-456.411) [-454.095] (-456.343) (-453.788) -- 0:00:49
182500 -- (-456.522) (-454.903) (-453.781) [-453.579] * (-455.890) [-455.540] (-453.875) (-453.822) -- 0:00:49
183000 -- (-453.752) [-453.408] (-453.778) (-456.403) * (-459.269) [-453.533] (-454.790) (-454.994) -- 0:00:49
183500 -- (-454.595) (-454.307) [-454.677] (-455.871) * [-454.749] (-455.256) (-454.080) (-458.687) -- 0:00:48
184000 -- (-454.677) [-455.490] (-454.141) (-455.522) * (-452.546) [-453.155] (-453.438) (-453.516) -- 0:00:48
184500 -- [-453.907] (-456.161) (-455.814) (-453.963) * [-453.133] (-456.303) (-453.481) (-452.962) -- 0:00:48
185000 -- [-454.195] (-456.343) (-454.811) (-456.181) * [-453.204] (-454.210) (-453.257) (-456.588) -- 0:00:48
Average standard deviation of split frequencies: 0.015607
185500 -- [-454.343] (-456.124) (-456.538) (-458.292) * (-454.265) (-457.329) [-453.657] (-454.639) -- 0:00:48
186000 -- (-454.174) (-453.021) [-453.180] (-454.537) * [-455.093] (-456.368) (-459.530) (-454.936) -- 0:00:52
186500 -- [-456.144] (-452.546) (-453.604) (-456.537) * (-454.924) [-453.159] (-453.854) (-455.501) -- 0:00:52
187000 -- (-458.067) [-452.704] (-457.350) (-454.381) * (-454.135) (-457.179) [-455.224] (-454.453) -- 0:00:52
187500 -- (-455.378) [-456.707] (-455.405) (-455.606) * (-456.179) (-454.825) (-456.433) [-455.573] -- 0:00:52
188000 -- (-454.171) [-456.661] (-453.197) (-462.551) * (-454.490) (-456.619) (-454.361) [-454.301] -- 0:00:51
188500 -- (-453.349) (-453.068) [-452.822] (-457.103) * (-452.772) [-453.852] (-453.622) (-455.644) -- 0:00:51
189000 -- (-454.001) [-452.852] (-457.989) (-454.840) * (-453.591) (-456.720) (-453.150) [-457.452] -- 0:00:51
189500 -- [-454.538] (-453.173) (-459.896) (-455.808) * (-454.396) [-456.539] (-452.714) (-458.717) -- 0:00:51
190000 -- (-460.706) (-453.659) (-455.089) [-454.455] * (-454.498) (-456.207) [-454.206] (-458.008) -- 0:00:51
Average standard deviation of split frequencies: 0.015796
190500 -- (-460.254) (-453.593) [-455.162] (-453.271) * (-454.117) (-456.059) (-454.993) [-454.883] -- 0:00:50
191000 -- (-462.739) (-454.038) (-461.657) [-454.529] * (-454.920) (-454.369) (-454.863) [-456.540] -- 0:00:50
191500 -- (-453.731) (-455.640) [-456.503] (-455.349) * (-453.642) [-455.451] (-456.401) (-453.466) -- 0:00:50
192000 -- (-455.390) (-456.160) (-454.964) [-452.738] * [-452.802] (-453.371) (-453.344) (-453.893) -- 0:00:50
192500 -- (-456.874) [-456.717] (-455.746) (-455.829) * (-454.064) (-456.089) [-454.048] (-453.557) -- 0:00:50
193000 -- (-457.175) (-454.742) [-456.547] (-455.272) * (-456.364) [-458.775] (-453.992) (-455.131) -- 0:00:50
193500 -- (-454.524) (-454.369) (-457.973) [-454.496] * [-455.131] (-462.605) (-459.381) (-455.926) -- 0:00:50
194000 -- (-454.980) (-458.269) [-453.183] (-458.225) * [-455.550] (-453.132) (-459.447) (-453.225) -- 0:00:49
194500 -- (-454.524) (-458.225) [-460.233] (-454.732) * (-453.333) (-454.483) (-453.673) [-454.096] -- 0:00:49
195000 -- (-456.268) (-460.856) [-454.770] (-457.927) * (-454.321) (-458.025) [-455.270] (-452.606) -- 0:00:49
Average standard deviation of split frequencies: 0.015280
195500 -- (-453.996) [-458.818] (-455.118) (-457.437) * (-454.302) (-457.183) [-454.447] (-453.478) -- 0:00:49
196000 -- (-453.509) (-455.579) [-453.688] (-457.730) * [-454.290] (-458.318) (-454.457) (-453.856) -- 0:00:49
196500 -- (-453.588) (-454.869) (-453.282) [-454.857] * [-455.390] (-454.256) (-454.605) (-453.013) -- 0:00:49
197000 -- (-452.983) (-453.709) (-457.481) [-452.919] * (-456.475) (-455.997) (-454.643) [-454.128] -- 0:00:48
197500 -- (-457.171) (-453.729) (-455.758) [-454.923] * [-453.269] (-456.317) (-454.490) (-452.852) -- 0:00:48
198000 -- (-455.781) (-453.341) [-456.773] (-455.551) * (-453.759) (-454.372) (-455.100) [-453.462] -- 0:00:48
198500 -- (-459.169) (-454.545) (-458.679) [-455.474] * (-456.144) (-456.170) [-453.946] (-454.166) -- 0:00:48
199000 -- [-456.059] (-455.979) (-456.064) (-454.246) * (-454.539) [-454.844] (-456.435) (-454.177) -- 0:00:48
199500 -- (-457.319) [-453.880] (-454.418) (-456.077) * (-454.515) (-455.252) (-457.030) [-454.286] -- 0:00:48
200000 -- (-455.783) (-454.256) [-463.133] (-453.549) * (-456.061) (-453.943) (-454.681) [-454.429] -- 0:00:48
Average standard deviation of split frequencies: 0.016859
200500 -- [-453.648] (-454.356) (-455.243) (-453.897) * (-453.476) (-460.501) [-454.971] (-454.178) -- 0:00:47
201000 -- [-456.452] (-452.773) (-460.501) (-453.768) * [-455.139] (-454.569) (-457.464) (-459.269) -- 0:00:47
201500 -- (-459.947) (-454.696) (-459.106) [-453.589] * (-456.879) (-458.164) [-455.944] (-458.330) -- 0:00:47
202000 -- [-456.041] (-454.761) (-454.676) (-457.649) * (-455.867) [-455.882] (-453.905) (-458.173) -- 0:00:47
202500 -- (-459.002) [-457.573] (-453.390) (-454.166) * (-454.951) (-454.943) [-453.310] (-460.471) -- 0:00:47
203000 -- [-453.945] (-456.859) (-456.327) (-459.313) * [-453.997] (-453.747) (-454.123) (-455.209) -- 0:00:51
203500 -- [-453.447] (-459.204) (-453.061) (-453.196) * (-453.733) (-453.695) [-454.349] (-453.150) -- 0:00:50
204000 -- [-453.093] (-454.003) (-455.805) (-456.783) * [-453.217] (-455.173) (-452.549) (-454.091) -- 0:00:50
204500 -- (-454.559) [-454.684] (-452.953) (-453.413) * [-452.589] (-457.003) (-453.551) (-452.663) -- 0:00:50
205000 -- (-455.424) [-457.600] (-455.311) (-453.199) * [-454.691] (-454.756) (-453.779) (-453.825) -- 0:00:50
Average standard deviation of split frequencies: 0.016557
205500 -- (-456.324) [-458.629] (-452.933) (-455.889) * (-459.272) (-454.959) (-454.866) [-455.176] -- 0:00:50
206000 -- [-456.223] (-455.742) (-457.372) (-455.337) * (-455.674) (-455.471) (-455.326) [-452.734] -- 0:00:50
206500 -- (-459.260) (-460.246) [-454.716] (-454.193) * [-456.137] (-454.486) (-456.006) (-454.442) -- 0:00:49
207000 -- (-456.775) (-457.164) (-453.711) [-455.873] * (-456.143) (-457.188) [-454.634] (-460.005) -- 0:00:49
207500 -- [-454.379] (-454.482) (-453.411) (-456.237) * [-457.181] (-459.119) (-455.325) (-453.918) -- 0:00:49
208000 -- (-454.419) [-453.546] (-454.545) (-454.318) * (-454.831) (-455.614) (-454.344) [-455.263] -- 0:00:49
208500 -- [-455.771] (-453.697) (-456.994) (-455.731) * (-460.836) [-456.234] (-454.639) (-454.953) -- 0:00:49
209000 -- (-455.180) (-454.517) (-454.975) [-454.072] * (-458.041) (-454.103) [-454.831] (-455.600) -- 0:00:49
209500 -- (-458.901) (-454.265) (-454.828) [-457.099] * (-457.418) [-453.392] (-457.020) (-456.743) -- 0:00:49
210000 -- [-454.337] (-457.674) (-457.113) (-455.979) * (-458.940) [-455.002] (-455.195) (-454.843) -- 0:00:48
Average standard deviation of split frequencies: 0.015532
210500 -- (-455.591) (-454.662) (-456.459) [-460.033] * (-453.161) (-455.319) (-456.486) [-453.940] -- 0:00:48
211000 -- [-454.841] (-455.192) (-454.350) (-453.212) * (-453.505) [-456.787] (-455.528) (-457.370) -- 0:00:48
211500 -- [-453.486] (-454.481) (-455.201) (-457.225) * (-454.613) (-457.255) (-454.342) [-453.282] -- 0:00:48
212000 -- (-455.574) [-454.938] (-454.545) (-457.249) * (-458.485) [-454.230] (-456.231) (-455.257) -- 0:00:48
212500 -- (-454.191) (-459.890) (-455.226) [-454.228] * [-453.304] (-453.935) (-452.952) (-458.083) -- 0:00:48
213000 -- (-457.589) (-452.921) (-455.082) [-453.783] * (-454.835) [-454.702] (-454.118) (-457.120) -- 0:00:48
213500 -- (-458.774) [-452.570] (-457.043) (-454.245) * [-454.926] (-454.961) (-454.224) (-453.875) -- 0:00:47
214000 -- (-456.859) [-452.675] (-455.527) (-455.680) * (-454.652) [-454.360] (-457.831) (-453.672) -- 0:00:47
214500 -- (-457.797) (-453.307) [-454.531] (-453.661) * (-454.203) (-455.008) (-454.907) [-453.141] -- 0:00:47
215000 -- (-452.994) (-452.712) (-452.897) [-452.451] * [-453.867] (-453.547) (-455.997) (-455.654) -- 0:00:47
Average standard deviation of split frequencies: 0.014507
215500 -- [-455.720] (-455.483) (-453.757) (-456.005) * [-455.686] (-456.096) (-454.901) (-453.794) -- 0:00:47
216000 -- [-453.336] (-453.823) (-453.965) (-459.432) * [-456.094] (-455.938) (-454.199) (-452.847) -- 0:00:47
216500 -- [-456.163] (-453.807) (-455.192) (-455.337) * [-453.623] (-454.466) (-453.249) (-454.287) -- 0:00:47
217000 -- [-453.998] (-454.230) (-454.598) (-454.891) * (-455.750) [-452.590] (-453.998) (-453.285) -- 0:00:46
217500 -- [-453.038] (-456.237) (-454.403) (-453.998) * (-455.478) (-455.406) [-452.987] (-454.037) -- 0:00:46
218000 -- (-454.219) (-456.819) (-457.965) [-453.757] * (-454.820) (-455.501) [-453.603] (-453.146) -- 0:00:46
218500 -- (-455.529) [-455.224] (-455.125) (-455.856) * (-457.331) (-453.395) (-454.069) [-459.680] -- 0:00:46
219000 -- (-454.746) (-456.221) [-455.316] (-453.854) * (-456.127) [-453.374] (-453.527) (-454.455) -- 0:00:46
219500 -- (-455.055) (-455.117) (-453.083) [-455.623] * (-453.638) [-458.330] (-454.631) (-455.239) -- 0:00:46
220000 -- (-454.956) (-454.113) (-452.977) [-454.862] * (-454.224) [-454.411] (-456.188) (-455.265) -- 0:00:49
Average standard deviation of split frequencies: 0.013949
220500 -- [-455.511] (-453.978) (-454.866) (-453.420) * (-453.782) [-453.621] (-455.918) (-455.084) -- 0:00:49
221000 -- [-456.076] (-454.545) (-458.123) (-453.075) * (-454.655) (-453.173) (-454.044) [-453.671] -- 0:00:49
221500 -- (-454.857) [-452.594] (-455.139) (-455.036) * (-458.365) [-453.748] (-456.295) (-453.222) -- 0:00:49
222000 -- (-456.893) [-454.636] (-457.562) (-454.810) * (-453.805) (-453.977) (-455.984) [-454.488] -- 0:00:49
222500 -- [-452.796] (-452.537) (-456.662) (-454.468) * (-453.593) [-454.196] (-456.853) (-453.686) -- 0:00:48
223000 -- (-457.994) (-453.482) [-452.991] (-453.994) * (-453.661) (-455.592) (-460.224) [-453.356] -- 0:00:48
223500 -- (-457.338) (-453.506) [-453.042] (-456.261) * (-457.515) (-455.365) (-457.076) [-455.956] -- 0:00:48
224000 -- (-456.271) (-453.236) [-458.550] (-455.122) * [-453.800] (-458.671) (-454.928) (-455.047) -- 0:00:48
224500 -- (-454.347) [-455.571] (-456.902) (-453.262) * (-454.933) (-455.351) [-452.680] (-455.768) -- 0:00:48
225000 -- (-452.423) (-455.179) (-453.655) [-454.723] * (-453.152) (-459.291) [-454.878] (-459.356) -- 0:00:48
Average standard deviation of split frequencies: 0.014233
225500 -- (-453.776) (-455.855) (-454.710) [-454.807] * (-456.639) (-454.947) [-455.806] (-458.933) -- 0:00:48
226000 -- (-455.150) [-454.538] (-454.085) (-453.138) * [-456.141] (-454.731) (-453.857) (-456.751) -- 0:00:47
226500 -- (-452.925) (-454.763) (-454.429) [-453.298] * [-454.835] (-452.793) (-455.664) (-455.567) -- 0:00:47
227000 -- [-455.927] (-459.673) (-454.639) (-454.490) * (-453.982) [-453.132] (-456.009) (-453.833) -- 0:00:47
227500 -- (-455.316) (-453.652) (-454.073) [-453.699] * (-454.386) (-456.954) [-453.187] (-454.022) -- 0:00:47
228000 -- (-454.101) (-454.852) (-452.515) [-454.732] * (-455.230) (-454.156) (-453.951) [-455.236] -- 0:00:47
228500 -- (-454.358) (-452.864) [-455.327] (-455.584) * (-454.390) (-454.909) (-454.664) [-455.184] -- 0:00:47
229000 -- (-452.702) (-454.044) [-453.172] (-457.922) * (-453.464) (-456.092) (-454.930) [-455.734] -- 0:00:47
229500 -- (-452.674) [-453.169] (-458.066) (-456.816) * (-454.461) [-458.735] (-457.223) (-454.767) -- 0:00:47
230000 -- (-454.181) (-454.291) [-453.691] (-452.822) * (-456.448) (-453.303) [-456.837] (-457.457) -- 0:00:46
Average standard deviation of split frequencies: 0.012262
230500 -- [-453.921] (-452.770) (-457.089) (-454.681) * (-457.622) (-459.076) (-454.843) [-458.386] -- 0:00:46
231000 -- [-454.989] (-455.040) (-453.313) (-454.512) * (-456.385) [-455.476] (-452.811) (-455.569) -- 0:00:46
231500 -- [-453.310] (-454.335) (-456.774) (-454.519) * (-455.296) (-455.210) (-453.828) [-455.012] -- 0:00:46
232000 -- (-455.306) (-455.252) (-454.364) [-453.757] * (-455.072) (-460.024) (-453.898) [-452.805] -- 0:00:46
232500 -- (-454.587) (-453.239) [-455.131] (-452.760) * (-453.877) [-453.652] (-454.554) (-454.444) -- 0:00:46
233000 -- (-452.470) [-453.005] (-453.885) (-455.306) * (-454.030) (-453.707) [-453.960] (-454.372) -- 0:00:46
233500 -- [-452.860] (-456.585) (-454.886) (-454.599) * (-456.830) [-455.959] (-455.008) (-453.436) -- 0:00:45
234000 -- (-455.155) (-456.036) [-453.664] (-455.197) * (-457.157) (-453.563) (-455.351) [-456.119] -- 0:00:45
234500 -- [-453.033] (-453.224) (-452.668) (-469.412) * (-453.823) [-458.675] (-454.816) (-457.980) -- 0:00:45
235000 -- [-455.493] (-457.327) (-454.688) (-463.987) * [-457.251] (-453.460) (-454.776) (-456.588) -- 0:00:45
Average standard deviation of split frequencies: 0.011735
235500 -- (-459.509) [-455.191] (-455.199) (-454.856) * (-454.599) (-454.944) (-454.672) [-454.928] -- 0:00:45
236000 -- (-459.778) (-454.558) [-457.116] (-454.642) * (-456.202) (-454.327) (-453.159) [-455.469] -- 0:00:45
236500 -- (-456.449) (-454.623) (-455.161) [-455.116] * (-453.780) (-453.896) [-453.335] (-455.681) -- 0:00:45
237000 -- (-454.186) (-454.676) [-457.115] (-455.783) * (-454.169) (-453.323) [-454.034] (-455.391) -- 0:00:48
237500 -- (-453.979) (-457.514) [-453.970] (-454.039) * (-453.105) (-452.756) (-457.040) [-456.987] -- 0:00:48
238000 -- [-452.949] (-455.973) (-457.073) (-456.104) * (-456.971) (-455.103) (-454.247) [-453.697] -- 0:00:48
238500 -- (-456.473) [-454.399] (-454.587) (-457.671) * (-454.741) (-454.584) [-453.298] (-453.365) -- 0:00:47
239000 -- (-456.231) (-457.201) (-456.364) [-452.618] * (-454.286) (-453.018) [-454.458] (-452.729) -- 0:00:47
239500 -- (-455.038) [-452.549] (-455.175) (-453.574) * [-456.089] (-454.310) (-456.477) (-453.337) -- 0:00:47
240000 -- (-455.404) (-453.450) (-454.202) [-453.495] * (-455.549) (-453.282) (-457.295) [-455.077] -- 0:00:47
Average standard deviation of split frequencies: 0.012120
240500 -- (-459.680) [-454.205] (-453.688) (-458.880) * (-453.664) (-453.321) [-452.665] (-453.782) -- 0:00:47
241000 -- (-452.926) (-456.392) (-454.293) [-456.732] * (-455.162) (-453.770) [-453.299] (-455.585) -- 0:00:47
241500 -- (-455.689) (-455.895) (-453.791) [-454.645] * (-455.991) (-453.558) (-455.922) [-455.389] -- 0:00:47
242000 -- (-453.699) (-454.792) [-453.435] (-457.476) * [-456.189] (-453.967) (-457.017) (-455.488) -- 0:00:46
242500 -- (-453.308) [-453.567] (-453.609) (-457.162) * (-456.311) (-454.468) (-455.537) [-452.994] -- 0:00:46
243000 -- (-452.998) (-458.483) [-456.489] (-458.211) * (-460.373) (-457.248) [-453.268] (-455.936) -- 0:00:46
243500 -- (-457.834) [-453.238] (-454.159) (-455.955) * [-453.770] (-453.528) (-454.088) (-456.476) -- 0:00:46
244000 -- [-453.660] (-454.182) (-454.514) (-457.444) * (-453.756) [-453.124] (-454.011) (-457.682) -- 0:00:46
244500 -- (-453.002) (-455.064) [-454.477] (-455.146) * (-455.774) (-453.796) (-455.897) [-454.069] -- 0:00:46
245000 -- (-456.327) (-454.433) [-453.598] (-455.531) * (-453.153) [-453.404] (-459.791) (-456.124) -- 0:00:46
Average standard deviation of split frequencies: 0.010483
245500 -- (-455.218) [-454.682] (-457.967) (-453.748) * (-456.055) [-453.869] (-454.672) (-454.709) -- 0:00:46
246000 -- [-453.359] (-453.970) (-455.655) (-453.900) * [-454.196] (-457.534) (-456.422) (-458.202) -- 0:00:45
246500 -- (-456.146) (-453.795) (-454.028) [-453.747] * (-454.818) [-458.203] (-453.251) (-453.924) -- 0:00:45
247000 -- (-456.737) (-454.726) (-454.772) [-457.076] * (-454.561) (-455.904) (-452.772) [-453.134] -- 0:00:45
247500 -- [-452.956] (-454.975) (-456.220) (-453.740) * (-455.643) [-456.517] (-454.871) (-453.457) -- 0:00:45
248000 -- (-453.249) (-456.082) (-456.111) [-453.481] * [-456.271] (-453.914) (-456.868) (-454.002) -- 0:00:45
248500 -- (-453.917) (-456.532) (-459.307) [-456.966] * (-454.204) (-454.899) (-454.751) [-454.377] -- 0:00:45
249000 -- (-455.516) [-454.674] (-453.908) (-455.804) * (-457.864) [-456.143] (-455.212) (-453.598) -- 0:00:45
249500 -- [-455.826] (-455.171) (-454.299) (-455.905) * (-457.059) [-455.805] (-455.663) (-455.800) -- 0:00:45
250000 -- [-462.455] (-459.225) (-455.075) (-453.618) * [-453.314] (-469.059) (-454.666) (-456.222) -- 0:00:45
Average standard deviation of split frequencies: 0.011388
250500 -- [-455.885] (-455.416) (-457.435) (-457.120) * [-453.345] (-454.183) (-454.887) (-452.915) -- 0:00:44
251000 -- [-457.582] (-454.290) (-455.246) (-455.450) * (-455.181) (-454.312) [-458.851] (-454.604) -- 0:00:44
251500 -- (-453.299) (-454.316) [-454.499] (-454.096) * (-456.964) (-452.962) [-454.083] (-454.738) -- 0:00:44
252000 -- (-453.516) (-454.309) (-454.722) [-455.046] * [-456.444] (-453.049) (-462.339) (-457.435) -- 0:00:44
252500 -- (-452.996) [-453.045] (-452.973) (-454.911) * (-457.605) [-453.875] (-454.583) (-454.496) -- 0:00:44
253000 -- (-454.987) [-453.849] (-456.490) (-454.454) * (-455.506) [-454.824] (-455.000) (-461.149) -- 0:00:44
253500 -- (-455.085) (-458.090) [-455.226] (-458.292) * (-454.724) [-454.586] (-454.969) (-454.876) -- 0:00:44
254000 -- (-457.051) [-457.264] (-454.615) (-454.463) * (-454.382) [-454.635] (-454.958) (-458.978) -- 0:00:46
254500 -- (-456.840) (-455.434) (-460.615) [-455.012] * (-454.986) [-457.021] (-457.125) (-454.766) -- 0:00:46
255000 -- (-455.236) (-456.680) (-455.587) [-453.994] * (-455.998) (-454.832) [-454.098] (-455.673) -- 0:00:46
Average standard deviation of split frequencies: 0.011157
255500 -- (-454.019) [-453.784] (-458.733) (-453.211) * (-455.987) [-454.907] (-455.195) (-458.024) -- 0:00:46
256000 -- (-454.285) [-454.638] (-456.790) (-458.847) * (-454.329) [-453.180] (-453.691) (-455.111) -- 0:00:46
256500 -- (-453.549) (-454.945) [-455.097] (-457.099) * (-456.296) (-457.409) [-452.869] (-453.454) -- 0:00:46
257000 -- (-454.268) (-453.951) [-453.745] (-457.930) * [-453.714] (-455.038) (-458.524) (-453.044) -- 0:00:46
257500 -- (-454.146) [-453.469] (-459.755) (-452.977) * (-453.296) (-457.352) [-459.760] (-455.117) -- 0:00:46
258000 -- (-453.276) (-455.097) [-455.257] (-456.151) * (-453.214) (-454.794) [-453.986] (-456.081) -- 0:00:46
258500 -- [-455.522] (-459.259) (-453.884) (-457.742) * [-454.620] (-456.199) (-456.062) (-455.053) -- 0:00:45
259000 -- (-454.461) (-454.916) (-455.006) [-456.076] * [-455.469] (-454.704) (-458.217) (-453.833) -- 0:00:45
259500 -- (-455.084) (-454.012) [-456.628] (-453.713) * [-454.893] (-455.631) (-453.943) (-455.278) -- 0:00:45
260000 -- [-452.472] (-455.494) (-458.067) (-454.129) * (-453.195) (-455.561) [-454.000] (-457.366) -- 0:00:45
Average standard deviation of split frequencies: 0.012659
260500 -- [-456.997] (-455.182) (-454.379) (-456.934) * [-453.802] (-453.256) (-453.794) (-455.569) -- 0:00:45
261000 -- [-459.397] (-461.096) (-452.815) (-456.074) * (-455.228) (-456.775) [-454.273] (-457.376) -- 0:00:45
261500 -- (-457.214) (-454.730) [-455.957] (-455.487) * (-454.338) (-453.860) (-457.667) [-453.349] -- 0:00:45
262000 -- [-459.926] (-454.060) (-453.366) (-459.566) * [-453.030] (-452.537) (-453.973) (-454.654) -- 0:00:45
262500 -- (-454.777) [-456.651] (-454.098) (-454.532) * (-454.817) (-456.503) [-453.977] (-455.870) -- 0:00:44
263000 -- (-454.567) [-454.647] (-453.422) (-454.882) * (-452.925) [-453.251] (-456.291) (-456.423) -- 0:00:44
263500 -- (-459.007) [-454.202] (-454.079) (-452.821) * (-452.818) [-453.821] (-455.584) (-455.547) -- 0:00:44
264000 -- (-458.007) [-455.334] (-456.105) (-453.872) * (-455.722) (-453.656) [-454.709] (-456.704) -- 0:00:44
264500 -- [-457.006] (-455.514) (-456.539) (-458.913) * (-456.795) (-455.718) (-452.735) [-453.699] -- 0:00:44
265000 -- [-455.388] (-453.981) (-453.545) (-457.629) * (-454.773) (-454.150) [-454.328] (-455.684) -- 0:00:44
Average standard deviation of split frequencies: 0.013390
265500 -- [-453.367] (-454.506) (-455.809) (-457.951) * (-455.411) [-453.709] (-459.681) (-452.686) -- 0:00:44
266000 -- [-456.125] (-454.896) (-455.880) (-458.065) * (-452.596) [-454.726] (-453.685) (-454.805) -- 0:00:44
266500 -- (-453.658) (-452.872) [-453.654] (-456.048) * (-453.581) [-454.979] (-453.835) (-453.525) -- 0:00:44
267000 -- (-456.744) (-454.661) (-455.000) [-453.816] * [-456.582] (-454.250) (-454.165) (-453.217) -- 0:00:43
267500 -- (-454.627) [-456.169] (-454.576) (-453.890) * [-455.825] (-463.405) (-453.546) (-453.581) -- 0:00:43
268000 -- [-455.770] (-453.743) (-459.768) (-458.676) * [-455.493] (-458.115) (-455.128) (-456.323) -- 0:00:43
268500 -- (-453.003) [-454.863] (-453.297) (-453.291) * (-454.846) (-452.714) (-454.519) [-453.692] -- 0:00:43
269000 -- (-459.935) [-454.106] (-452.958) (-454.193) * (-455.285) [-453.059] (-456.978) (-456.594) -- 0:00:43
269500 -- [-454.818] (-453.321) (-454.808) (-456.266) * [-454.507] (-452.976) (-457.192) (-458.942) -- 0:00:43
270000 -- (-458.574) (-456.676) [-458.077] (-452.780) * (-454.861) [-454.793] (-456.055) (-456.061) -- 0:00:43
Average standard deviation of split frequencies: 0.012869
270500 -- (-457.019) (-454.199) [-453.098] (-453.182) * (-456.016) [-455.289] (-455.188) (-456.253) -- 0:00:43
271000 -- (-456.553) (-455.665) [-454.054] (-453.061) * [-454.626] (-455.841) (-461.390) (-455.337) -- 0:00:45
271500 -- [-454.796] (-452.854) (-453.578) (-453.584) * (-458.975) [-457.073] (-455.457) (-455.374) -- 0:00:45
272000 -- [-454.132] (-454.868) (-454.582) (-455.039) * (-454.398) (-452.664) [-453.880] (-453.963) -- 0:00:45
272500 -- [-454.581] (-455.859) (-454.857) (-455.734) * (-452.895) [-455.156] (-453.888) (-456.055) -- 0:00:45
273000 -- (-452.863) [-454.114] (-454.244) (-454.778) * (-455.960) (-453.100) [-454.499] (-454.091) -- 0:00:45
273500 -- (-454.585) (-454.453) [-454.306] (-454.250) * (-454.385) (-455.614) (-453.334) [-457.485] -- 0:00:45
274000 -- (-453.313) (-456.673) (-453.181) [-452.861] * (-455.922) (-452.913) [-457.948] (-456.405) -- 0:00:45
274500 -- (-457.344) (-454.996) (-454.201) [-452.990] * (-454.066) (-454.745) [-453.002] (-453.524) -- 0:00:44
275000 -- (-453.750) (-453.508) (-452.539) [-453.048] * (-453.995) (-454.398) [-453.367] (-456.064) -- 0:00:44
Average standard deviation of split frequencies: 0.013284
275500 -- [-454.843] (-453.555) (-452.611) (-454.727) * (-453.570) (-455.284) (-454.899) [-456.135] -- 0:00:44
276000 -- (-454.129) (-452.883) (-456.503) [-452.729] * [-455.686] (-454.602) (-453.038) (-455.760) -- 0:00:44
276500 -- (-458.101) (-453.921) [-454.671] (-452.942) * [-456.762] (-456.364) (-456.115) (-459.072) -- 0:00:44
277000 -- (-456.555) (-455.698) (-455.933) [-459.443] * (-459.404) [-458.057] (-452.984) (-460.302) -- 0:00:44
277500 -- (-456.373) [-455.741] (-453.905) (-458.315) * [-456.005] (-453.706) (-455.667) (-459.162) -- 0:00:44
278000 -- [-460.501] (-453.629) (-454.302) (-455.462) * (-456.500) [-460.452] (-458.558) (-454.348) -- 0:00:44
278500 -- [-457.571] (-457.843) (-454.614) (-457.690) * (-453.064) (-456.936) (-453.176) [-452.835] -- 0:00:44
279000 -- (-454.513) (-453.476) (-457.691) [-453.286] * (-454.636) (-453.560) [-453.831] (-456.242) -- 0:00:43
279500 -- (-453.987) [-456.347] (-455.234) (-453.117) * (-454.461) (-453.925) [-453.543] (-453.871) -- 0:00:43
280000 -- (-454.710) (-453.614) (-454.908) [-453.282] * (-455.994) (-455.638) (-454.963) [-456.940] -- 0:00:43
Average standard deviation of split frequencies: 0.011757
280500 -- [-453.826] (-452.832) (-457.325) (-453.557) * (-454.217) [-454.684] (-455.822) (-454.800) -- 0:00:43
281000 -- (-454.704) (-455.629) [-453.741] (-452.672) * (-453.812) [-454.645] (-455.578) (-455.217) -- 0:00:43
281500 -- (-453.023) (-453.785) [-455.663] (-454.253) * (-457.823) (-454.483) [-454.113] (-455.094) -- 0:00:43
282000 -- (-457.239) [-454.947] (-453.447) (-455.496) * (-454.730) [-454.894] (-458.478) (-458.433) -- 0:00:43
282500 -- (-454.619) [-453.626] (-454.007) (-453.919) * [-453.181] (-454.676) (-454.070) (-460.845) -- 0:00:43
283000 -- (-455.119) (-460.894) (-459.153) [-456.056] * (-453.865) [-454.983] (-455.959) (-460.138) -- 0:00:43
283500 -- (-456.416) [-455.343] (-457.206) (-454.257) * (-452.924) [-454.252] (-454.620) (-453.983) -- 0:00:42
284000 -- (-454.609) (-454.744) [-456.385] (-454.120) * [-455.721] (-452.841) (-455.430) (-454.058) -- 0:00:42
284500 -- [-455.473] (-455.161) (-454.643) (-455.178) * [-454.647] (-453.852) (-453.397) (-453.112) -- 0:00:42
285000 -- (-453.509) (-455.641) [-453.008] (-454.301) * (-453.406) (-456.364) (-454.953) [-452.726] -- 0:00:42
Average standard deviation of split frequencies: 0.013380
285500 -- [-457.178] (-458.793) (-455.016) (-459.590) * (-455.943) (-457.012) [-457.451] (-455.097) -- 0:00:42
286000 -- (-455.214) [-456.002] (-454.234) (-458.128) * (-463.210) (-458.382) (-457.195) [-453.345] -- 0:00:42
286500 -- (-456.309) (-459.384) (-463.712) [-457.689] * (-463.804) (-455.996) (-453.375) [-453.156] -- 0:00:42
287000 -- (-454.618) (-456.055) (-455.217) [-455.218] * (-456.696) (-453.892) (-459.313) [-452.857] -- 0:00:42
287500 -- (-455.089) (-454.844) [-453.518] (-456.536) * (-455.810) [-453.893] (-460.541) (-453.277) -- 0:00:42
288000 -- (-455.448) [-453.311] (-454.985) (-454.880) * [-455.359] (-455.318) (-456.273) (-456.447) -- 0:00:44
288500 -- (-455.538) (-454.655) [-455.581] (-453.291) * [-453.711] (-455.036) (-456.812) (-454.929) -- 0:00:44
289000 -- [-455.324] (-455.328) (-454.654) (-454.935) * (-455.102) (-454.575) (-453.137) [-453.674] -- 0:00:44
289500 -- (-454.570) (-454.584) (-460.467) [-459.493] * (-454.165) [-454.975] (-454.097) (-456.257) -- 0:00:44
290000 -- (-456.669) [-453.414] (-456.395) (-454.308) * (-453.707) (-457.422) [-453.604] (-453.745) -- 0:00:44
Average standard deviation of split frequencies: 0.012688
290500 -- (-454.045) [-454.104] (-455.657) (-454.060) * [-456.380] (-454.041) (-455.259) (-453.773) -- 0:00:43
291000 -- (-457.492) (-454.099) [-455.092] (-453.060) * (-457.395) (-455.680) [-457.241] (-458.657) -- 0:00:43
291500 -- (-454.848) (-456.708) (-457.189) [-455.374] * (-453.788) [-454.588] (-456.647) (-455.297) -- 0:00:43
292000 -- [-453.951] (-457.532) (-456.129) (-453.611) * [-454.102] (-455.151) (-455.033) (-456.213) -- 0:00:43
292500 -- (-454.498) (-458.122) [-453.000] (-455.505) * (-454.261) (-454.112) (-455.015) [-456.075] -- 0:00:43
293000 -- (-459.892) (-456.839) (-456.865) [-453.074] * (-455.563) (-453.866) [-454.532] (-455.269) -- 0:00:43
293500 -- [-452.865] (-452.701) (-453.896) (-454.559) * (-453.309) (-456.028) [-456.446] (-454.719) -- 0:00:43
294000 -- (-455.909) (-453.694) [-454.412] (-456.345) * (-453.545) [-454.321] (-454.100) (-454.893) -- 0:00:43
294500 -- (-453.515) (-452.764) [-458.203] (-454.365) * (-456.943) (-458.195) (-454.721) [-452.730] -- 0:00:43
295000 -- [-454.409] (-453.176) (-457.533) (-455.173) * [-456.522] (-455.669) (-454.347) (-455.660) -- 0:00:43
Average standard deviation of split frequencies: 0.010849
295500 -- (-453.351) [-456.703] (-455.798) (-455.849) * (-456.453) (-455.315) [-452.580] (-457.454) -- 0:00:42
296000 -- [-455.194] (-454.447) (-455.752) (-455.062) * (-454.164) [-454.632] (-454.283) (-453.901) -- 0:00:42
296500 -- [-459.778] (-453.919) (-455.805) (-456.907) * (-454.629) (-454.904) [-453.160] (-456.305) -- 0:00:42
297000 -- (-457.361) [-456.985] (-456.671) (-453.307) * (-455.749) (-455.705) (-454.794) [-454.010] -- 0:00:42
297500 -- (-454.157) (-454.828) (-454.834) [-456.513] * (-456.202) (-453.895) (-456.322) [-453.944] -- 0:00:42
298000 -- (-454.959) [-452.735] (-453.247) (-455.853) * (-456.866) (-453.578) [-454.282] (-459.911) -- 0:00:42
298500 -- [-455.504] (-457.644) (-453.391) (-456.125) * [-455.740] (-453.898) (-453.968) (-457.595) -- 0:00:42
299000 -- (-456.027) [-453.294] (-455.274) (-453.997) * (-456.307) (-454.458) (-455.539) [-454.104] -- 0:00:42
299500 -- (-454.111) [-452.923] (-456.669) (-456.278) * (-457.291) [-453.799] (-452.685) (-454.260) -- 0:00:42
300000 -- (-452.804) (-452.971) [-454.279] (-462.521) * (-457.719) [-452.926] (-458.380) (-454.628) -- 0:00:42
Average standard deviation of split frequencies: 0.009407
300500 -- [-454.155] (-454.344) (-454.341) (-456.235) * [-455.438] (-455.890) (-461.636) (-454.951) -- 0:00:41
301000 -- (-453.592) (-453.800) (-453.820) [-456.010] * [-456.091] (-456.524) (-453.262) (-454.587) -- 0:00:41
301500 -- (-454.772) (-455.355) (-455.323) [-457.226] * (-456.408) [-453.196] (-458.388) (-454.174) -- 0:00:41
302000 -- [-457.765] (-456.280) (-455.203) (-456.763) * (-454.709) (-454.334) [-456.964] (-458.316) -- 0:00:41
302500 -- [-452.957] (-454.389) (-453.995) (-457.669) * (-454.621) (-454.834) (-460.083) [-454.384] -- 0:00:41
303000 -- (-454.358) (-458.652) [-458.351] (-455.616) * [-453.372] (-454.769) (-453.738) (-454.468) -- 0:00:41
303500 -- (-457.764) (-459.010) [-454.630] (-456.447) * [-453.009] (-454.362) (-459.830) (-454.433) -- 0:00:41
304000 -- (-457.080) (-457.097) [-453.438] (-457.686) * (-453.683) (-454.101) (-459.801) [-453.746] -- 0:00:41
304500 -- (-454.018) (-456.785) (-453.635) [-457.831] * (-454.980) [-453.545] (-456.721) (-456.705) -- 0:00:41
305000 -- [-453.488] (-455.114) (-453.775) (-453.492) * (-456.885) (-455.779) [-454.689] (-454.336) -- 0:00:43
Average standard deviation of split frequencies: 0.009628
305500 -- (-454.051) (-458.027) (-453.573) [-454.294] * (-456.547) (-454.862) [-454.878] (-455.923) -- 0:00:43
306000 -- (-453.816) [-452.993] (-456.136) (-454.819) * [-454.236] (-455.477) (-453.784) (-455.792) -- 0:00:43
306500 -- (-453.662) (-454.253) [-454.502] (-453.641) * [-456.132] (-455.145) (-457.343) (-453.956) -- 0:00:42
307000 -- [-454.564] (-456.000) (-454.094) (-453.463) * (-453.313) (-453.345) [-454.286] (-457.008) -- 0:00:42
307500 -- (-454.867) [-452.938] (-454.959) (-454.746) * [-452.868] (-455.202) (-457.543) (-455.870) -- 0:00:42
308000 -- (-455.572) (-452.820) (-454.230) [-452.626] * [-456.554] (-456.833) (-455.289) (-454.024) -- 0:00:42
308500 -- (-453.941) (-452.983) [-454.086] (-452.726) * (-454.583) (-452.955) (-455.357) [-455.342] -- 0:00:42
309000 -- (-454.446) [-454.119] (-453.165) (-454.657) * (-455.376) (-453.078) [-455.460] (-455.020) -- 0:00:42
309500 -- (-456.228) (-457.868) (-453.926) [-454.536] * [-453.577] (-455.737) (-455.246) (-456.329) -- 0:00:42
310000 -- [-455.906] (-456.841) (-455.637) (-456.077) * (-456.342) [-458.711] (-455.579) (-453.067) -- 0:00:42
Average standard deviation of split frequencies: 0.010432
310500 -- (-455.949) (-454.017) (-455.472) [-453.412] * (-459.566) (-459.212) [-455.854] (-456.470) -- 0:00:42
311000 -- (-453.622) [-453.585] (-453.531) (-454.614) * (-455.119) (-460.143) [-453.646] (-455.618) -- 0:00:42
311500 -- (-454.777) (-455.525) (-454.306) [-453.433] * (-455.082) (-453.374) (-453.795) [-454.815] -- 0:00:41
312000 -- (-454.436) [-455.030] (-454.368) (-456.000) * [-454.362] (-457.192) (-457.450) (-454.354) -- 0:00:41
312500 -- [-454.166] (-453.761) (-458.322) (-461.914) * [-453.315] (-459.900) (-457.505) (-458.958) -- 0:00:41
313000 -- (-454.422) [-453.268] (-456.980) (-455.819) * (-456.245) (-454.370) (-458.557) [-453.436] -- 0:00:41
313500 -- (-457.289) (-459.955) [-453.396] (-453.087) * (-454.367) (-455.005) [-453.194] (-454.664) -- 0:00:41
314000 -- [-455.392] (-454.973) (-453.908) (-452.519) * (-456.856) (-456.017) [-453.991] (-455.524) -- 0:00:41
314500 -- [-456.706] (-455.782) (-456.467) (-455.071) * (-455.489) (-455.096) [-454.032] (-454.881) -- 0:00:41
315000 -- (-457.825) (-455.863) (-457.370) [-455.784] * [-458.664] (-454.500) (-453.329) (-455.543) -- 0:00:41
Average standard deviation of split frequencies: 0.011375
315500 -- (-454.260) (-453.644) [-453.903] (-454.438) * [-454.733] (-453.767) (-457.607) (-453.044) -- 0:00:41
316000 -- (-453.042) (-454.112) (-453.269) [-453.027] * [-456.639] (-457.057) (-458.721) (-455.010) -- 0:00:41
316500 -- (-454.328) (-457.708) (-455.684) [-455.823] * [-453.357] (-455.196) (-455.839) (-456.033) -- 0:00:41
317000 -- (-455.756) [-455.514] (-454.123) (-459.474) * (-454.263) (-454.521) (-453.540) [-453.510] -- 0:00:40
317500 -- (-456.356) (-456.610) [-454.959] (-453.856) * [-453.259] (-455.030) (-455.116) (-452.945) -- 0:00:40
318000 -- (-457.596) (-459.572) (-456.186) [-454.411] * (-454.365) [-453.182] (-455.525) (-453.460) -- 0:00:40
318500 -- (-458.368) (-455.614) (-456.828) [-456.205] * (-457.993) [-453.587] (-453.871) (-455.974) -- 0:00:40
319000 -- [-454.415] (-456.920) (-453.519) (-453.188) * [-453.759] (-454.226) (-453.508) (-455.237) -- 0:00:40
319500 -- (-454.016) (-454.593) (-453.638) [-453.676] * [-454.224] (-454.221) (-457.344) (-454.989) -- 0:00:40
320000 -- (-456.259) (-453.591) (-456.347) [-453.104] * (-453.451) (-454.893) [-455.681] (-455.086) -- 0:00:40
Average standard deviation of split frequencies: 0.011669
320500 -- (-452.746) [-453.885] (-458.497) (-454.924) * [-453.046] (-457.536) (-459.390) (-455.107) -- 0:00:40
321000 -- (-452.762) [-452.676] (-454.701) (-454.959) * (-453.437) [-457.210] (-460.598) (-460.108) -- 0:00:40
321500 -- (-453.614) (-452.635) (-453.019) [-454.363] * (-454.094) (-454.325) (-458.204) [-454.593] -- 0:00:40
322000 -- (-455.278) (-455.317) (-453.028) [-454.337] * (-453.443) [-454.436] (-456.819) (-453.150) -- 0:00:42
322500 -- [-457.105] (-455.510) (-460.977) (-454.008) * (-455.512) (-453.181) [-454.265] (-456.323) -- 0:00:42
323000 -- (-457.537) (-453.822) [-453.527] (-455.587) * (-452.520) (-453.611) [-453.212] (-455.048) -- 0:00:41
323500 -- [-454.041] (-457.725) (-456.730) (-455.997) * (-456.289) (-455.028) [-456.928] (-456.403) -- 0:00:41
324000 -- (-455.862) (-458.209) [-456.029] (-456.066) * (-454.878) [-453.821] (-454.539) (-453.907) -- 0:00:41
324500 -- (-456.966) (-455.407) (-457.674) [-453.544] * (-453.786) (-456.644) (-455.588) [-454.538] -- 0:00:41
325000 -- (-457.185) (-456.098) (-455.762) [-453.340] * [-454.159] (-455.368) (-453.786) (-454.436) -- 0:00:41
Average standard deviation of split frequencies: 0.011387
325500 -- (-455.093) (-458.341) [-454.236] (-453.174) * (-456.658) [-455.780] (-453.550) (-455.671) -- 0:00:41
326000 -- (-455.698) (-454.956) [-454.632] (-455.034) * (-455.179) (-455.704) (-453.730) [-455.430] -- 0:00:41
326500 -- (-455.343) (-455.443) (-458.355) [-454.151] * (-454.929) (-457.678) (-453.840) [-454.612] -- 0:00:41
327000 -- [-453.521] (-458.366) (-452.843) (-454.320) * (-455.188) [-457.055] (-453.378) (-454.824) -- 0:00:41
327500 -- [-455.213] (-456.894) (-458.768) (-454.227) * (-455.928) (-454.297) (-454.899) [-452.914] -- 0:00:41
328000 -- [-454.802] (-455.970) (-453.894) (-455.592) * (-456.878) (-453.306) (-458.801) [-452.984] -- 0:00:40
328500 -- [-456.504] (-454.546) (-453.109) (-454.948) * (-454.270) (-454.301) [-455.488] (-455.240) -- 0:00:40
329000 -- (-454.858) [-454.116] (-459.526) (-457.285) * (-455.602) (-454.216) (-454.407) [-453.026] -- 0:00:40
329500 -- (-453.937) (-454.734) (-455.331) [-456.772] * (-455.486) [-456.863] (-453.140) (-454.070) -- 0:00:40
330000 -- (-459.432) [-457.376] (-459.016) (-454.064) * [-453.555] (-454.359) (-453.417) (-455.337) -- 0:00:40
Average standard deviation of split frequencies: 0.011761
330500 -- (-455.739) [-454.268] (-454.408) (-454.028) * (-456.183) [-456.347] (-454.013) (-456.139) -- 0:00:40
331000 -- (-455.188) (-454.205) (-452.772) [-458.003] * (-455.663) (-454.753) [-453.304] (-454.148) -- 0:00:40
331500 -- (-455.825) (-453.399) [-452.719] (-454.511) * (-458.199) [-456.307] (-454.202) (-457.259) -- 0:00:40
332000 -- [-457.259] (-454.160) (-452.898) (-454.463) * (-457.577) (-454.511) [-453.489] (-459.578) -- 0:00:40
332500 -- (-459.191) [-455.277] (-454.673) (-455.395) * [-455.062] (-453.981) (-453.543) (-457.991) -- 0:00:40
333000 -- (-459.408) (-453.729) (-454.491) [-452.990] * (-454.876) (-453.930) [-454.149] (-456.133) -- 0:00:40
333500 -- (-459.355) [-454.493] (-455.684) (-452.851) * [-453.801] (-452.671) (-453.586) (-453.746) -- 0:00:39
334000 -- (-457.046) (-454.060) [-454.469] (-455.425) * (-455.223) (-454.371) (-456.934) [-454.355] -- 0:00:39
334500 -- (-453.103) (-454.470) (-455.267) [-456.489] * [-454.699] (-458.873) (-455.493) (-452.750) -- 0:00:39
335000 -- (-454.423) (-457.984) [-453.486] (-456.377) * (-456.725) [-453.961] (-461.124) (-452.882) -- 0:00:39
Average standard deviation of split frequencies: 0.012890
335500 -- [-455.052] (-453.610) (-459.042) (-455.681) * (-453.248) (-453.270) (-457.339) [-454.541] -- 0:00:39
336000 -- (-454.643) [-455.263] (-460.505) (-455.303) * (-456.438) (-456.118) [-454.645] (-467.899) -- 0:00:39
336500 -- (-453.782) [-453.265] (-456.038) (-453.751) * (-456.067) [-454.616] (-454.933) (-456.236) -- 0:00:39
337000 -- (-454.468) [-454.245] (-454.835) (-453.634) * [-455.151] (-454.394) (-455.932) (-453.504) -- 0:00:39
337500 -- (-456.715) (-453.424) [-456.516] (-455.963) * [-454.326] (-456.222) (-454.779) (-453.401) -- 0:00:39
338000 -- [-453.738] (-457.273) (-454.456) (-455.273) * (-454.388) (-456.706) [-453.634] (-454.648) -- 0:00:39
338500 -- (-453.770) (-453.492) [-457.052] (-454.941) * (-454.042) (-458.183) (-454.146) [-455.312] -- 0:00:39
339000 -- (-457.165) (-457.404) (-455.399) [-452.928] * (-457.839) (-455.621) [-454.782] (-453.276) -- 0:00:40
339500 -- (-455.830) (-454.348) (-455.408) [-453.293] * [-455.304] (-453.953) (-455.227) (-464.687) -- 0:00:40
340000 -- (-457.801) (-455.112) (-454.254) [-454.623] * [-453.778] (-459.508) (-457.112) (-458.002) -- 0:00:40
Average standard deviation of split frequencies: 0.013059
340500 -- (-455.325) [-457.613] (-459.692) (-454.724) * (-454.685) (-453.471) (-453.900) [-456.949] -- 0:00:40
341000 -- [-459.413] (-457.701) (-454.127) (-453.649) * [-453.038] (-461.157) (-453.452) (-458.610) -- 0:00:40
341500 -- (-453.777) (-452.993) (-455.911) [-453.229] * [-454.141] (-455.446) (-453.680) (-456.292) -- 0:00:40
342000 -- (-452.871) (-456.470) (-455.881) [-455.169] * (-454.902) [-455.928] (-453.912) (-456.260) -- 0:00:40
342500 -- (-453.028) (-455.036) (-453.736) [-452.430] * (-454.770) [-454.761] (-454.539) (-455.782) -- 0:00:40
343000 -- (-453.988) (-453.747) (-453.844) [-452.776] * (-454.192) (-455.827) (-455.791) [-458.932] -- 0:00:40
343500 -- [-455.905] (-454.433) (-453.815) (-453.202) * (-454.233) [-455.681] (-462.283) (-452.819) -- 0:00:40
344000 -- (-455.179) (-454.369) (-454.734) [-456.124] * (-456.448) [-455.278] (-458.581) (-453.504) -- 0:00:40
344500 -- (-456.210) [-455.128] (-454.226) (-457.213) * (-456.637) (-453.319) (-455.977) [-452.891] -- 0:00:39
345000 -- (-453.264) [-458.641] (-456.336) (-454.492) * (-455.269) (-457.620) (-456.417) [-454.478] -- 0:00:39
Average standard deviation of split frequencies: 0.012262
345500 -- (-453.359) (-453.369) (-454.278) [-454.322] * [-454.690] (-453.929) (-453.947) (-455.635) -- 0:00:39
346000 -- (-453.917) (-456.921) (-455.355) [-453.473] * (-454.270) (-455.702) (-453.534) [-456.264] -- 0:00:39
346500 -- (-455.498) [-455.933] (-458.746) (-452.521) * [-452.645] (-452.841) (-455.160) (-454.030) -- 0:00:39
347000 -- (-454.107) [-456.549] (-455.815) (-452.868) * (-453.656) (-454.390) (-456.169) [-455.192] -- 0:00:39
347500 -- (-453.495) (-456.264) (-455.532) [-454.786] * (-455.832) (-456.381) [-455.831] (-455.491) -- 0:00:39
348000 -- (-455.695) (-454.603) [-456.609] (-461.128) * (-453.135) [-455.848] (-454.702) (-455.403) -- 0:00:39
348500 -- (-454.834) [-455.234] (-453.505) (-455.097) * (-456.540) (-452.864) [-453.454] (-454.683) -- 0:00:39
349000 -- (-456.368) (-460.350) (-454.782) [-454.140] * (-455.363) (-455.563) [-458.106] (-453.223) -- 0:00:39
349500 -- (-455.064) (-458.320) [-453.253] (-455.311) * (-455.213) [-453.535] (-455.734) (-454.954) -- 0:00:39
350000 -- (-455.591) [-454.937] (-452.620) (-454.560) * (-454.346) (-453.873) (-462.695) [-455.182] -- 0:00:39
Average standard deviation of split frequencies: 0.011343
350500 -- (-455.835) [-456.624] (-455.682) (-455.148) * (-454.895) (-456.112) [-453.480] (-459.240) -- 0:00:38
351000 -- [-453.321] (-453.890) (-456.011) (-453.376) * (-454.046) (-453.752) [-454.290] (-460.098) -- 0:00:38
351500 -- (-454.178) (-457.190) (-456.055) [-456.455] * (-455.303) (-453.611) [-455.652] (-459.789) -- 0:00:38
352000 -- [-457.077] (-455.890) (-457.567) (-457.361) * (-455.173) (-454.080) [-453.658] (-455.770) -- 0:00:38
352500 -- [-457.729] (-454.657) (-455.039) (-454.498) * (-454.733) (-456.676) [-453.029] (-453.662) -- 0:00:38
353000 -- (-455.265) (-457.039) [-455.291] (-453.488) * (-453.808) (-453.730) [-457.407] (-452.715) -- 0:00:38
353500 -- (-454.454) (-458.895) [-454.350] (-454.836) * (-452.605) (-453.203) (-455.800) [-453.044] -- 0:00:38
354000 -- [-455.479] (-458.329) (-455.619) (-458.235) * (-456.997) (-453.318) (-458.361) [-455.034] -- 0:00:38
354500 -- (-457.626) (-457.917) (-453.832) [-454.218] * (-458.466) (-454.723) [-453.392] (-454.981) -- 0:00:38
355000 -- [-453.787] (-453.573) (-453.888) (-455.065) * (-455.339) (-453.460) (-456.168) [-454.631] -- 0:00:38
Average standard deviation of split frequencies: 0.011338
355500 -- [-454.028] (-454.524) (-454.544) (-457.994) * [-454.884] (-454.341) (-455.018) (-454.028) -- 0:00:38
356000 -- (-453.754) [-454.150] (-452.990) (-454.381) * (-456.222) [-454.304] (-454.058) (-458.429) -- 0:00:39
356500 -- (-455.560) (-454.543) [-455.451] (-463.156) * (-457.049) (-454.060) [-453.441] (-455.027) -- 0:00:39
357000 -- (-454.317) (-452.953) [-456.416] (-457.340) * (-457.586) (-455.986) [-456.098] (-455.640) -- 0:00:39
357500 -- (-456.245) [-452.880] (-455.534) (-453.890) * (-457.750) (-453.963) [-455.290] (-454.617) -- 0:00:39
358000 -- (-453.633) (-454.137) [-453.757] (-453.832) * (-456.557) [-453.414] (-455.931) (-455.273) -- 0:00:39
358500 -- (-454.707) (-453.026) (-453.508) [-452.895] * [-454.422] (-456.567) (-457.108) (-454.264) -- 0:00:39
359000 -- (-453.798) (-453.748) (-456.145) [-454.102] * [-455.240] (-455.647) (-453.339) (-454.919) -- 0:00:39
359500 -- (-455.116) (-453.643) [-456.765] (-452.981) * (-453.756) (-453.143) [-454.194] (-455.668) -- 0:00:39
360000 -- (-459.746) (-454.168) (-453.815) [-452.534] * (-459.219) (-454.399) [-453.311] (-454.201) -- 0:00:39
Average standard deviation of split frequencies: 0.010048
360500 -- (-459.783) (-456.910) (-454.457) [-454.910] * [-457.117] (-454.169) (-457.727) (-453.597) -- 0:00:39
361000 -- (-456.290) (-453.102) [-454.093] (-457.351) * (-453.774) (-457.001) [-456.713] (-455.748) -- 0:00:38
361500 -- (-457.611) (-454.246) [-454.112] (-454.162) * (-452.639) (-455.773) (-453.876) [-454.650] -- 0:00:38
362000 -- (-453.678) (-456.275) (-453.257) [-452.651] * (-452.375) (-454.042) (-457.214) [-454.024] -- 0:00:38
362500 -- (-459.561) (-459.311) [-455.533] (-453.409) * (-454.345) (-455.933) [-453.104] (-455.570) -- 0:00:38
363000 -- (-453.450) (-454.575) [-453.258] (-456.359) * [-454.325] (-454.648) (-453.790) (-455.529) -- 0:00:38
363500 -- (-454.188) (-453.309) (-456.776) [-452.999] * [-452.462] (-454.162) (-453.650) (-453.765) -- 0:00:38
364000 -- (-455.761) (-453.448) [-455.978] (-454.682) * (-454.545) (-454.984) (-453.526) [-455.768] -- 0:00:38
364500 -- [-454.419] (-453.411) (-455.458) (-456.177) * (-455.591) (-456.684) [-456.329] (-456.634) -- 0:00:38
365000 -- [-454.073] (-454.632) (-455.523) (-459.509) * (-456.882) (-454.829) (-456.531) [-453.925] -- 0:00:38
Average standard deviation of split frequencies: 0.009177
365500 -- (-455.646) (-455.753) (-454.330) [-453.358] * (-456.987) [-454.017] (-454.064) (-458.149) -- 0:00:38
366000 -- (-455.412) (-455.588) (-453.247) [-454.403] * (-454.470) (-454.020) [-455.157] (-454.845) -- 0:00:38
366500 -- (-452.900) (-456.398) [-453.121] (-455.616) * [-453.143] (-458.395) (-453.877) (-454.997) -- 0:00:38
367000 -- (-454.729) [-454.725] (-453.754) (-456.380) * (-452.571) (-457.620) (-455.316) [-456.075] -- 0:00:37
367500 -- (-456.897) (-455.718) [-454.539] (-454.243) * (-452.944) (-456.151) (-458.206) [-453.348] -- 0:00:37
368000 -- (-453.767) (-453.815) [-453.313] (-457.684) * (-454.578) [-455.836] (-454.074) (-453.142) -- 0:00:37
368500 -- [-454.585] (-459.151) (-452.688) (-457.723) * (-457.319) [-456.677] (-454.028) (-453.568) -- 0:00:37
369000 -- (-456.108) (-453.833) (-455.026) [-455.223] * (-455.876) [-453.216] (-455.402) (-456.578) -- 0:00:37
369500 -- [-454.828] (-455.520) (-454.340) (-454.539) * (-454.277) (-455.919) (-455.371) [-454.559] -- 0:00:37
370000 -- [-455.943] (-454.541) (-455.015) (-453.908) * (-457.474) (-457.859) [-453.205] (-453.709) -- 0:00:37
Average standard deviation of split frequencies: 0.009141
370500 -- [-453.895] (-455.169) (-458.812) (-454.904) * [-455.354] (-453.292) (-456.856) (-454.733) -- 0:00:37
371000 -- (-453.149) (-458.568) (-457.107) [-453.777] * (-455.355) (-457.130) (-456.570) [-457.985] -- 0:00:37
371500 -- (-453.819) (-457.066) [-454.081] (-452.951) * [-453.702] (-454.611) (-458.680) (-457.565) -- 0:00:37
372000 -- (-454.303) [-456.399] (-458.762) (-457.922) * (-454.958) [-454.752] (-455.161) (-453.990) -- 0:00:38
372500 -- (-454.474) [-459.382] (-454.196) (-460.548) * (-454.951) (-454.196) [-457.879] (-454.988) -- 0:00:38
373000 -- [-453.271] (-455.130) (-455.323) (-459.025) * [-457.375] (-456.623) (-454.441) (-456.365) -- 0:00:38
373500 -- [-452.718] (-453.472) (-452.658) (-454.535) * (-456.667) (-456.297) (-453.799) [-455.289] -- 0:00:38
374000 -- (-458.260) (-455.220) [-457.726] (-454.623) * (-458.272) (-453.067) (-455.820) [-452.977] -- 0:00:38
374500 -- (-453.159) [-457.335] (-453.800) (-455.553) * (-455.202) [-454.465] (-459.160) (-452.628) -- 0:00:38
375000 -- [-454.420] (-457.382) (-454.817) (-454.583) * (-454.816) (-454.408) (-454.863) [-455.153] -- 0:00:38
Average standard deviation of split frequencies: 0.010343
375500 -- (-454.319) [-457.094] (-463.706) (-453.476) * [-454.332] (-454.041) (-453.437) (-455.221) -- 0:00:38
376000 -- (-456.068) (-457.370) (-456.280) [-454.451] * (-460.210) (-454.760) (-455.917) [-454.070] -- 0:00:38
376500 -- [-452.960] (-455.984) (-455.807) (-455.467) * (-460.380) [-455.001] (-455.056) (-457.608) -- 0:00:38
377000 -- (-453.751) (-457.167) (-452.906) [-454.753] * (-454.918) (-453.430) [-455.134] (-456.294) -- 0:00:38
377500 -- [-454.809] (-457.570) (-453.395) (-454.468) * (-458.717) (-453.650) (-457.289) [-455.358] -- 0:00:37
378000 -- (-454.544) (-455.904) (-453.532) [-457.926] * (-453.269) (-454.132) [-454.966] (-453.744) -- 0:00:37
378500 -- (-454.291) (-457.650) (-456.547) [-454.869] * (-453.155) (-454.777) (-454.135) [-454.126] -- 0:00:37
379000 -- (-456.761) [-454.651] (-457.557) (-454.450) * (-453.895) (-454.993) (-455.877) [-453.940] -- 0:00:37
379500 -- (-455.104) [-453.698] (-456.501) (-460.773) * (-454.676) [-453.445] (-455.410) (-454.593) -- 0:00:37
380000 -- (-454.288) (-453.882) [-454.993] (-457.886) * (-457.021) [-453.630] (-454.908) (-454.573) -- 0:00:37
Average standard deviation of split frequencies: 0.009752
380500 -- (-458.832) (-457.080) [-453.861] (-456.237) * [-458.406] (-453.432) (-453.134) (-454.932) -- 0:00:37
381000 -- (-455.655) [-455.785] (-453.498) (-456.523) * (-455.781) (-453.274) (-454.287) [-455.614] -- 0:00:37
381500 -- (-456.722) (-456.053) (-458.481) [-457.033] * (-458.444) [-454.652] (-457.697) (-453.351) -- 0:00:37
382000 -- (-453.368) (-456.191) (-456.701) [-455.686] * [-456.655] (-453.650) (-454.650) (-455.942) -- 0:00:37
382500 -- [-455.184] (-454.804) (-458.408) (-454.077) * (-461.534) (-455.262) (-455.207) [-456.516] -- 0:00:37
383000 -- (-453.427) (-456.914) [-453.668] (-454.886) * (-454.526) [-454.787] (-455.138) (-453.543) -- 0:00:37
383500 -- (-453.791) [-453.849] (-454.677) (-456.428) * (-454.394) (-453.824) [-452.864] (-456.849) -- 0:00:36
384000 -- (-454.979) (-459.954) [-457.928] (-455.722) * [-456.347] (-453.785) (-457.551) (-454.876) -- 0:00:36
384500 -- [-453.299] (-456.293) (-455.467) (-456.744) * (-454.539) (-454.221) (-459.465) [-453.482] -- 0:00:36
385000 -- (-455.015) (-453.438) [-453.890] (-455.504) * (-453.601) (-454.450) (-457.068) [-453.869] -- 0:00:36
Average standard deviation of split frequencies: 0.011566
385500 -- (-456.389) [-453.508] (-454.160) (-462.238) * (-453.763) (-457.780) [-453.980] (-453.877) -- 0:00:36
386000 -- (-455.581) (-454.193) (-456.884) [-455.482] * (-453.359) (-454.886) (-455.636) [-454.504] -- 0:00:36
386500 -- [-455.787] (-455.350) (-455.768) (-455.579) * (-453.393) (-456.710) [-453.949] (-455.065) -- 0:00:36
387000 -- (-454.807) (-455.041) (-459.318) [-453.217] * [-454.451] (-456.095) (-453.119) (-457.643) -- 0:00:36
387500 -- (-454.024) (-456.835) (-454.563) [-455.112] * (-453.761) (-455.847) (-454.330) [-455.870] -- 0:00:36
388000 -- (-458.525) [-453.937] (-453.998) (-453.635) * (-453.865) (-455.258) (-454.195) [-452.932] -- 0:00:36
388500 -- (-453.597) (-456.723) [-453.681] (-454.173) * (-453.154) (-453.853) [-457.684] (-454.743) -- 0:00:37
389000 -- (-453.311) (-455.655) [-454.713] (-455.341) * (-459.639) (-452.955) [-454.067] (-454.445) -- 0:00:37
389500 -- [-456.273] (-454.343) (-453.864) (-456.800) * [-456.294] (-454.523) (-455.353) (-454.006) -- 0:00:37
390000 -- (-456.978) (-452.960) (-454.712) [-454.711] * (-460.605) [-453.746] (-459.856) (-454.674) -- 0:00:37
Average standard deviation of split frequencies: 0.011313
390500 -- (-453.091) (-453.944) [-454.052] (-456.765) * (-457.336) (-453.754) [-453.868] (-459.112) -- 0:00:37
391000 -- (-454.460) (-455.325) (-454.105) [-454.353] * (-454.948) (-454.337) [-453.793] (-457.497) -- 0:00:37
391500 -- (-456.298) (-455.612) [-454.622] (-454.321) * (-456.932) [-454.090] (-454.855) (-454.470) -- 0:00:37
392000 -- (-457.223) (-454.058) [-455.330] (-456.478) * [-453.856] (-452.914) (-453.757) (-459.164) -- 0:00:37
392500 -- (-456.232) [-455.564] (-454.656) (-453.605) * (-455.238) (-453.076) [-452.817] (-458.855) -- 0:00:37
393000 -- (-452.736) [-452.465] (-455.974) (-455.874) * (-455.287) (-454.084) (-453.495) [-456.674] -- 0:00:37
393500 -- (-454.133) (-453.099) (-454.396) [-455.746] * (-453.106) (-454.556) [-456.421] (-453.673) -- 0:00:36
394000 -- (-453.392) [-456.351] (-455.181) (-460.820) * [-453.220] (-454.220) (-455.194) (-453.050) -- 0:00:36
394500 -- (-456.200) (-455.859) [-453.403] (-460.881) * (-454.300) (-457.425) (-453.347) [-454.038] -- 0:00:36
395000 -- [-455.763] (-453.201) (-457.464) (-454.135) * [-453.074] (-454.507) (-458.067) (-454.590) -- 0:00:36
Average standard deviation of split frequencies: 0.011979
395500 -- (-453.533) [-456.130] (-455.996) (-455.541) * [-455.352] (-454.231) (-455.563) (-453.603) -- 0:00:36
396000 -- (-453.096) (-454.212) [-454.022] (-454.030) * (-458.899) (-454.517) [-453.477] (-454.322) -- 0:00:36
396500 -- (-452.785) (-453.727) [-452.912] (-452.528) * (-454.602) [-453.829] (-453.182) (-453.603) -- 0:00:36
397000 -- (-456.776) (-453.435) (-452.908) [-456.197] * (-456.254) [-463.108] (-456.539) (-453.964) -- 0:00:36
397500 -- (-458.914) (-454.722) [-452.717] (-456.466) * (-457.431) (-456.834) [-456.764] (-453.915) -- 0:00:36
398000 -- (-455.179) (-453.749) (-454.641) [-457.578] * [-455.748] (-453.253) (-454.521) (-453.939) -- 0:00:36
398500 -- (-456.308) (-454.540) [-453.881] (-455.872) * (-457.168) [-453.414] (-453.148) (-456.607) -- 0:00:36
399000 -- (-456.777) (-455.118) [-455.668] (-453.528) * (-455.043) [-453.946] (-452.740) (-454.587) -- 0:00:36
399500 -- (-454.650) (-455.291) (-456.794) [-454.053] * (-454.287) (-454.835) [-453.625] (-453.996) -- 0:00:36
400000 -- (-454.008) (-455.961) (-455.646) [-453.673] * (-457.464) (-456.100) [-452.863] (-452.439) -- 0:00:36
Average standard deviation of split frequencies: 0.011766
400500 -- (-453.919) [-455.853] (-455.052) (-452.533) * [-454.456] (-456.792) (-454.793) (-452.603) -- 0:00:35
401000 -- (-453.510) (-461.309) [-456.314] (-453.006) * (-454.501) [-453.098] (-452.902) (-454.044) -- 0:00:35
401500 -- (-454.796) (-455.015) [-452.949] (-455.351) * (-457.747) (-455.943) (-456.492) [-459.418] -- 0:00:35
402000 -- (-453.616) (-456.564) (-455.758) [-452.764] * (-456.619) (-456.827) (-463.163) [-454.286] -- 0:00:35
402500 -- (-453.492) (-455.030) [-454.152] (-454.920) * (-455.600) (-457.936) [-455.381] (-454.497) -- 0:00:35
403000 -- (-455.973) (-456.348) [-455.575] (-453.928) * (-457.071) [-454.112] (-455.267) (-458.815) -- 0:00:35
403500 -- [-453.840] (-454.349) (-456.491) (-456.123) * (-455.853) (-453.148) (-459.392) [-453.246] -- 0:00:35
404000 -- (-453.725) (-461.036) (-457.914) [-455.180] * (-457.692) (-455.310) [-456.456] (-457.217) -- 0:00:35
404500 -- (-454.768) (-452.821) (-453.663) [-457.908] * (-456.683) (-456.696) [-454.642] (-454.882) -- 0:00:35
405000 -- (-455.285) [-454.150] (-453.286) (-462.192) * (-456.779) (-457.594) [-453.525] (-454.246) -- 0:00:35
Average standard deviation of split frequencies: 0.011466
405500 -- (-453.447) (-454.134) [-457.156] (-455.911) * [-455.318] (-459.407) (-453.536) (-453.839) -- 0:00:36
406000 -- (-453.653) (-459.072) (-455.283) [-452.773] * (-455.897) [-453.693] (-455.776) (-453.417) -- 0:00:36
406500 -- [-453.828] (-454.810) (-453.949) (-452.634) * (-453.569) (-454.873) [-455.169] (-453.633) -- 0:00:36
407000 -- (-456.475) [-453.838] (-455.808) (-455.858) * (-458.597) (-455.748) (-457.386) [-453.014] -- 0:00:36
407500 -- [-454.093] (-452.863) (-456.609) (-455.527) * (-453.104) (-456.148) [-454.883] (-452.563) -- 0:00:36
408000 -- (-456.482) (-453.697) [-454.275] (-456.037) * (-457.996) (-454.640) (-453.588) [-455.678] -- 0:00:36
408500 -- (-457.188) (-453.812) [-457.462] (-454.192) * (-456.147) [-453.214] (-456.337) (-454.029) -- 0:00:36
409000 -- (-454.051) [-454.644] (-457.559) (-455.229) * (-457.495) [-453.217] (-457.607) (-452.640) -- 0:00:36
409500 -- (-455.811) (-456.019) (-455.385) [-457.677] * (-454.544) (-456.226) (-454.881) [-453.419] -- 0:00:36
410000 -- (-458.501) (-458.169) [-457.114] (-453.992) * (-453.396) (-455.800) (-455.826) [-454.176] -- 0:00:35
Average standard deviation of split frequencies: 0.012154
410500 -- (-454.357) (-464.195) (-456.591) [-453.931] * [-453.808] (-455.492) (-454.671) (-454.700) -- 0:00:35
411000 -- (-457.666) [-453.755] (-458.823) (-457.976) * (-453.728) [-454.257] (-455.018) (-454.862) -- 0:00:35
411500 -- (-454.263) [-453.274] (-463.061) (-456.825) * [-456.908] (-455.566) (-454.589) (-454.733) -- 0:00:35
412000 -- (-453.920) (-456.830) [-454.969] (-454.606) * [-454.735] (-453.006) (-455.703) (-453.060) -- 0:00:35
412500 -- [-454.142] (-454.292) (-453.698) (-453.433) * (-455.655) (-453.710) (-453.462) [-453.857] -- 0:00:35
413000 -- (-453.452) (-453.922) (-455.166) [-454.719] * [-452.683] (-453.688) (-455.396) (-453.717) -- 0:00:35
413500 -- (-453.378) (-454.438) [-455.975] (-454.438) * (-462.244) (-454.135) (-452.925) [-454.135] -- 0:00:35
414000 -- [-454.936] (-454.192) (-454.036) (-457.397) * (-454.809) [-453.530] (-453.713) (-455.638) -- 0:00:35
414500 -- (-454.582) [-458.054] (-454.323) (-460.239) * [-452.547] (-456.171) (-453.101) (-453.597) -- 0:00:35
415000 -- (-458.434) [-453.743] (-454.534) (-453.146) * [-454.717] (-452.608) (-453.347) (-455.592) -- 0:00:35
Average standard deviation of split frequencies: 0.011265
415500 -- (-453.648) [-454.823] (-453.629) (-456.261) * [-455.354] (-453.686) (-455.121) (-455.468) -- 0:00:35
416000 -- [-453.673] (-454.657) (-455.061) (-454.918) * (-453.111) [-456.981] (-455.205) (-454.744) -- 0:00:35
416500 -- [-453.737] (-453.366) (-456.952) (-454.618) * [-453.187] (-453.953) (-455.044) (-454.866) -- 0:00:35
417000 -- (-452.934) [-457.877] (-454.096) (-455.204) * (-456.762) (-453.479) (-460.901) [-453.448] -- 0:00:34
417500 -- (-453.423) [-455.592] (-454.087) (-453.869) * (-456.823) [-453.112] (-459.919) (-453.234) -- 0:00:34
418000 -- [-455.090] (-456.841) (-456.272) (-455.522) * (-454.780) [-453.230] (-456.096) (-455.336) -- 0:00:34
418500 -- (-455.205) [-453.898] (-456.121) (-455.245) * (-453.295) [-454.228] (-453.058) (-455.474) -- 0:00:34
419000 -- (-453.962) [-457.852] (-455.146) (-454.249) * (-454.358) (-455.121) (-457.782) [-458.262] -- 0:00:34
419500 -- (-453.915) [-453.520] (-455.754) (-457.237) * (-454.581) (-453.713) [-454.245] (-454.878) -- 0:00:34
420000 -- (-454.263) [-453.563] (-459.983) (-452.810) * [-453.282] (-455.712) (-455.961) (-456.307) -- 0:00:34
Average standard deviation of split frequencies: 0.010086
420500 -- [-453.042] (-455.894) (-458.394) (-455.104) * [-455.165] (-454.478) (-456.584) (-455.115) -- 0:00:34
421000 -- [-456.612] (-453.819) (-453.770) (-456.193) * (-453.887) (-454.186) [-457.152] (-457.785) -- 0:00:34
421500 -- [-454.310] (-455.847) (-457.989) (-456.046) * (-453.582) (-454.744) (-453.671) [-454.177] -- 0:00:34
422000 -- (-454.159) (-454.143) [-453.219] (-455.267) * (-455.061) [-458.364] (-453.845) (-456.678) -- 0:00:34
422500 -- (-456.762) (-454.940) [-452.774] (-454.466) * (-454.189) [-453.601] (-456.933) (-454.981) -- 0:00:35
423000 -- (-456.450) (-457.084) (-458.879) [-453.167] * [-453.779] (-454.975) (-455.349) (-454.708) -- 0:00:35
423500 -- [-460.677] (-454.192) (-453.593) (-460.069) * (-454.448) (-453.125) [-453.095] (-453.861) -- 0:00:35
424000 -- (-453.567) (-454.343) (-456.781) [-452.942] * [-453.161] (-456.625) (-453.720) (-453.419) -- 0:00:35
424500 -- (-456.074) (-453.807) (-454.730) [-456.583] * (-453.953) [-455.691] (-454.301) (-455.709) -- 0:00:35
425000 -- (-453.319) (-455.633) (-455.117) [-457.456] * (-454.568) [-454.195] (-453.783) (-454.516) -- 0:00:35
Average standard deviation of split frequencies: 0.009129
425500 -- (-455.405) (-462.459) [-455.710] (-453.168) * (-453.485) (-456.047) [-453.046] (-453.018) -- 0:00:35
426000 -- [-455.289] (-458.880) (-454.440) (-452.630) * (-456.748) (-457.828) (-452.842) [-453.744] -- 0:00:35
426500 -- (-455.818) (-454.741) (-456.293) [-455.512] * (-454.527) (-453.826) (-453.295) [-453.147] -- 0:00:34
427000 -- (-454.826) [-454.571] (-454.967) (-458.360) * (-456.381) (-456.255) (-456.449) [-453.716] -- 0:00:34
427500 -- (-455.374) [-453.508] (-454.745) (-455.745) * (-455.692) (-453.843) [-454.995] (-453.859) -- 0:00:34
428000 -- [-454.303] (-456.167) (-458.058) (-454.180) * (-453.324) (-453.539) [-453.968] (-456.542) -- 0:00:34
428500 -- (-455.438) (-454.775) (-458.081) [-456.677] * (-454.521) [-454.225] (-454.220) (-453.941) -- 0:00:34
429000 -- [-453.901] (-453.544) (-456.812) (-454.393) * (-459.402) (-457.655) [-453.871] (-456.548) -- 0:00:34
429500 -- (-455.021) (-453.050) (-459.534) [-455.331] * [-456.942] (-456.452) (-454.607) (-458.706) -- 0:00:34
430000 -- (-454.728) [-453.831] (-454.179) (-456.610) * [-452.962] (-455.486) (-455.886) (-456.631) -- 0:00:34
Average standard deviation of split frequencies: 0.009167
430500 -- [-453.594] (-458.019) (-454.484) (-455.438) * (-453.753) (-454.518) (-455.618) [-453.482] -- 0:00:34
431000 -- [-457.796] (-454.494) (-456.412) (-455.350) * (-455.998) (-458.079) (-455.497) [-454.007] -- 0:00:34
431500 -- (-454.811) [-453.682] (-457.384) (-456.448) * (-454.928) (-456.290) [-454.470] (-452.987) -- 0:00:34
432000 -- [-454.716] (-453.052) (-454.303) (-461.587) * (-455.438) (-454.227) [-453.892] (-454.260) -- 0:00:34
432500 -- (-454.112) (-455.655) (-453.991) [-457.024] * (-453.996) (-454.869) (-454.469) [-454.403] -- 0:00:34
433000 -- (-455.383) (-455.857) (-455.251) [-453.708] * (-455.406) (-458.697) [-458.092] (-454.014) -- 0:00:34
433500 -- (-453.574) (-455.955) [-452.753] (-453.439) * (-458.215) (-454.732) (-453.984) [-454.887] -- 0:00:33
434000 -- (-453.313) (-453.214) [-454.290] (-455.349) * [-453.936] (-455.605) (-454.169) (-458.857) -- 0:00:33
434500 -- (-453.419) (-453.995) [-453.883] (-458.024) * [-455.043] (-454.680) (-454.151) (-454.718) -- 0:00:33
435000 -- [-453.238] (-455.850) (-454.824) (-453.315) * (-454.632) (-455.652) [-453.719] (-453.684) -- 0:00:33
Average standard deviation of split frequencies: 0.008920
435500 -- (-456.743) (-457.454) (-456.069) [-453.375] * (-455.991) [-452.976] (-455.420) (-453.808) -- 0:00:33
436000 -- (-453.190) (-453.086) [-456.801] (-456.781) * (-456.122) (-455.964) [-453.796] (-454.956) -- 0:00:33
436500 -- (-455.785) [-458.403] (-455.740) (-457.802) * (-456.249) (-453.568) (-456.742) [-456.254] -- 0:00:33
437000 -- (-452.495) (-457.895) (-454.746) [-457.562] * [-457.516] (-455.567) (-459.751) (-457.268) -- 0:00:33
437500 -- (-452.609) [-456.983] (-453.487) (-457.442) * (-455.315) (-456.799) [-453.422] (-453.130) -- 0:00:33
438000 -- (-453.134) [-459.649] (-454.940) (-453.916) * (-458.238) (-458.041) (-457.102) [-454.962] -- 0:00:33
438500 -- (-453.658) (-453.266) [-455.177] (-454.508) * (-456.049) (-457.620) (-456.566) [-456.307] -- 0:00:33
439000 -- [-455.017] (-454.915) (-455.226) (-456.489) * (-454.240) (-454.888) [-455.458] (-456.068) -- 0:00:33
439500 -- (-456.687) [-453.238] (-452.539) (-455.420) * (-454.136) (-454.213) (-454.384) [-454.712] -- 0:00:34
440000 -- (-456.328) (-453.926) (-458.608) [-456.103] * (-458.410) (-457.879) (-455.921) [-454.263] -- 0:00:34
Average standard deviation of split frequencies: 0.009565
440500 -- (-454.667) (-453.461) [-452.622] (-454.167) * (-456.069) (-454.175) (-455.068) [-453.755] -- 0:00:34
441000 -- (-455.873) (-453.071) (-455.227) [-454.799] * (-456.445) [-454.465] (-453.676) (-455.440) -- 0:00:34
441500 -- (-453.384) (-453.300) (-452.802) [-453.263] * [-455.144] (-455.204) (-456.055) (-456.445) -- 0:00:34
442000 -- [-453.815] (-453.212) (-455.777) (-454.111) * [-454.635] (-454.030) (-453.756) (-455.927) -- 0:00:34
442500 -- [-453.729] (-453.272) (-454.719) (-455.032) * (-458.013) [-454.312] (-453.499) (-452.984) -- 0:00:34
443000 -- [-454.764] (-452.853) (-452.985) (-456.398) * (-453.842) (-454.704) (-456.162) [-456.605] -- 0:00:33
443500 -- (-452.840) (-457.937) [-455.118] (-453.546) * [-455.227] (-455.955) (-456.081) (-453.425) -- 0:00:33
444000 -- (-455.108) (-455.905) (-453.433) [-453.507] * (-453.714) [-452.934] (-455.020) (-464.501) -- 0:00:33
444500 -- (-453.090) (-459.378) [-453.341] (-452.816) * (-456.335) (-454.188) (-453.217) [-457.103] -- 0:00:33
445000 -- (-453.963) (-454.864) (-456.091) [-456.405] * (-457.320) (-455.462) [-454.004] (-455.346) -- 0:00:33
Average standard deviation of split frequencies: 0.009761
445500 -- [-456.084] (-453.703) (-456.804) (-454.448) * (-455.547) (-460.410) [-452.884] (-458.071) -- 0:00:33
446000 -- [-455.711] (-457.717) (-453.780) (-456.453) * (-458.269) (-455.883) (-454.039) [-457.509] -- 0:00:33
446500 -- (-453.713) (-454.764) [-454.304] (-458.695) * (-455.976) (-462.412) [-455.283] (-456.294) -- 0:00:33
447000 -- [-452.904] (-453.177) (-452.790) (-452.704) * (-456.844) (-456.410) (-454.611) [-455.225] -- 0:00:33
447500 -- (-452.959) [-460.909] (-456.792) (-453.216) * (-454.132) [-455.651] (-454.035) (-455.685) -- 0:00:33
448000 -- (-456.321) [-457.800] (-453.216) (-459.980) * (-454.334) (-454.991) [-453.799] (-454.128) -- 0:00:33
448500 -- [-455.505] (-457.984) (-455.114) (-455.177) * (-458.641) [-454.876] (-454.391) (-454.728) -- 0:00:33
449000 -- (-458.239) [-453.513] (-454.969) (-457.331) * (-454.110) (-456.827) [-453.258] (-454.183) -- 0:00:33
449500 -- [-454.403] (-459.076) (-455.910) (-453.657) * (-455.755) [-453.111] (-454.571) (-453.493) -- 0:00:33
450000 -- (-454.366) (-453.029) [-453.027] (-454.169) * (-453.062) (-453.174) (-453.153) [-455.428] -- 0:00:33
Average standard deviation of split frequencies: 0.009476
450500 -- [-454.313] (-456.558) (-453.913) (-456.052) * (-455.773) (-453.601) [-454.023] (-454.943) -- 0:00:32
451000 -- (-457.011) [-454.211] (-458.637) (-458.055) * (-454.629) (-455.830) [-453.063] (-455.327) -- 0:00:32
451500 -- (-457.051) (-460.848) [-456.786] (-456.842) * (-456.392) [-457.855] (-454.771) (-452.617) -- 0:00:32
452000 -- (-454.237) (-453.122) (-454.156) [-453.503] * (-455.712) (-455.993) (-455.550) [-455.323] -- 0:00:32
452500 -- (-455.617) [-458.455] (-457.146) (-454.086) * (-456.224) (-455.608) [-454.148] (-454.937) -- 0:00:32
453000 -- [-455.369] (-460.120) (-453.721) (-455.017) * [-455.006] (-456.383) (-456.858) (-456.965) -- 0:00:32
453500 -- (-458.003) (-454.098) (-454.440) [-456.562] * [-453.635] (-456.651) (-454.944) (-455.665) -- 0:00:32
454000 -- (-454.868) (-455.599) [-455.283] (-453.885) * (-453.393) [-455.215] (-456.530) (-455.187) -- 0:00:32
454500 -- (-453.478) [-457.353] (-453.245) (-457.844) * (-453.336) (-454.828) [-455.081] (-454.255) -- 0:00:32
455000 -- (-453.883) (-454.610) [-453.808] (-456.729) * [-453.548] (-460.061) (-454.895) (-455.823) -- 0:00:32
Average standard deviation of split frequencies: 0.008723
455500 -- [-455.018] (-463.185) (-455.351) (-455.720) * [-453.707] (-454.221) (-454.376) (-456.107) -- 0:00:32
456000 -- [-453.466] (-454.925) (-453.903) (-455.049) * (-455.604) (-458.744) [-455.619] (-458.302) -- 0:00:32
456500 -- (-454.940) (-453.736) (-455.168) [-454.787] * (-455.125) [-454.254] (-455.512) (-459.600) -- 0:00:33
457000 -- [-456.874] (-454.022) (-453.279) (-456.191) * (-456.818) (-454.706) [-454.301] (-455.980) -- 0:00:33
457500 -- (-455.009) (-453.619) [-454.234] (-454.086) * (-452.980) [-456.441] (-456.930) (-453.800) -- 0:00:33
458000 -- (-455.584) (-454.921) (-454.969) [-453.301] * (-453.150) (-454.558) (-455.737) [-454.052] -- 0:00:33
458500 -- (-452.764) (-455.344) (-454.057) [-453.781] * (-459.472) [-454.377] (-457.061) (-455.741) -- 0:00:33
459000 -- [-453.410] (-454.855) (-453.107) (-455.681) * (-458.378) [-454.218] (-455.756) (-453.852) -- 0:00:33
459500 -- [-453.447] (-457.930) (-454.741) (-454.748) * (-456.647) [-454.907] (-456.860) (-454.144) -- 0:00:32
460000 -- [-454.733] (-455.445) (-455.110) (-454.910) * (-453.953) [-453.685] (-455.192) (-455.036) -- 0:00:32
Average standard deviation of split frequencies: 0.008890
460500 -- (-454.490) [-455.482] (-454.186) (-459.334) * (-457.386) (-459.719) (-457.627) [-453.705] -- 0:00:32
461000 -- (-454.950) [-455.192] (-456.037) (-454.901) * (-456.358) [-458.424] (-458.462) (-453.058) -- 0:00:32
461500 -- (-456.105) (-457.090) (-455.180) [-456.152] * (-457.120) (-454.880) (-461.295) [-455.257] -- 0:00:32
462000 -- (-456.106) [-455.453] (-457.892) (-454.206) * (-453.710) (-456.894) (-456.364) [-455.161] -- 0:00:32
462500 -- (-457.291) (-455.188) (-454.966) [-453.261] * (-453.001) [-458.371] (-455.437) (-453.955) -- 0:00:32
463000 -- [-457.614] (-461.417) (-458.061) (-454.671) * (-457.571) [-453.884] (-453.552) (-454.661) -- 0:00:32
463500 -- [-452.980] (-458.640) (-456.798) (-453.589) * (-456.171) (-453.226) (-453.463) [-454.234] -- 0:00:32
464000 -- [-453.407] (-453.239) (-460.793) (-455.616) * (-456.086) (-454.269) (-452.799) [-453.587] -- 0:00:32
464500 -- [-453.353] (-452.600) (-454.380) (-453.644) * (-454.856) (-455.565) (-456.368) [-453.811] -- 0:00:32
465000 -- (-453.837) [-454.479] (-453.198) (-453.637) * (-454.953) (-454.881) (-455.087) [-454.506] -- 0:00:32
Average standard deviation of split frequencies: 0.008788
465500 -- (-455.803) (-454.227) [-454.028] (-453.385) * (-455.200) (-454.302) (-456.374) [-454.451] -- 0:00:32
466000 -- (-456.825) (-454.175) (-453.074) [-455.558] * (-454.631) (-455.267) [-453.842] (-454.924) -- 0:00:32
466500 -- [-453.974] (-457.365) (-454.074) (-458.785) * (-453.917) (-453.923) [-454.365] (-456.931) -- 0:00:32
467000 -- (-453.993) (-456.217) (-454.869) [-455.274] * (-456.867) [-455.642] (-454.581) (-454.657) -- 0:00:31
467500 -- (-455.129) (-454.564) (-453.230) [-456.150] * (-455.299) (-456.102) (-454.828) [-454.938] -- 0:00:31
468000 -- (-453.938) (-453.615) [-452.824] (-456.205) * (-456.028) (-459.882) [-453.133] (-457.879) -- 0:00:31
468500 -- (-456.613) (-454.349) (-452.516) [-455.803] * (-455.110) (-456.945) [-452.707] (-454.973) -- 0:00:31
469000 -- [-455.908] (-454.401) (-457.811) (-457.352) * [-454.955] (-454.473) (-452.707) (-453.634) -- 0:00:31
469500 -- (-455.748) (-453.919) (-456.251) [-456.113] * (-454.723) (-454.790) (-456.069) [-454.084] -- 0:00:31
470000 -- (-456.300) (-455.241) (-455.704) [-456.505] * (-454.847) [-454.601] (-459.980) (-458.267) -- 0:00:31
Average standard deviation of split frequencies: 0.008388
470500 -- (-454.591) [-457.126] (-453.692) (-453.358) * (-455.941) [-453.871] (-456.038) (-457.262) -- 0:00:31
471000 -- (-456.240) [-456.059] (-455.720) (-456.159) * (-455.051) [-453.998] (-453.470) (-462.547) -- 0:00:31
471500 -- [-453.897] (-456.285) (-455.693) (-453.277) * (-456.255) [-456.970] (-455.046) (-454.406) -- 0:00:31
472000 -- (-454.158) (-454.319) [-454.729] (-453.908) * (-454.072) [-453.892] (-455.357) (-454.630) -- 0:00:31
472500 -- [-454.978] (-455.378) (-453.477) (-453.418) * (-454.106) (-454.421) [-454.553] (-454.488) -- 0:00:31
473000 -- (-454.509) (-454.727) [-452.586] (-453.269) * [-453.656] (-456.309) (-457.348) (-457.140) -- 0:00:31
473500 -- (-455.761) [-452.791] (-454.055) (-454.960) * (-456.157) (-453.990) [-456.039] (-456.922) -- 0:00:31
474000 -- [-457.213] (-453.786) (-453.644) (-454.136) * [-456.406] (-455.239) (-455.895) (-460.355) -- 0:00:32
474500 -- (-454.590) (-454.087) [-453.772] (-455.584) * (-456.837) (-455.779) [-456.530] (-454.172) -- 0:00:32
475000 -- [-454.658] (-455.642) (-453.360) (-454.339) * [-453.802] (-453.502) (-454.893) (-455.256) -- 0:00:32
Average standard deviation of split frequencies: 0.007428
475500 -- (-455.886) [-455.931] (-457.535) (-457.138) * [-455.649] (-455.865) (-459.953) (-456.801) -- 0:00:31
476000 -- [-453.159] (-454.313) (-458.215) (-454.054) * [-453.867] (-453.529) (-454.088) (-455.276) -- 0:00:31
476500 -- (-457.743) [-453.844] (-454.691) (-455.662) * [-453.681] (-453.407) (-456.087) (-456.086) -- 0:00:31
477000 -- (-458.303) (-454.362) (-456.707) [-454.227] * (-453.447) [-455.984] (-459.305) (-455.303) -- 0:00:31
477500 -- (-455.024) (-457.719) [-453.634] (-453.627) * (-455.596) (-457.006) [-455.123] (-456.961) -- 0:00:31
478000 -- (-454.474) (-453.188) (-453.981) [-453.506] * (-452.755) [-455.679] (-454.890) (-453.335) -- 0:00:31
478500 -- (-454.179) (-453.225) [-456.695] (-458.668) * (-454.062) (-455.732) [-454.113] (-453.506) -- 0:00:31
479000 -- [-454.712] (-453.497) (-455.875) (-454.414) * (-456.272) [-453.448] (-453.259) (-455.117) -- 0:00:31
479500 -- [-455.021] (-453.348) (-454.226) (-454.552) * (-453.233) (-453.807) (-456.290) [-453.678] -- 0:00:31
480000 -- (-456.163) (-453.981) [-453.342] (-454.325) * (-453.540) [-453.828] (-453.831) (-454.097) -- 0:00:31
Average standard deviation of split frequencies: 0.009346
480500 -- (-457.122) [-454.936] (-454.843) (-454.679) * (-455.420) (-453.927) [-454.146] (-457.691) -- 0:00:31
481000 -- (-456.700) (-454.965) [-456.827] (-457.128) * (-459.522) (-452.707) [-453.927] (-456.651) -- 0:00:31
481500 -- [-455.285] (-455.098) (-455.335) (-457.473) * (-453.153) (-453.665) [-453.846] (-457.607) -- 0:00:31
482000 -- (-456.698) [-454.729] (-454.292) (-454.491) * (-455.817) (-456.882) [-453.611] (-454.140) -- 0:00:31
482500 -- (-453.390) (-454.195) (-457.246) [-454.606] * [-453.516] (-458.157) (-458.370) (-455.188) -- 0:00:31
483000 -- (-453.648) [-453.671] (-455.026) (-453.972) * (-454.735) (-452.864) (-455.971) [-453.042] -- 0:00:31
483500 -- (-454.187) (-456.935) (-456.492) [-455.287] * [-455.378] (-456.723) (-454.930) (-453.774) -- 0:00:30
484000 -- (-458.279) (-454.488) (-454.061) [-455.176] * [-456.619] (-455.234) (-458.470) (-455.113) -- 0:00:30
484500 -- [-454.404] (-454.559) (-454.565) (-457.096) * (-453.652) (-454.690) [-455.143] (-454.392) -- 0:00:30
485000 -- (-452.579) [-453.990] (-456.957) (-454.592) * (-462.396) [-458.077] (-457.473) (-453.495) -- 0:00:30
Average standard deviation of split frequencies: 0.009243
485500 -- (-453.178) (-454.086) (-456.152) [-453.381] * (-455.209) (-454.702) [-456.737] (-456.496) -- 0:00:30
486000 -- (-453.764) (-453.193) [-453.016] (-455.596) * [-456.276] (-453.501) (-454.941) (-453.697) -- 0:00:30
486500 -- (-452.752) [-454.594] (-452.918) (-456.115) * (-455.636) (-454.418) (-454.827) [-454.248] -- 0:00:30
487000 -- (-452.811) (-453.938) (-457.931) [-458.105] * (-453.526) (-455.734) [-454.508] (-453.998) -- 0:00:30
487500 -- (-454.289) [-454.125] (-454.122) (-456.803) * (-456.410) [-453.648] (-457.004) (-466.960) -- 0:00:30
488000 -- (-456.312) (-453.870) (-455.054) [-454.135] * (-455.581) [-454.495] (-454.437) (-456.064) -- 0:00:30
488500 -- (-460.275) (-458.269) [-453.674] (-458.428) * [-454.551] (-453.556) (-454.622) (-454.633) -- 0:00:30
489000 -- (-456.487) (-454.865) [-453.971] (-453.200) * (-453.347) [-454.540] (-453.005) (-453.262) -- 0:00:30
489500 -- (-454.186) (-458.085) (-453.733) [-455.248] * (-453.515) (-456.869) (-454.935) [-454.766] -- 0:00:30
490000 -- (-456.227) [-457.828] (-454.665) (-452.910) * (-456.851) (-454.045) (-458.287) [-453.344] -- 0:00:30
Average standard deviation of split frequencies: 0.009833
490500 -- (-456.268) [-455.913] (-456.841) (-454.683) * (-454.430) (-454.533) (-456.923) [-456.020] -- 0:00:30
491000 -- (-456.325) (-458.777) [-453.810] (-453.451) * (-458.840) (-455.682) [-457.444] (-456.776) -- 0:00:31
491500 -- (-457.779) [-457.767] (-454.138) (-453.267) * [-454.632] (-454.661) (-454.672) (-457.023) -- 0:00:31
492000 -- (-457.238) [-455.272] (-454.304) (-452.837) * [-453.416] (-455.773) (-455.017) (-459.840) -- 0:00:30
492500 -- (-454.491) (-457.520) [-454.977] (-454.176) * (-454.947) (-454.676) (-455.802) [-453.082] -- 0:00:30
493000 -- (-457.859) (-455.509) (-453.312) [-455.451] * (-455.143) [-455.200] (-455.266) (-452.803) -- 0:00:30
493500 -- (-461.190) (-455.235) [-452.985] (-454.442) * [-452.984] (-457.543) (-452.922) (-453.897) -- 0:00:30
494000 -- (-453.323) (-453.521) (-460.727) [-454.954] * [-452.964] (-454.180) (-453.542) (-455.071) -- 0:00:30
494500 -- [-453.369] (-458.586) (-455.070) (-454.704) * [-454.890] (-454.512) (-459.644) (-455.169) -- 0:00:30
495000 -- (-454.569) (-458.250) [-454.048] (-455.616) * (-455.716) (-461.871) (-456.509) [-454.332] -- 0:00:30
Average standard deviation of split frequencies: 0.009326
495500 -- [-454.764] (-456.000) (-453.570) (-454.246) * (-457.869) (-459.121) (-456.518) [-454.628] -- 0:00:30
496000 -- (-456.516) (-456.069) (-455.324) [-454.998] * (-460.065) [-454.111] (-454.052) (-453.964) -- 0:00:30
496500 -- (-455.114) [-454.608] (-459.262) (-455.939) * (-455.062) (-453.225) (-455.888) [-453.454] -- 0:00:30
497000 -- (-455.355) (-453.243) (-453.060) [-455.610] * (-454.646) (-454.797) (-458.265) [-456.371] -- 0:00:30
497500 -- (-454.764) (-454.892) (-455.357) [-453.745] * [-453.928] (-458.032) (-458.152) (-456.563) -- 0:00:30
498000 -- (-453.780) (-455.103) [-453.385] (-454.730) * (-456.038) [-454.680] (-455.842) (-453.338) -- 0:00:30
498500 -- (-455.949) [-456.124] (-454.619) (-455.341) * (-457.132) (-453.464) [-454.068] (-453.989) -- 0:00:30
499000 -- (-454.744) (-453.587) [-453.270] (-454.017) * (-456.691) (-453.986) [-453.314] (-453.878) -- 0:00:30
499500 -- [-455.104] (-454.121) (-454.412) (-457.386) * (-456.480) (-455.472) (-453.725) [-455.119] -- 0:00:30
500000 -- (-453.888) (-455.350) [-454.719] (-457.116) * (-459.458) [-455.090] (-454.610) (-454.197) -- 0:00:30
Average standard deviation of split frequencies: 0.010136
500500 -- [-453.524] (-453.945) (-455.748) (-455.466) * [-461.354] (-455.797) (-452.788) (-454.314) -- 0:00:29
501000 -- (-454.143) [-454.151] (-455.011) (-453.751) * (-454.435) (-455.856) [-453.409] (-453.503) -- 0:00:29
501500 -- (-454.649) [-454.352] (-455.821) (-452.927) * (-453.508) (-455.839) (-453.716) [-457.036] -- 0:00:29
502000 -- (-453.475) (-454.034) (-456.594) [-453.445] * (-454.222) (-454.615) [-453.768] (-461.136) -- 0:00:29
502500 -- [-456.091] (-461.099) (-455.720) (-458.445) * [-453.464] (-458.025) (-458.112) (-457.135) -- 0:00:29
503000 -- [-455.331] (-458.467) (-454.298) (-455.020) * (-452.848) (-453.338) (-455.092) [-454.479] -- 0:00:29
503500 -- (-455.408) [-455.688] (-456.945) (-455.358) * (-455.110) [-452.749] (-458.585) (-456.646) -- 0:00:29
504000 -- [-454.309] (-452.721) (-456.864) (-455.503) * [-456.496] (-453.625) (-453.788) (-456.268) -- 0:00:29
504500 -- (-454.526) (-455.791) [-453.504] (-455.459) * (-456.634) [-453.451] (-452.749) (-455.529) -- 0:00:29
505000 -- [-454.436] (-453.373) (-454.951) (-455.967) * (-454.860) (-452.888) [-453.390] (-456.051) -- 0:00:29
Average standard deviation of split frequencies: 0.009371
505500 -- (-455.147) (-454.915) (-455.464) [-456.818] * (-456.455) [-452.919] (-453.523) (-454.456) -- 0:00:29
506000 -- [-455.498] (-455.015) (-458.112) (-455.973) * (-456.498) (-454.744) (-455.848) [-454.514] -- 0:00:29
506500 -- [-453.370] (-455.618) (-456.029) (-454.717) * (-454.106) [-454.623] (-453.214) (-456.156) -- 0:00:29
507000 -- (-456.271) [-455.134] (-455.281) (-455.237) * (-456.606) (-456.164) (-453.932) [-453.756] -- 0:00:29
507500 -- (-457.994) (-454.811) [-455.965] (-457.612) * (-456.544) (-455.350) [-453.623] (-455.519) -- 0:00:29
508000 -- (-456.225) (-453.176) [-455.106] (-454.863) * [-454.571] (-456.333) (-453.611) (-452.996) -- 0:00:30
508500 -- (-454.108) [-454.288] (-457.714) (-456.242) * [-452.608] (-458.886) (-453.604) (-453.130) -- 0:00:29
509000 -- (-453.850) (-454.358) (-454.425) [-456.751] * [-456.349] (-457.348) (-453.932) (-454.369) -- 0:00:29
509500 -- [-459.971] (-452.913) (-459.338) (-454.679) * (-454.374) [-455.332] (-452.772) (-458.074) -- 0:00:29
510000 -- (-454.555) (-458.672) (-455.114) [-454.422] * (-455.048) [-453.533] (-455.140) (-456.367) -- 0:00:29
Average standard deviation of split frequencies: 0.009340
510500 -- (-454.816) (-456.111) [-453.905] (-454.423) * (-461.131) (-453.645) [-453.113] (-455.037) -- 0:00:29
511000 -- (-454.196) (-458.114) [-455.128] (-456.489) * [-453.928] (-454.833) (-456.591) (-454.844) -- 0:00:29
511500 -- (-457.169) [-457.398] (-453.957) (-456.157) * [-454.749] (-453.156) (-454.423) (-453.844) -- 0:00:29
512000 -- (-455.715) (-459.433) [-456.578] (-460.396) * [-454.396] (-455.622) (-455.231) (-456.780) -- 0:00:29
512500 -- (-456.522) (-454.142) (-458.844) [-453.712] * (-456.143) [-455.613] (-458.172) (-455.086) -- 0:00:29
513000 -- (-453.104) (-462.241) (-454.467) [-453.694] * (-454.329) (-454.421) [-456.821] (-454.957) -- 0:00:29
513500 -- (-453.607) [-453.416] (-455.852) (-454.237) * (-453.365) (-454.119) (-459.187) [-453.166] -- 0:00:29
514000 -- (-453.954) [-453.423] (-456.545) (-454.397) * (-455.151) (-458.911) [-455.918] (-454.140) -- 0:00:29
514500 -- [-454.412] (-454.590) (-453.695) (-459.508) * (-455.769) (-454.542) (-459.980) [-455.422] -- 0:00:29
515000 -- [-455.885] (-455.750) (-455.938) (-455.920) * [-453.875] (-454.126) (-454.943) (-459.055) -- 0:00:29
Average standard deviation of split frequencies: 0.008565
515500 -- (-455.959) [-454.260] (-454.115) (-455.334) * (-453.388) (-454.502) (-454.662) [-456.965] -- 0:00:29
516000 -- (-455.461) [-453.220] (-454.451) (-454.157) * (-456.638) [-452.538] (-455.574) (-454.382) -- 0:00:29
516500 -- (-454.460) (-454.631) (-459.160) [-455.030] * (-454.066) (-454.845) [-454.810] (-455.321) -- 0:00:29
517000 -- (-455.005) (-458.501) (-455.501) [-455.579] * (-456.388) (-454.951) (-455.330) [-452.533] -- 0:00:28
517500 -- (-456.171) (-452.834) (-459.443) [-456.332] * (-454.721) (-458.171) [-453.927] (-452.714) -- 0:00:28
518000 -- [-454.668] (-452.878) (-455.902) (-455.501) * (-455.929) (-461.247) (-453.479) [-456.841] -- 0:00:28
518500 -- (-456.274) (-454.486) (-457.322) [-455.490] * (-456.174) (-462.154) (-455.565) [-454.354] -- 0:00:28
519000 -- [-455.117] (-455.845) (-453.696) (-455.989) * (-459.394) (-455.151) (-452.959) [-456.570] -- 0:00:28
519500 -- (-455.244) (-455.775) [-454.184] (-456.283) * (-455.051) (-454.636) (-454.115) [-460.382] -- 0:00:28
520000 -- (-456.748) (-453.183) (-455.854) [-454.183] * (-455.625) (-454.039) (-456.119) [-456.939] -- 0:00:28
Average standard deviation of split frequencies: 0.009167
520500 -- (-454.435) (-455.347) [-455.002] (-454.251) * [-454.389] (-455.203) (-455.081) (-460.090) -- 0:00:28
521000 -- (-453.770) (-453.726) (-454.936) [-453.233] * (-454.068) (-455.993) [-454.637] (-454.728) -- 0:00:28
521500 -- (-455.808) (-455.287) [-456.893] (-453.088) * (-454.010) (-453.113) (-459.606) [-454.007] -- 0:00:28
522000 -- (-456.454) (-453.203) [-455.702] (-453.034) * (-459.478) (-454.368) (-454.294) [-453.911] -- 0:00:28
522500 -- (-455.309) (-454.291) (-455.641) [-454.429] * (-456.275) [-456.089] (-458.854) (-456.202) -- 0:00:28
523000 -- [-454.336] (-456.184) (-454.229) (-453.857) * (-457.919) (-454.623) (-457.919) [-453.948] -- 0:00:28
523500 -- (-454.639) (-456.711) (-454.483) [-454.316] * (-461.891) (-454.599) [-453.792] (-453.867) -- 0:00:28
524000 -- [-455.328] (-455.917) (-456.014) (-455.906) * (-457.612) (-456.738) (-455.287) [-454.312] -- 0:00:28
524500 -- [-456.473] (-454.764) (-455.566) (-455.524) * (-455.422) (-453.680) (-457.628) [-454.556] -- 0:00:29
525000 -- (-454.970) [-453.831] (-453.226) (-454.897) * (-455.394) [-452.794] (-455.081) (-455.347) -- 0:00:28
Average standard deviation of split frequencies: 0.009437
525500 -- (-454.658) (-455.255) [-454.495] (-454.176) * (-453.918) (-454.263) [-455.668] (-453.501) -- 0:00:28
526000 -- [-453.951] (-454.711) (-456.714) (-454.144) * (-453.171) (-452.898) (-454.321) [-453.262] -- 0:00:28
526500 -- (-459.235) (-452.701) [-455.330] (-454.356) * (-454.424) [-454.377] (-452.844) (-459.846) -- 0:00:28
527000 -- (-453.526) (-453.091) (-456.249) [-453.432] * (-455.120) (-455.792) (-453.998) [-456.176] -- 0:00:28
527500 -- (-458.235) (-453.119) [-454.021] (-454.435) * (-454.166) (-457.455) (-456.905) [-454.416] -- 0:00:28
528000 -- (-453.584) [-454.068] (-454.443) (-454.626) * (-454.257) [-454.532] (-461.217) (-454.436) -- 0:00:28
528500 -- (-453.183) [-456.446] (-453.991) (-455.634) * (-457.357) (-465.543) [-454.170] (-457.014) -- 0:00:28
529000 -- (-453.005) (-456.456) (-455.939) [-453.644] * [-457.233] (-457.831) (-453.755) (-454.017) -- 0:00:28
529500 -- (-453.482) [-454.879] (-457.667) (-453.578) * [-455.427] (-454.798) (-456.669) (-454.516) -- 0:00:28
530000 -- (-454.161) [-454.679] (-456.867) (-454.479) * (-456.991) (-453.776) (-455.826) [-455.154] -- 0:00:28
Average standard deviation of split frequencies: 0.008106
530500 -- (-453.436) [-453.461] (-456.797) (-457.216) * (-458.913) (-454.065) [-456.437] (-455.595) -- 0:00:28
531000 -- (-456.247) [-459.766] (-454.111) (-453.954) * [-454.738] (-455.158) (-456.157) (-457.400) -- 0:00:28
531500 -- (-455.782) (-456.466) [-454.021] (-454.458) * [-455.129] (-454.726) (-457.536) (-454.131) -- 0:00:28
532000 -- (-458.186) (-454.740) [-453.387] (-457.832) * (-454.775) (-462.875) [-457.066] (-458.848) -- 0:00:28
532500 -- (-459.110) (-459.173) [-453.108] (-460.992) * (-453.842) (-458.115) [-456.035] (-454.750) -- 0:00:28
533000 -- [-454.166] (-453.578) (-454.861) (-455.329) * (-452.979) (-457.313) (-453.729) [-453.617] -- 0:00:28
533500 -- [-455.928] (-453.073) (-460.394) (-457.535) * (-453.039) (-454.636) (-453.414) [-453.719] -- 0:00:27
534000 -- (-458.254) (-453.376) [-454.309] (-455.186) * (-453.336) [-454.739] (-453.605) (-453.779) -- 0:00:27
534500 -- [-454.041] (-456.351) (-453.976) (-455.104) * (-453.564) [-454.043] (-454.110) (-453.711) -- 0:00:27
535000 -- (-454.756) [-457.715] (-454.477) (-455.987) * (-453.216) (-454.862) (-459.590) [-455.992] -- 0:00:27
Average standard deviation of split frequencies: 0.007696
535500 -- (-458.576) (-456.677) (-454.209) [-455.665] * (-453.380) [-454.414] (-453.976) (-454.497) -- 0:00:27
536000 -- (-454.454) [-453.164] (-455.343) (-454.845) * (-454.463) [-453.248] (-453.778) (-459.149) -- 0:00:27
536500 -- [-455.001] (-453.639) (-452.859) (-457.748) * (-456.266) (-453.702) [-453.784] (-455.412) -- 0:00:27
537000 -- [-454.758] (-453.901) (-456.292) (-459.756) * [-457.385] (-456.078) (-452.599) (-455.866) -- 0:00:27
537500 -- (-454.186) (-455.699) (-456.275) [-454.985] * (-455.785) [-455.812] (-454.900) (-455.934) -- 0:00:27
538000 -- (-454.023) [-453.092] (-459.058) (-453.770) * (-456.318) (-455.807) (-453.654) [-454.349] -- 0:00:27
538500 -- (-454.225) (-455.750) [-454.196] (-454.040) * (-456.458) [-456.619] (-455.550) (-454.106) -- 0:00:27
539000 -- [-453.294] (-453.901) (-453.658) (-457.309) * (-457.575) (-461.202) [-455.481] (-453.891) -- 0:00:27
539500 -- (-453.676) (-454.344) (-454.260) [-456.369] * [-454.722] (-456.870) (-456.462) (-455.817) -- 0:00:27
540000 -- [-454.079] (-455.128) (-456.200) (-454.719) * (-454.538) (-458.974) [-460.891] (-454.860) -- 0:00:27
Average standard deviation of split frequencies: 0.007575
540500 -- (-453.581) (-454.864) (-457.792) [-456.307] * [-456.693] (-454.698) (-455.546) (-456.135) -- 0:00:27
541000 -- (-455.993) [-453.753] (-455.602) (-460.768) * (-454.777) (-454.225) [-456.881] (-454.288) -- 0:00:27
541500 -- (-457.587) [-455.838] (-459.287) (-460.956) * (-453.942) (-453.885) [-456.865] (-453.859) -- 0:00:27
542000 -- [-455.142] (-455.732) (-454.984) (-458.913) * (-453.759) (-455.197) (-454.039) [-452.680] -- 0:00:27
542500 -- (-455.339) (-455.472) (-454.971) [-453.758] * (-454.666) [-454.517] (-454.920) (-453.351) -- 0:00:27
543000 -- (-453.367) [-454.035] (-456.599) (-454.044) * (-455.415) (-454.237) (-453.878) [-455.893] -- 0:00:27
543500 -- (-460.758) (-453.970) (-454.186) [-454.273] * (-453.553) [-453.272] (-453.870) (-453.894) -- 0:00:27
544000 -- [-454.289] (-453.679) (-452.845) (-457.135) * [-453.886] (-457.164) (-455.971) (-456.458) -- 0:00:27
544500 -- [-455.330] (-453.410) (-454.857) (-454.742) * (-454.922) [-456.428] (-459.094) (-455.073) -- 0:00:27
545000 -- (-453.675) [-453.442] (-454.005) (-453.795) * (-453.788) [-453.709] (-455.241) (-454.319) -- 0:00:27
Average standard deviation of split frequencies: 0.007824
545500 -- [-454.374] (-453.526) (-452.663) (-454.433) * (-457.461) (-456.339) (-457.541) [-454.220] -- 0:00:27
546000 -- (-452.706) [-453.602] (-456.661) (-455.675) * [-457.384] (-461.705) (-455.697) (-457.284) -- 0:00:27
546500 -- (-457.163) (-453.687) [-454.602] (-456.083) * (-454.905) [-453.432] (-454.341) (-454.567) -- 0:00:27
547000 -- [-453.268] (-453.811) (-455.901) (-454.901) * (-453.660) (-454.410) [-457.753] (-454.494) -- 0:00:27
547500 -- (-454.496) (-454.692) (-456.129) [-454.909] * [-453.406] (-454.131) (-459.346) (-454.943) -- 0:00:27
548000 -- (-455.656) [-455.225] (-454.824) (-455.162) * (-455.427) (-454.521) [-454.788] (-455.529) -- 0:00:27
548500 -- [-453.527] (-455.097) (-454.355) (-456.896) * (-454.867) [-452.994] (-455.632) (-454.016) -- 0:00:27
549000 -- (-453.403) (-455.229) [-454.345] (-460.944) * (-458.185) (-453.856) [-454.679] (-454.232) -- 0:00:27
549500 -- [-452.998] (-455.947) (-453.093) (-453.664) * (-456.109) [-456.876] (-452.856) (-453.045) -- 0:00:27
550000 -- [-454.737] (-459.141) (-455.701) (-454.004) * [-457.048] (-456.391) (-452.816) (-453.066) -- 0:00:27
Average standard deviation of split frequencies: 0.007437
550500 -- [-453.913] (-459.623) (-453.709) (-455.076) * (-454.835) (-457.692) [-454.954] (-456.416) -- 0:00:26
551000 -- [-454.836] (-455.461) (-453.030) (-456.372) * (-454.383) (-458.129) (-453.878) [-454.513] -- 0:00:26
551500 -- (-453.583) (-454.847) (-454.474) [-454.156] * (-459.204) (-454.456) (-455.256) [-454.143] -- 0:00:26
552000 -- (-455.802) (-455.886) (-454.183) [-453.159] * (-457.719) (-454.086) [-454.163] (-454.937) -- 0:00:26
552500 -- (-457.771) (-454.128) (-455.436) [-454.490] * (-463.229) (-453.552) (-456.285) [-454.584] -- 0:00:26
553000 -- (-455.089) [-455.873] (-455.776) (-452.750) * (-454.183) (-453.612) (-458.001) [-453.107] -- 0:00:26
553500 -- (-458.593) [-454.760] (-457.130) (-457.168) * (-453.897) (-454.138) [-456.426] (-454.344) -- 0:00:26
554000 -- [-457.547] (-457.828) (-454.709) (-452.652) * (-455.861) (-453.291) (-458.371) [-454.274] -- 0:00:26
554500 -- (-456.811) (-456.185) (-459.576) [-457.986] * (-455.311) [-454.215] (-456.380) (-454.609) -- 0:00:26
555000 -- (-456.236) [-452.972] (-456.427) (-457.270) * (-455.855) (-453.803) (-454.504) [-456.556] -- 0:00:26
Average standard deviation of split frequencies: 0.006465
555500 -- (-459.510) [-453.696] (-452.462) (-455.755) * [-455.045] (-453.127) (-456.266) (-454.067) -- 0:00:26
556000 -- (-453.709) [-456.867] (-454.784) (-456.011) * (-455.709) (-455.982) [-453.395] (-453.296) -- 0:00:26
556500 -- (-453.951) [-457.531] (-454.602) (-454.297) * (-454.129) (-457.916) [-454.344] (-453.072) -- 0:00:26
557000 -- (-458.201) [-454.403] (-455.111) (-461.768) * (-453.722) (-457.880) [-454.827] (-457.815) -- 0:00:26
557500 -- (-455.565) (-454.528) [-453.828] (-454.734) * (-456.028) (-454.620) (-454.837) [-457.393] -- 0:00:26
558000 -- (-453.754) (-455.150) (-454.033) [-456.516] * [-454.158] (-454.779) (-454.195) (-455.921) -- 0:00:26
558500 -- (-455.018) [-455.786] (-455.620) (-455.686) * (-455.279) (-453.448) [-453.110] (-460.718) -- 0:00:26
559000 -- (-454.587) [-456.268] (-457.307) (-454.711) * [-456.253] (-460.304) (-453.574) (-456.772) -- 0:00:26
559500 -- (-456.298) [-454.213] (-456.751) (-457.502) * (-463.890) [-457.976] (-453.929) (-456.022) -- 0:00:26
560000 -- (-453.514) [-453.522] (-456.766) (-456.693) * (-460.919) [-458.745] (-454.551) (-454.437) -- 0:00:26
Average standard deviation of split frequencies: 0.006937
560500 -- (-453.019) [-453.861] (-453.650) (-455.708) * (-454.597) (-455.298) (-454.653) [-453.539] -- 0:00:26
561000 -- (-453.356) (-464.061) (-453.432) [-454.260] * (-455.601) (-455.261) (-454.933) [-458.733] -- 0:00:26
561500 -- (-454.183) (-455.195) [-454.312] (-459.828) * (-455.480) (-454.012) [-453.690] (-456.612) -- 0:00:26
562000 -- (-458.064) [-454.857] (-452.958) (-458.562) * (-453.745) (-453.312) (-455.205) [-456.165] -- 0:00:26
562500 -- (-457.093) (-456.520) [-454.021] (-454.826) * (-453.840) [-453.733] (-455.761) (-453.541) -- 0:00:26
563000 -- [-454.945] (-456.976) (-457.741) (-453.862) * (-453.958) (-455.273) (-454.786) [-453.200] -- 0:00:26
563500 -- (-454.982) (-462.320) [-454.544] (-452.991) * (-454.389) (-457.560) (-455.307) [-454.103] -- 0:00:26
564000 -- [-455.111] (-456.438) (-453.632) (-453.365) * (-456.712) [-456.274] (-453.708) (-453.950) -- 0:00:26
564500 -- (-457.019) (-453.854) (-456.966) [-455.019] * (-455.945) [-456.582] (-453.256) (-454.052) -- 0:00:26
565000 -- (-455.956) [-454.443] (-454.264) (-458.600) * (-457.504) (-454.829) (-459.912) [-453.218] -- 0:00:26
Average standard deviation of split frequencies: 0.007300
565500 -- (-455.663) (-455.488) [-455.599] (-456.416) * (-455.956) (-453.170) [-453.032] (-456.885) -- 0:00:26
566000 -- (-455.055) (-457.539) [-454.017] (-452.854) * (-453.532) (-457.772) (-452.642) [-455.810] -- 0:00:26
566500 -- [-454.437] (-455.195) (-454.899) (-452.915) * (-453.413) [-453.331] (-458.845) (-453.865) -- 0:00:26
567000 -- (-453.726) [-454.060] (-454.616) (-455.540) * (-455.943) (-453.409) [-453.696] (-455.544) -- 0:00:25
567500 -- (-454.869) [-452.849] (-457.175) (-458.410) * (-459.116) [-453.885] (-454.636) (-455.994) -- 0:00:25
568000 -- (-453.633) [-453.782] (-454.524) (-455.900) * (-453.277) (-457.442) (-455.668) [-457.483] -- 0:00:25
568500 -- (-454.290) (-453.754) (-456.988) [-454.972] * (-454.261) (-461.238) (-459.671) [-455.387] -- 0:00:25
569000 -- (-453.419) [-454.429] (-453.710) (-453.192) * (-452.884) (-456.038) [-455.718] (-453.073) -- 0:00:25
569500 -- (-455.166) [-455.838] (-457.906) (-453.543) * [-453.953] (-456.039) (-454.957) (-457.465) -- 0:00:25
570000 -- [-454.992] (-455.531) (-456.032) (-452.934) * [-459.602] (-454.190) (-456.506) (-457.084) -- 0:00:25
Average standard deviation of split frequencies: 0.006350
570500 -- (-456.213) [-454.269] (-453.440) (-453.812) * (-460.314) [-455.060] (-453.460) (-454.362) -- 0:00:25
571000 -- (-453.486) (-456.896) (-454.613) [-453.728] * (-454.711) [-457.895] (-454.767) (-457.948) -- 0:00:25
571500 -- [-455.876] (-455.683) (-460.026) (-457.176) * (-455.009) [-458.944] (-453.172) (-454.448) -- 0:00:25
572000 -- [-455.933] (-456.793) (-454.584) (-454.981) * (-455.836) (-457.039) [-452.738] (-455.087) -- 0:00:25
572500 -- (-454.636) (-457.687) [-454.702] (-455.516) * (-457.105) (-456.099) [-455.243] (-453.578) -- 0:00:25
573000 -- (-453.885) (-456.800) [-456.084] (-456.212) * (-454.927) (-454.996) [-455.168] (-453.001) -- 0:00:25
573500 -- (-453.442) [-455.141] (-458.396) (-457.791) * (-456.779) (-454.257) [-453.848] (-457.649) -- 0:00:25
574000 -- (-454.860) [-456.061] (-459.527) (-459.738) * (-453.299) [-453.365] (-455.734) (-458.851) -- 0:00:25
574500 -- [-457.511] (-455.735) (-457.362) (-453.868) * (-454.502) (-453.328) [-454.108] (-458.591) -- 0:00:25
575000 -- [-454.558] (-457.623) (-453.508) (-456.993) * (-455.498) (-453.214) (-455.025) [-457.820] -- 0:00:25
Average standard deviation of split frequencies: 0.006240
575500 -- (-455.418) [-454.439] (-454.617) (-455.715) * (-453.776) [-453.135] (-455.134) (-459.429) -- 0:00:25
576000 -- (-454.584) [-454.148] (-454.455) (-454.938) * (-453.578) (-453.042) [-453.789] (-453.752) -- 0:00:25
576500 -- (-459.099) [-456.337] (-455.011) (-456.522) * (-453.917) (-453.911) [-454.285] (-452.883) -- 0:00:25
577000 -- (-453.935) [-457.027] (-456.817) (-456.629) * (-453.337) (-455.963) [-454.777] (-453.817) -- 0:00:25
577500 -- [-456.281] (-455.330) (-454.595) (-455.542) * [-453.387] (-456.499) (-453.429) (-457.224) -- 0:00:25
578000 -- (-456.639) [-456.202] (-454.146) (-453.014) * (-454.961) (-462.569) [-454.003] (-457.123) -- 0:00:25
578500 -- (-457.849) (-454.668) (-454.969) [-454.281] * (-456.620) [-455.332] (-457.000) (-454.078) -- 0:00:25
579000 -- (-454.933) (-454.947) (-454.825) [-457.807] * [-452.701] (-456.118) (-453.223) (-453.227) -- 0:00:25
579500 -- (-456.056) (-456.738) [-452.866] (-453.268) * (-453.129) [-454.006] (-458.792) (-453.766) -- 0:00:25
580000 -- (-457.179) (-453.675) (-455.885) [-454.404] * (-455.187) (-458.766) [-453.222] (-455.861) -- 0:00:25
Average standard deviation of split frequencies: 0.006089
580500 -- (-456.744) (-453.009) [-457.133] (-454.624) * (-455.750) (-455.971) (-455.204) [-454.931] -- 0:00:25
581000 -- [-455.149] (-453.416) (-454.064) (-453.301) * [-456.498] (-457.208) (-456.625) (-454.305) -- 0:00:25
581500 -- (-457.309) (-453.916) (-453.420) [-453.644] * (-455.424) (-459.721) [-454.034] (-454.585) -- 0:00:25
582000 -- (-456.472) (-455.182) (-456.409) [-456.308] * (-453.856) (-454.879) [-453.680] (-453.550) -- 0:00:25
582500 -- (-454.097) [-453.627] (-457.644) (-455.527) * (-453.774) [-456.878] (-453.128) (-452.941) -- 0:00:25
583000 -- (-453.555) [-456.253] (-459.693) (-454.201) * (-453.456) [-454.326] (-456.202) (-454.545) -- 0:00:25
583500 -- (-456.604) (-453.709) [-453.404] (-453.706) * [-454.538] (-456.258) (-457.705) (-455.589) -- 0:00:24
584000 -- (-456.106) (-456.108) (-453.833) [-457.780] * (-453.882) [-454.398] (-461.435) (-453.810) -- 0:00:24
584500 -- (-454.430) (-456.108) [-452.686] (-454.477) * (-454.430) (-453.008) [-453.618] (-455.400) -- 0:00:24
585000 -- [-454.213] (-455.769) (-457.934) (-453.255) * (-454.953) [-455.362] (-457.311) (-456.511) -- 0:00:24
Average standard deviation of split frequencies: 0.005732
585500 -- (-452.909) (-453.535) [-456.237] (-458.939) * [-454.138] (-453.092) (-453.352) (-453.273) -- 0:00:24
586000 -- (-454.584) [-454.035] (-455.830) (-455.159) * (-455.027) (-452.884) (-453.916) [-453.609] -- 0:00:24
586500 -- [-453.524] (-454.384) (-456.437) (-455.681) * (-457.806) [-454.479] (-455.980) (-452.831) -- 0:00:24
587000 -- (-454.989) [-457.409] (-456.334) (-454.143) * [-454.776] (-454.198) (-457.266) (-456.079) -- 0:00:24
587500 -- [-455.986] (-454.267) (-455.824) (-453.694) * (-455.115) [-454.574] (-455.244) (-454.747) -- 0:00:24
588000 -- (-458.640) [-453.707] (-453.922) (-453.348) * (-455.046) (-453.484) (-453.914) [-457.790] -- 0:00:24
588500 -- [-453.445] (-454.919) (-454.663) (-454.268) * (-455.477) (-458.604) [-454.452] (-456.382) -- 0:00:24
589000 -- [-455.442] (-457.886) (-456.052) (-453.816) * (-454.744) [-453.742] (-456.403) (-457.606) -- 0:00:24
589500 -- (-455.137) (-453.744) (-454.668) [-457.846] * (-453.298) [-454.484] (-452.782) (-458.314) -- 0:00:24
590000 -- (-454.356) [-454.515] (-452.795) (-455.214) * (-454.044) (-457.887) (-455.223) [-454.286] -- 0:00:24
Average standard deviation of split frequencies: 0.005936
590500 -- [-454.551] (-453.840) (-455.348) (-455.211) * (-456.883) (-455.135) [-455.286] (-455.332) -- 0:00:24
591000 -- [-454.118] (-455.961) (-459.961) (-456.883) * (-456.486) (-455.210) (-458.375) [-457.659] -- 0:00:24
591500 -- (-454.533) [-454.487] (-461.094) (-454.088) * [-453.355] (-455.474) (-460.340) (-454.421) -- 0:00:24
592000 -- (-453.849) (-455.124) (-461.079) [-455.606] * (-456.736) (-455.953) (-454.805) [-456.083] -- 0:00:24
592500 -- (-457.611) [-459.843] (-453.779) (-456.694) * (-454.726) [-453.503] (-454.596) (-453.768) -- 0:00:24
593000 -- [-453.638] (-454.846) (-453.949) (-454.125) * [-456.064] (-456.291) (-457.063) (-452.699) -- 0:00:24
593500 -- (-453.625) (-454.878) (-455.589) [-453.097] * (-453.722) (-461.757) [-453.986] (-456.394) -- 0:00:24
594000 -- (-454.601) (-453.196) (-460.425) [-453.909] * (-453.696) (-462.474) (-454.756) [-457.590] -- 0:00:24
594500 -- (-465.493) (-456.965) [-453.621] (-454.076) * (-456.346) (-456.895) (-455.076) [-456.574] -- 0:00:24
595000 -- (-453.550) (-457.440) [-454.965] (-453.240) * (-455.189) (-455.119) (-453.380) [-457.383] -- 0:00:24
Average standard deviation of split frequencies: 0.006700
595500 -- [-454.995] (-453.890) (-456.048) (-453.132) * [-452.748] (-453.563) (-455.678) (-453.271) -- 0:00:24
596000 -- (-456.550) (-454.186) (-454.244) [-452.970] * (-457.549) [-457.332] (-453.605) (-454.105) -- 0:00:24
596500 -- (-454.295) [-457.807] (-454.920) (-453.236) * (-455.859) (-454.560) [-457.234] (-454.610) -- 0:00:24
597000 -- (-455.208) (-455.329) (-455.596) [-455.249] * (-455.882) (-454.901) (-455.654) [-458.773] -- 0:00:24
597500 -- [-453.384] (-453.604) (-454.786) (-454.128) * (-454.005) (-452.978) [-455.112] (-453.718) -- 0:00:24
598000 -- (-455.980) [-453.337] (-455.854) (-457.185) * [-454.145] (-457.327) (-455.480) (-455.512) -- 0:00:24
598500 -- (-458.268) [-456.314] (-460.723) (-452.984) * (-458.254) (-455.547) [-454.324] (-453.366) -- 0:00:24
599000 -- [-453.635] (-456.183) (-459.970) (-459.560) * (-456.742) (-455.079) [-454.601] (-454.477) -- 0:00:24
599500 -- [-455.928] (-455.961) (-454.614) (-460.323) * (-454.489) (-457.055) (-457.345) [-454.457] -- 0:00:24
600000 -- (-456.712) (-456.130) (-461.017) [-456.883] * (-454.896) [-454.791] (-454.376) (-457.144) -- 0:00:24
Average standard deviation of split frequencies: 0.006327
600500 -- [-455.520] (-459.857) (-454.525) (-454.051) * [-453.849] (-455.558) (-455.080) (-454.636) -- 0:00:23
601000 -- (-455.226) (-455.379) (-454.386) [-453.341] * (-454.064) (-453.692) [-454.996] (-455.240) -- 0:00:23
601500 -- (-456.062) (-456.735) (-453.653) [-453.968] * (-459.696) (-453.793) [-455.833] (-456.544) -- 0:00:23
602000 -- (-453.582) [-457.319] (-455.040) (-454.841) * (-455.975) [-453.435] (-455.842) (-454.180) -- 0:00:23
602500 -- [-455.710] (-454.678) (-455.283) (-455.557) * (-457.484) (-455.473) [-459.000] (-454.032) -- 0:00:23
603000 -- (-456.165) (-454.176) (-454.960) [-454.659] * (-454.853) (-458.467) (-456.367) [-454.629] -- 0:00:23
603500 -- (-458.133) [-454.883] (-458.569) (-454.765) * (-454.720) (-455.332) (-454.718) [-454.187] -- 0:00:23
604000 -- [-456.100] (-454.334) (-455.127) (-453.082) * (-454.361) (-454.230) (-456.824) [-453.991] -- 0:00:24
604500 -- (-455.112) [-457.615] (-455.468) (-454.460) * (-454.430) [-454.542] (-455.120) (-453.429) -- 0:00:24
605000 -- [-453.326] (-454.325) (-455.078) (-454.190) * (-458.222) (-454.548) [-457.662] (-454.487) -- 0:00:24
Average standard deviation of split frequencies: 0.006466
605500 -- (-453.326) (-454.679) [-457.013] (-452.786) * [-455.908] (-454.335) (-456.542) (-457.148) -- 0:00:24
606000 -- (-455.553) (-453.239) (-456.684) [-453.543] * (-453.403) (-453.234) [-454.759] (-454.293) -- 0:00:24
606500 -- (-455.663) (-455.309) [-454.549] (-454.700) * (-454.526) (-455.257) [-459.300] (-452.982) -- 0:00:24
607000 -- (-454.637) (-453.368) [-453.918] (-454.101) * [-453.100] (-456.772) (-455.391) (-455.674) -- 0:00:23
607500 -- (-455.033) [-452.787] (-455.618) (-453.966) * (-452.547) (-453.424) (-455.078) [-453.584] -- 0:00:23
608000 -- (-458.336) (-456.696) (-453.697) [-453.607] * [-453.298] (-454.963) (-454.605) (-454.988) -- 0:00:23
608500 -- (-454.848) (-454.801) [-454.075] (-453.129) * (-454.033) (-454.189) [-452.842] (-456.765) -- 0:00:23
609000 -- (-455.558) [-453.151] (-455.338) (-454.135) * (-456.078) (-453.208) (-453.743) [-454.110] -- 0:00:23
609500 -- (-456.732) [-454.361] (-454.330) (-452.892) * (-456.249) (-454.481) [-456.515] (-458.096) -- 0:00:23
610000 -- (-456.602) [-453.033] (-454.870) (-453.260) * (-456.660) (-455.385) [-453.182] (-456.336) -- 0:00:23
Average standard deviation of split frequencies: 0.006417
610500 -- [-457.671] (-452.906) (-452.602) (-453.031) * (-454.623) [-455.619] (-454.876) (-454.004) -- 0:00:23
611000 -- (-456.361) (-453.415) (-452.693) [-455.939] * (-455.807) [-454.026] (-456.328) (-455.029) -- 0:00:23
611500 -- (-453.447) (-455.727) [-453.868] (-453.766) * (-453.538) (-456.803) (-453.750) [-455.158] -- 0:00:23
612000 -- (-452.621) (-454.877) [-454.368] (-453.899) * [-453.149] (-453.068) (-453.078) (-454.984) -- 0:00:23
612500 -- (-457.120) (-456.227) (-455.173) [-453.231] * (-459.042) (-455.205) [-453.280] (-460.323) -- 0:00:23
613000 -- [-454.258] (-458.714) (-459.526) (-456.923) * [-456.891] (-457.724) (-454.973) (-453.339) -- 0:00:23
613500 -- (-455.744) (-456.290) (-454.900) [-454.167] * (-455.103) (-455.000) [-454.406] (-456.153) -- 0:00:23
614000 -- (-454.583) (-453.352) [-456.076] (-456.043) * (-459.231) (-455.664) [-457.295] (-453.435) -- 0:00:23
614500 -- [-455.395] (-455.571) (-457.903) (-457.625) * (-453.463) [-454.876] (-452.558) (-454.921) -- 0:00:23
615000 -- (-458.333) [-454.333] (-454.045) (-455.093) * (-453.734) (-457.748) (-454.647) [-454.159] -- 0:00:23
Average standard deviation of split frequencies: 0.006600
615500 -- (-460.748) (-453.541) [-454.174] (-457.692) * (-455.451) [-453.492] (-452.982) (-455.126) -- 0:00:23
616000 -- (-457.204) [-454.657] (-455.177) (-457.231) * (-457.281) (-454.921) (-455.014) [-455.333] -- 0:00:23
616500 -- (-454.292) [-453.160] (-456.540) (-457.731) * (-454.329) (-453.970) [-453.695] (-456.215) -- 0:00:23
617000 -- [-453.634] (-453.820) (-454.543) (-453.080) * (-454.632) [-453.955] (-454.233) (-455.977) -- 0:00:22
617500 -- (-453.799) [-452.801] (-454.547) (-453.653) * [-454.563] (-453.872) (-454.400) (-452.791) -- 0:00:22
618000 -- (-456.883) [-455.389] (-454.751) (-453.797) * [-453.149] (-456.532) (-454.866) (-452.649) -- 0:00:22
618500 -- (-454.183) [-455.818] (-453.381) (-453.369) * (-453.012) (-456.982) (-452.751) [-453.418] -- 0:00:22
619000 -- (-452.555) [-454.541] (-452.975) (-454.676) * [-455.711] (-456.073) (-456.150) (-455.027) -- 0:00:22
619500 -- [-457.585] (-454.673) (-454.369) (-455.215) * [-454.577] (-455.628) (-456.944) (-455.610) -- 0:00:22
620000 -- (-455.724) [-453.231] (-459.982) (-454.598) * (-454.005) (-456.262) (-455.498) [-455.739] -- 0:00:22
Average standard deviation of split frequencies: 0.006456
620500 -- (-453.159) (-454.306) (-453.112) [-455.820] * (-454.967) (-459.306) [-456.139] (-456.017) -- 0:00:23
621000 -- (-455.549) [-453.344] (-454.934) (-452.981) * (-453.024) (-461.931) (-456.818) [-456.911] -- 0:00:23
621500 -- [-453.412] (-454.624) (-456.768) (-453.507) * (-455.049) (-457.872) [-454.983] (-455.070) -- 0:00:23
622000 -- (-457.755) [-454.233] (-453.781) (-453.599) * (-455.408) [-457.589] (-455.249) (-454.072) -- 0:00:23
622500 -- (-453.120) [-453.776] (-455.798) (-453.626) * (-456.160) [-455.218] (-454.067) (-455.187) -- 0:00:23
623000 -- (-456.293) [-455.168] (-455.075) (-453.968) * (-453.741) (-455.461) (-457.325) [-456.865] -- 0:00:22
623500 -- [-456.566] (-454.888) (-453.319) (-457.280) * (-453.942) [-454.812] (-453.066) (-455.884) -- 0:00:22
624000 -- [-455.161] (-455.636) (-453.640) (-457.197) * (-454.792) (-454.363) (-452.536) [-454.959] -- 0:00:22
624500 -- (-454.339) [-453.535] (-455.126) (-456.358) * (-454.403) [-453.986] (-453.716) (-453.532) -- 0:00:22
625000 -- (-457.089) [-454.397] (-453.516) (-454.717) * (-453.524) (-453.077) [-455.260] (-455.458) -- 0:00:22
Average standard deviation of split frequencies: 0.006213
625500 -- [-454.775] (-454.028) (-456.663) (-457.986) * (-458.124) (-453.469) [-454.920] (-456.873) -- 0:00:22
626000 -- (-454.037) [-454.361] (-460.124) (-457.188) * (-458.099) [-454.269] (-454.123) (-452.909) -- 0:00:22
626500 -- [-455.466] (-453.629) (-458.742) (-459.596) * (-458.451) (-453.528) (-454.869) [-455.520] -- 0:00:22
627000 -- (-456.532) (-453.389) [-455.084] (-456.519) * [-455.017] (-453.324) (-455.776) (-455.720) -- 0:00:22
627500 -- (-453.588) (-457.193) [-453.103] (-455.368) * [-456.423] (-460.158) (-465.214) (-455.165) -- 0:00:22
628000 -- (-453.712) [-453.554] (-455.633) (-454.126) * (-458.794) (-454.793) (-463.228) [-456.737] -- 0:00:22
628500 -- [-455.350] (-455.394) (-454.753) (-454.814) * (-455.787) (-457.667) [-459.492] (-455.351) -- 0:00:22
629000 -- [-454.740] (-456.259) (-454.072) (-454.196) * (-454.964) (-459.748) [-455.554] (-459.724) -- 0:00:22
629500 -- (-455.629) [-459.296] (-454.182) (-453.087) * [-456.432] (-456.077) (-452.915) (-453.799) -- 0:00:22
630000 -- [-462.070] (-458.485) (-456.165) (-454.000) * (-453.686) (-455.973) (-453.745) [-452.878] -- 0:00:22
Average standard deviation of split frequencies: 0.006213
630500 -- (-455.701) [-455.918] (-456.987) (-454.778) * (-456.747) (-454.030) (-456.349) [-455.127] -- 0:00:22
631000 -- (-457.555) (-459.132) (-454.742) [-455.500] * (-454.707) (-458.883) [-454.632] (-454.830) -- 0:00:22
631500 -- (-454.132) (-452.722) [-457.093] (-457.041) * [-454.923] (-455.822) (-457.062) (-456.510) -- 0:00:22
632000 -- (-454.064) (-453.927) (-455.469) [-453.121] * [-455.577] (-455.926) (-455.770) (-459.334) -- 0:00:22
632500 -- (-455.460) (-456.480) (-455.644) [-452.821] * (-454.487) (-454.812) (-453.407) [-453.799] -- 0:00:22
633000 -- (-456.174) [-454.656] (-453.548) (-453.625) * (-454.190) (-461.898) [-454.523] (-454.161) -- 0:00:22
633500 -- (-454.839) (-453.127) [-457.888] (-454.170) * [-457.680] (-456.732) (-456.232) (-455.578) -- 0:00:21
634000 -- (-457.841) (-452.756) (-457.064) [-453.373] * (-453.254) (-455.011) [-459.658] (-455.731) -- 0:00:21
634500 -- [-454.534] (-453.235) (-455.801) (-455.048) * (-457.005) (-455.183) [-457.494] (-453.185) -- 0:00:21
635000 -- [-453.615] (-453.129) (-458.588) (-456.201) * (-456.319) [-452.850] (-455.650) (-453.820) -- 0:00:21
Average standard deviation of split frequencies: 0.006115
635500 -- (-457.198) [-453.582] (-454.782) (-456.466) * (-453.259) (-454.800) (-456.082) [-452.816] -- 0:00:21
636000 -- (-452.537) [-455.142] (-456.983) (-455.816) * (-454.193) [-454.465] (-455.848) (-452.931) -- 0:00:21
636500 -- [-453.389] (-454.811) (-454.590) (-453.406) * (-455.227) (-456.576) (-454.444) [-453.600] -- 0:00:21
637000 -- (-453.872) [-455.400] (-454.198) (-453.010) * (-455.857) (-455.424) [-453.368] (-454.402) -- 0:00:21
637500 -- [-453.529] (-454.149) (-454.454) (-453.332) * (-455.080) (-456.246) [-455.504] (-455.262) -- 0:00:22
638000 -- [-455.734] (-458.188) (-456.270) (-454.078) * (-455.146) (-459.354) (-454.293) [-453.177] -- 0:00:22
638500 -- (-454.780) [-454.883] (-457.826) (-455.074) * (-453.793) (-453.766) (-456.357) [-455.477] -- 0:00:22
639000 -- (-454.065) (-455.284) [-458.180] (-458.707) * [-453.517] (-454.150) (-453.771) (-455.358) -- 0:00:22
639500 -- (-454.384) (-456.219) [-456.038] (-462.706) * [-458.187] (-455.885) (-458.474) (-453.450) -- 0:00:21
640000 -- (-456.000) [-455.139] (-454.264) (-458.804) * (-454.630) [-454.075] (-455.693) (-453.653) -- 0:00:21
Average standard deviation of split frequencies: 0.006760
640500 -- (-455.282) (-456.400) [-457.116] (-454.856) * (-453.365) (-459.003) (-453.887) [-455.082] -- 0:00:21
641000 -- (-460.181) (-454.486) (-453.435) [-454.243] * (-457.217) [-455.442] (-453.106) (-453.531) -- 0:00:21
641500 -- (-456.119) [-454.345] (-457.149) (-456.645) * (-453.347) [-458.117] (-458.749) (-458.602) -- 0:00:21
642000 -- [-454.828] (-456.263) (-454.527) (-456.303) * (-452.724) [-454.918] (-457.515) (-455.319) -- 0:00:21
642500 -- [-453.705] (-456.718) (-460.623) (-457.885) * (-455.166) (-460.952) (-455.242) [-454.321] -- 0:00:21
643000 -- (-453.417) [-455.152] (-456.401) (-453.586) * (-454.253) (-453.683) [-456.379] (-454.136) -- 0:00:21
643500 -- [-452.806] (-454.325) (-454.484) (-456.070) * [-453.848] (-455.806) (-456.706) (-453.951) -- 0:00:21
644000 -- (-453.024) (-455.138) [-452.881] (-455.150) * (-455.018) [-456.630] (-455.072) (-456.195) -- 0:00:21
644500 -- (-454.187) (-454.644) (-454.282) [-454.006] * (-458.051) [-453.624] (-453.264) (-458.047) -- 0:00:21
645000 -- (-454.655) (-453.710) (-454.505) [-455.767] * [-457.300] (-453.728) (-458.841) (-458.471) -- 0:00:21
Average standard deviation of split frequencies: 0.006796
645500 -- (-454.358) (-455.341) (-453.489) [-454.779] * (-457.849) [-455.007] (-455.975) (-457.172) -- 0:00:21
646000 -- (-454.504) (-456.514) (-454.028) [-454.477] * (-456.730) (-456.249) [-452.914] (-456.813) -- 0:00:21
646500 -- (-454.590) [-455.064] (-455.912) (-456.021) * (-455.844) (-457.572) [-454.298] (-455.528) -- 0:00:21
647000 -- (-453.877) [-454.820] (-452.890) (-454.280) * (-455.678) [-461.726] (-457.353) (-454.460) -- 0:00:21
647500 -- (-456.245) [-456.861] (-455.827) (-455.079) * (-454.194) (-456.634) (-458.449) [-453.390] -- 0:00:21
648000 -- (-457.203) [-454.243] (-454.124) (-455.643) * (-454.566) [-453.337] (-454.642) (-454.081) -- 0:00:21
648500 -- (-455.258) (-456.822) [-453.681] (-454.148) * (-455.367) [-455.419] (-457.803) (-456.384) -- 0:00:21
649000 -- (-452.576) [-455.516] (-461.282) (-460.209) * (-454.986) (-456.551) [-454.983] (-453.404) -- 0:00:21
649500 -- (-453.407) [-453.778] (-454.578) (-457.135) * (-455.924) [-454.782] (-455.845) (-459.340) -- 0:00:21
650000 -- [-454.804] (-454.246) (-453.030) (-457.451) * (-456.928) [-453.277] (-457.974) (-461.565) -- 0:00:21
Average standard deviation of split frequencies: 0.006475
650500 -- (-453.098) (-453.825) (-453.583) [-453.579] * (-456.665) (-458.462) [-453.747] (-454.011) -- 0:00:20
651000 -- (-454.424) (-454.568) [-456.911] (-455.106) * (-460.558) (-453.009) [-456.808] (-455.312) -- 0:00:20
651500 -- [-454.792] (-454.766) (-455.356) (-455.642) * (-456.202) (-453.749) (-459.190) [-453.418] -- 0:00:20
652000 -- (-459.037) (-454.389) (-455.480) [-455.547] * (-457.485) (-457.469) [-454.016] (-454.665) -- 0:00:20
652500 -- [-454.033] (-455.537) (-453.851) (-454.754) * (-455.900) [-455.741] (-454.372) (-454.176) -- 0:00:20
653000 -- (-454.159) (-454.889) [-454.393] (-454.067) * (-455.908) (-453.008) (-455.560) [-455.874] -- 0:00:20
653500 -- [-452.791] (-455.745) (-457.482) (-454.628) * (-456.602) (-456.512) [-453.197] (-456.199) -- 0:00:20
654000 -- [-456.986] (-455.076) (-453.211) (-454.772) * (-457.414) (-455.856) (-454.858) [-454.479] -- 0:00:21
654500 -- (-460.607) (-455.673) (-455.702) [-453.682] * (-457.295) [-453.819] (-453.173) (-455.375) -- 0:00:21
655000 -- (-452.935) (-453.559) [-454.461] (-454.273) * (-455.982) (-453.110) (-459.759) [-454.365] -- 0:00:21
Average standard deviation of split frequencies: 0.006737
655500 -- (-454.094) (-455.374) (-453.178) [-457.544] * (-452.982) [-452.987] (-454.428) (-454.827) -- 0:00:21
656000 -- (-456.937) (-456.454) [-453.159] (-458.339) * (-453.168) (-455.348) (-457.004) [-457.303] -- 0:00:20
656500 -- (-456.383) (-453.367) (-457.655) [-456.181] * (-454.323) (-454.190) (-454.675) [-453.728] -- 0:00:20
657000 -- (-458.156) [-454.470] (-454.217) (-454.264) * (-455.384) [-453.313] (-455.405) (-454.472) -- 0:00:20
657500 -- (-454.061) [-454.278] (-454.985) (-454.918) * [-453.603] (-457.167) (-457.240) (-457.906) -- 0:00:20
658000 -- (-457.665) (-456.927) (-454.191) [-454.528] * [-459.203] (-454.173) (-453.254) (-454.746) -- 0:00:20
658500 -- (-452.994) (-456.323) [-455.095] (-457.344) * [-452.701] (-454.515) (-453.656) (-459.050) -- 0:00:20
659000 -- (-454.215) (-453.532) [-453.132] (-454.259) * (-454.944) (-454.792) (-460.241) [-454.252] -- 0:00:20
659500 -- [-453.683] (-453.662) (-453.071) (-455.282) * (-454.796) [-455.283] (-461.135) (-455.960) -- 0:00:20
660000 -- (-456.056) [-453.743] (-453.495) (-455.104) * (-454.704) (-455.284) (-462.037) [-459.847] -- 0:00:20
Average standard deviation of split frequencies: 0.007001
660500 -- [-455.948] (-453.092) (-455.189) (-454.126) * (-453.696) (-458.440) (-456.405) [-463.472] -- 0:00:20
661000 -- [-456.289] (-453.436) (-455.625) (-458.858) * [-455.246] (-455.948) (-459.306) (-454.706) -- 0:00:20
661500 -- (-455.479) (-455.324) [-454.331] (-455.667) * (-455.078) (-453.293) [-455.426] (-454.671) -- 0:00:20
662000 -- (-457.858) (-456.180) [-452.883] (-456.104) * (-454.231) [-455.141] (-454.663) (-453.761) -- 0:00:20
662500 -- (-453.750) (-455.479) (-454.130) [-453.294] * [-453.604] (-454.107) (-455.240) (-453.498) -- 0:00:20
663000 -- (-453.419) [-454.114] (-454.431) (-453.898) * (-453.667) (-454.335) [-454.031] (-455.127) -- 0:00:20
663500 -- (-458.750) (-457.654) (-454.856) [-455.416] * (-455.391) (-456.843) (-456.839) [-459.549] -- 0:00:20
664000 -- [-454.118] (-456.427) (-457.636) (-454.584) * [-455.584] (-456.985) (-454.397) (-459.816) -- 0:00:20
664500 -- [-455.803] (-456.636) (-463.424) (-455.503) * [-453.753] (-461.013) (-452.903) (-458.737) -- 0:00:20
665000 -- (-456.012) (-457.238) (-459.026) [-457.552] * [-455.929] (-456.127) (-455.412) (-462.050) -- 0:00:20
Average standard deviation of split frequencies: 0.007344
665500 -- (-452.919) (-453.318) [-456.071] (-455.521) * (-459.306) [-454.371] (-456.242) (-454.378) -- 0:00:20
666000 -- [-453.649] (-453.578) (-454.573) (-452.996) * [-456.637] (-454.096) (-454.608) (-456.874) -- 0:00:20
666500 -- (-457.753) (-455.589) [-454.568] (-457.343) * (-456.381) [-457.365] (-454.225) (-454.522) -- 0:00:20
667000 -- (-453.725) [-455.987] (-454.140) (-454.806) * (-453.798) (-455.370) [-454.747] (-454.562) -- 0:00:19
667500 -- [-456.877] (-456.740) (-454.444) (-454.562) * [-456.866] (-454.576) (-454.449) (-454.052) -- 0:00:19
668000 -- (-458.218) [-453.880] (-457.605) (-454.043) * (-456.356) [-457.011] (-457.596) (-455.372) -- 0:00:19
668500 -- [-455.917] (-453.364) (-454.088) (-455.340) * (-454.980) (-456.654) (-454.390) [-455.240] -- 0:00:19
669000 -- (-453.722) [-455.216] (-452.969) (-455.336) * (-459.647) [-455.383] (-456.071) (-455.281) -- 0:00:19
669500 -- (-454.109) [-456.166] (-454.392) (-453.656) * (-457.505) (-453.954) (-453.471) [-454.010] -- 0:00:20
670000 -- (-452.857) [-454.818] (-453.552) (-455.351) * (-456.998) [-453.607] (-458.779) (-455.447) -- 0:00:20
Average standard deviation of split frequencies: 0.007249
670500 -- (-454.131) (-455.356) [-456.411] (-453.031) * (-456.516) [-454.373] (-455.264) (-453.671) -- 0:00:20
671000 -- (-454.269) (-455.441) [-457.109] (-454.218) * (-460.607) (-457.256) (-455.019) [-454.820] -- 0:00:20
671500 -- (-453.986) (-454.785) [-456.917] (-457.409) * (-453.960) [-452.831] (-455.479) (-455.481) -- 0:00:20
672000 -- (-456.322) [-452.970] (-456.647) (-457.448) * (-453.671) (-455.275) [-453.571] (-454.728) -- 0:00:20
672500 -- (-455.035) (-455.246) (-452.930) [-454.435] * (-455.652) (-458.662) [-454.827] (-456.983) -- 0:00:19
673000 -- (-454.513) (-455.729) (-455.406) [-453.530] * [-457.404] (-456.172) (-454.003) (-452.915) -- 0:00:19
673500 -- (-456.800) [-455.605] (-457.045) (-453.541) * [-454.162] (-459.111) (-455.544) (-453.552) -- 0:00:19
674000 -- (-452.822) [-453.808] (-456.190) (-454.620) * (-455.628) (-455.010) (-453.804) [-453.022] -- 0:00:19
674500 -- [-453.499] (-453.609) (-454.549) (-452.795) * [-454.285] (-456.876) (-461.838) (-454.393) -- 0:00:19
675000 -- [-460.423] (-453.644) (-453.239) (-454.961) * (-457.285) [-453.857] (-454.762) (-454.269) -- 0:00:19
Average standard deviation of split frequencies: 0.007148
675500 -- (-455.286) (-456.993) (-455.818) [-453.889] * (-455.581) [-453.804] (-454.020) (-461.451) -- 0:00:19
676000 -- [-453.829] (-454.591) (-456.976) (-453.607) * (-454.127) [-453.308] (-458.349) (-456.095) -- 0:00:19
676500 -- (-456.557) (-453.967) [-454.316] (-455.216) * (-455.647) (-453.894) (-455.962) [-452.985] -- 0:00:19
677000 -- (-454.028) [-453.864] (-452.714) (-454.441) * (-453.615) (-456.353) (-456.400) [-453.686] -- 0:00:19
677500 -- [-455.846] (-452.627) (-452.939) (-455.458) * [-452.833] (-454.101) (-455.184) (-454.017) -- 0:00:19
678000 -- (-455.850) [-455.332] (-454.707) (-453.956) * [-456.460] (-455.101) (-453.663) (-455.594) -- 0:00:19
678500 -- [-454.787] (-452.851) (-455.121) (-457.614) * (-457.618) [-453.705] (-452.443) (-458.050) -- 0:00:19
679000 -- [-455.313] (-453.341) (-453.631) (-454.588) * (-458.050) [-453.965] (-454.131) (-457.021) -- 0:00:19
679500 -- (-454.039) (-453.207) (-453.871) [-454.643] * (-452.844) (-453.822) (-454.274) [-453.808] -- 0:00:19
680000 -- [-454.641] (-452.863) (-453.916) (-457.265) * (-456.342) (-454.710) (-455.053) [-454.182] -- 0:00:19
Average standard deviation of split frequencies: 0.007055
680500 -- (-454.553) [-453.017] (-453.920) (-453.983) * (-455.418) [-453.902] (-453.949) (-455.126) -- 0:00:19
681000 -- (-454.450) [-453.191] (-455.368) (-453.784) * [-454.909] (-455.748) (-454.233) (-454.922) -- 0:00:19
681500 -- [-454.153] (-454.501) (-454.638) (-455.703) * (-455.731) [-457.457] (-455.361) (-455.495) -- 0:00:19
682000 -- (-462.103) [-452.553] (-453.336) (-457.451) * [-454.795] (-454.695) (-453.995) (-454.798) -- 0:00:19
682500 -- [-454.585] (-453.954) (-455.184) (-457.511) * (-455.323) (-453.988) (-452.983) [-453.372] -- 0:00:19
683000 -- (-453.425) (-460.768) [-453.670] (-453.650) * (-456.774) (-455.077) (-456.247) [-455.659] -- 0:00:19
683500 -- (-453.475) (-454.290) (-457.915) [-454.823] * [-457.409] (-453.920) (-453.412) (-455.552) -- 0:00:18
684000 -- (-453.151) [-454.768] (-455.944) (-458.235) * (-457.477) (-453.046) [-454.339] (-454.189) -- 0:00:18
684500 -- (-455.377) (-455.025) [-453.042] (-456.637) * (-454.391) [-454.589] (-455.291) (-453.965) -- 0:00:18
685000 -- (-453.544) [-455.675] (-454.150) (-458.266) * (-454.418) [-454.094] (-452.706) (-454.318) -- 0:00:18
Average standard deviation of split frequencies: 0.007215
685500 -- (-455.147) [-454.822] (-456.708) (-456.870) * [-453.753] (-454.712) (-453.752) (-457.545) -- 0:00:18
686000 -- (-456.476) (-454.919) [-453.284] (-455.857) * (-453.834) [-454.808] (-454.247) (-455.274) -- 0:00:18
686500 -- (-456.770) [-454.176] (-454.583) (-455.989) * (-453.029) (-454.693) [-454.495] (-456.348) -- 0:00:19
687000 -- (-455.051) (-454.553) (-454.702) [-452.754] * (-453.485) (-455.070) [-455.304] (-456.503) -- 0:00:19
687500 -- (-453.839) [-453.052] (-453.189) (-456.068) * (-453.270) (-455.605) [-457.985] (-454.407) -- 0:00:19
688000 -- (-456.343) [-454.645] (-454.610) (-456.473) * (-453.856) (-455.756) (-461.759) [-453.008] -- 0:00:19
688500 -- (-456.337) (-453.389) [-457.886] (-456.104) * (-453.699) (-466.342) (-453.005) [-454.632] -- 0:00:19
689000 -- (-458.289) (-453.638) (-457.500) [-455.370] * [-453.836] (-455.109) (-453.483) (-455.791) -- 0:00:18
689500 -- (-456.412) (-455.628) (-454.978) [-454.052] * (-455.320) (-453.525) (-455.878) [-453.418] -- 0:00:18
690000 -- (-452.993) (-457.780) (-455.995) [-454.622] * (-455.408) (-454.540) (-456.380) [-454.554] -- 0:00:18
Average standard deviation of split frequencies: 0.007721
690500 -- (-459.012) (-454.648) [-453.673] (-454.493) * (-454.638) (-455.534) (-453.973) [-454.024] -- 0:00:18
691000 -- (-454.290) (-455.232) [-456.204] (-454.629) * (-454.170) (-455.077) [-455.057] (-453.211) -- 0:00:18
691500 -- (-453.420) (-454.677) (-453.714) [-453.187] * [-453.249] (-454.159) (-454.010) (-454.977) -- 0:00:18
692000 -- (-453.528) [-455.446] (-454.176) (-457.933) * (-455.554) (-455.207) (-453.891) [-455.500] -- 0:00:18
692500 -- [-455.517] (-455.881) (-453.899) (-468.002) * (-453.605) (-455.264) (-453.348) [-458.737] -- 0:00:18
693000 -- [-455.635] (-452.883) (-458.258) (-456.692) * [-453.855] (-453.697) (-455.276) (-456.215) -- 0:00:18
693500 -- (-456.511) (-454.169) [-455.301] (-454.331) * (-453.514) [-453.659] (-456.542) (-460.988) -- 0:00:18
694000 -- (-454.587) [-454.408] (-457.233) (-453.871) * (-453.575) (-456.468) (-455.412) [-456.211] -- 0:00:18
694500 -- (-455.497) (-455.339) (-453.962) [-454.472] * (-459.404) (-456.448) (-455.864) [-455.755] -- 0:00:18
695000 -- (-454.361) [-456.436] (-456.985) (-455.700) * [-454.140] (-455.557) (-454.054) (-454.330) -- 0:00:18
Average standard deviation of split frequencies: 0.007154
695500 -- [-455.703] (-454.968) (-458.222) (-452.922) * (-454.982) (-458.238) [-453.016] (-453.210) -- 0:00:18
696000 -- (-453.047) [-454.286] (-459.713) (-456.002) * (-457.704) [-457.762] (-454.629) (-454.713) -- 0:00:18
696500 -- (-453.125) (-454.607) (-457.545) [-456.577] * (-457.526) [-457.786] (-454.358) (-453.292) -- 0:00:18
697000 -- [-456.263] (-454.430) (-458.914) (-454.682) * (-453.998) [-456.416] (-456.155) (-454.280) -- 0:00:18
697500 -- (-455.141) [-453.203] (-457.061) (-453.823) * [-455.835] (-459.616) (-461.572) (-454.486) -- 0:00:18
698000 -- [-453.694] (-453.618) (-454.033) (-453.275) * (-454.786) [-455.451] (-454.962) (-455.420) -- 0:00:18
698500 -- [-452.893] (-456.111) (-454.080) (-458.417) * [-455.467] (-458.357) (-458.751) (-455.120) -- 0:00:18
699000 -- [-456.653] (-457.802) (-454.602) (-453.964) * (-459.386) [-454.067] (-454.915) (-454.867) -- 0:00:18
699500 -- (-455.750) (-457.511) [-453.291] (-453.266) * [-458.808] (-458.233) (-453.181) (-454.376) -- 0:00:18
700000 -- [-455.782] (-462.054) (-456.192) (-453.011) * (-456.850) (-455.141) (-456.551) [-453.106] -- 0:00:18
Average standard deviation of split frequencies: 0.007148
700500 -- (-455.519) (-461.485) (-453.825) [-453.304] * (-460.406) (-455.202) (-454.179) [-453.118] -- 0:00:17
701000 -- [-453.860] (-454.946) (-454.750) (-455.059) * [-455.276] (-454.166) (-457.482) (-454.190) -- 0:00:17
701500 -- (-455.094) [-456.794] (-453.952) (-460.272) * (-456.400) [-454.318] (-458.956) (-458.366) -- 0:00:17
702000 -- [-458.411] (-458.663) (-453.936) (-459.769) * [-452.941] (-453.211) (-454.929) (-454.883) -- 0:00:17
702500 -- (-455.168) (-456.863) (-455.492) [-458.040] * [-453.374] (-456.665) (-453.378) (-457.985) -- 0:00:17
703000 -- [-458.678] (-453.105) (-457.320) (-455.588) * (-457.223) (-453.978) (-453.994) [-455.057] -- 0:00:17
703500 -- [-455.059] (-455.639) (-452.907) (-454.612) * (-455.110) [-452.821] (-454.567) (-454.322) -- 0:00:18
704000 -- (-453.427) [-456.435] (-454.577) (-453.270) * (-453.312) [-455.250] (-455.558) (-453.362) -- 0:00:18
704500 -- (-453.386) (-457.488) (-453.697) [-458.705] * [-454.160] (-454.874) (-453.944) (-458.520) -- 0:00:18
705000 -- (-454.035) (-455.175) [-453.716] (-457.523) * [-453.811] (-453.948) (-454.035) (-454.256) -- 0:00:17
Average standard deviation of split frequencies: 0.007679
705500 -- (-454.152) (-455.082) [-455.308] (-455.586) * (-454.176) [-453.198] (-455.316) (-454.539) -- 0:00:17
706000 -- (-454.005) (-454.634) (-452.546) [-453.852] * (-454.544) [-456.220] (-453.645) (-456.275) -- 0:00:17
706500 -- (-453.686) [-455.078] (-452.865) (-455.420) * (-455.531) (-460.278) (-455.067) [-455.752] -- 0:00:17
707000 -- (-454.254) (-454.756) [-455.557] (-454.089) * [-455.962] (-454.726) (-453.754) (-454.017) -- 0:00:17
707500 -- (-454.096) (-455.890) [-455.680] (-454.204) * (-457.115) [-455.430] (-453.040) (-455.707) -- 0:00:17
708000 -- [-453.272] (-453.550) (-456.995) (-459.278) * (-453.444) (-458.255) (-454.653) [-456.965] -- 0:00:17
708500 -- (-454.493) (-453.732) [-457.660] (-458.378) * (-454.052) [-455.178] (-455.103) (-457.206) -- 0:00:17
709000 -- (-453.340) (-461.551) (-453.656) [-453.864] * (-454.816) (-456.523) (-454.731) [-455.014] -- 0:00:17
709500 -- [-453.062] (-456.315) (-457.242) (-454.142) * (-457.182) [-454.878] (-455.518) (-460.257) -- 0:00:17
710000 -- (-455.747) (-455.130) [-454.821] (-455.071) * [-453.912] (-453.660) (-453.556) (-457.643) -- 0:00:17
Average standard deviation of split frequencies: 0.007877
710500 -- (-454.691) [-454.075] (-454.066) (-454.181) * (-454.048) (-454.376) [-456.209] (-456.821) -- 0:00:17
711000 -- [-454.141] (-454.323) (-453.274) (-453.241) * [-453.203] (-454.195) (-456.447) (-458.031) -- 0:00:17
711500 -- (-454.728) (-454.266) (-453.143) [-455.397] * (-453.166) (-456.249) [-455.425] (-454.567) -- 0:00:17
712000 -- (-455.509) [-455.515] (-459.181) (-458.310) * (-459.274) (-456.726) (-457.329) [-454.292] -- 0:00:17
712500 -- (-455.557) [-455.609] (-458.251) (-456.927) * (-454.221) (-455.081) (-454.531) [-453.811] -- 0:00:17
713000 -- (-453.896) (-454.011) (-455.689) [-456.995] * (-452.872) [-456.727] (-453.581) (-457.318) -- 0:00:17
713500 -- [-456.284] (-454.408) (-453.527) (-454.334) * (-458.563) (-458.400) (-452.772) [-454.606] -- 0:00:17
714000 -- (-456.934) (-460.491) [-455.739] (-454.688) * (-453.720) [-453.446] (-453.721) (-454.414) -- 0:00:17
714500 -- (-462.197) (-458.613) [-455.447] (-454.656) * [-453.485] (-453.576) (-454.689) (-457.326) -- 0:00:17
715000 -- (-455.079) (-455.614) (-454.998) [-455.536] * (-453.487) [-453.855] (-454.976) (-457.855) -- 0:00:17
Average standard deviation of split frequencies: 0.008024
715500 -- (-454.687) (-452.719) [-458.190] (-456.618) * (-454.338) [-456.437] (-452.527) (-457.891) -- 0:00:17
716000 -- (-453.992) [-453.496] (-459.336) (-455.272) * (-454.492) (-455.789) [-453.966] (-454.928) -- 0:00:17
716500 -- (-453.417) (-453.910) [-454.920] (-457.250) * (-456.477) (-453.535) (-453.967) [-454.987] -- 0:00:17
717000 -- [-454.091] (-454.016) (-455.386) (-455.073) * [-457.168] (-454.739) (-459.437) (-457.650) -- 0:00:16
717500 -- (-454.347) [-452.969] (-453.912) (-453.850) * [-455.494] (-455.425) (-456.035) (-454.259) -- 0:00:16
718000 -- (-453.159) [-454.060] (-454.394) (-453.808) * (-458.617) (-457.081) [-454.582] (-455.895) -- 0:00:16
718500 -- [-453.152] (-456.181) (-457.475) (-456.187) * [-454.589] (-456.541) (-454.777) (-453.342) -- 0:00:16
719000 -- [-454.354] (-457.820) (-459.480) (-453.750) * [-457.435] (-454.347) (-458.069) (-461.318) -- 0:00:16
719500 -- [-454.943] (-454.140) (-456.827) (-452.999) * (-454.277) [-454.723] (-458.226) (-458.963) -- 0:00:16
720000 -- (-455.098) (-453.613) [-455.849] (-456.651) * [-454.619] (-455.210) (-453.149) (-458.811) -- 0:00:1 