--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:09:50 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lsr2/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -454.12 -457.17
2 -454.12 -457.58
--------------------------------------
TOTAL -454.12 -457.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904228 0.090900 0.383146 1.522487 0.868954 1372.99 1436.99 1.000
r(A<->C){all} 0.175587 0.021612 0.000112 0.472429 0.135603 161.57 214.69 1.000
r(A<->G){all} 0.163768 0.019740 0.000079 0.445035 0.126381 228.74 317.27 1.000
r(A<->T){all} 0.175010 0.021252 0.000122 0.464779 0.135511 218.51 221.70 1.002
r(C<->G){all} 0.160719 0.018957 0.000097 0.433414 0.125021 231.20 246.34 1.001
r(C<->T){all} 0.153467 0.016551 0.000114 0.415632 0.119684 231.26 238.59 1.001
r(G<->T){all} 0.171449 0.021724 0.000002 0.465562 0.129309 130.54 147.42 1.008
pi(A){all} 0.194257 0.000458 0.152742 0.236984 0.193655 1348.57 1352.05 1.000
pi(C){all} 0.262369 0.000541 0.214440 0.305420 0.261892 1057.80 1082.97 1.000
pi(G){all} 0.361054 0.000683 0.313022 0.416574 0.361167 1193.92 1269.64 1.000
pi(T){all} 0.182320 0.000424 0.145003 0.223687 0.181878 1002.92 1119.31 1.000
alpha{1,2} 0.407288 0.210734 0.000105 1.350321 0.244646 1099.26 1156.82 1.000
alpha{3} 0.452887 0.229311 0.000148 1.368754 0.298860 1213.04 1267.90 1.000
pinvar{all} 0.994992 0.000037 0.983474 0.999998 0.996902 1281.53 1381.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -438.932945
Model 2: PositiveSelection -438.932911
Model 0: one-ratio -438.932911
Model 7: beta -438.932963
Model 8: beta&w>1 -438.932911
Model 0 vs 1 6.800000005569018E-5
Model 2 vs 1 6.800000005569018E-5
Model 8 vs 7 1.0399999996479892E-4
>C1
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C2
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C3
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C4
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C5
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C6
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=112
C1 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C2 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C3 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C4 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C5 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C6 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
**************************************************
C1 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C2 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C3 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C4 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C5 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C6 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
**************************************************
C1 PADVIDAFHAAT
C2 PADVIDAFHAAT
C3 PADVIDAFHAAT
C4 PADVIDAFHAAT
C5 PADVIDAFHAAT
C6 PADVIDAFHAAT
************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 112 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 112 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3360]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3360]--->[3360]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.639 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C2 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C3 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C4 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C5 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
C6 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
**************************************************
C1 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C2 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C3 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C4 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C5 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
C6 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
**************************************************
C1 PADVIDAFHAAT
C2 PADVIDAFHAAT
C3 PADVIDAFHAAT
C4 PADVIDAFHAAT
C5 PADVIDAFHAAT
C6 PADVIDAFHAAT
************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C2 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C3 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C4 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C5 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
C6 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
**************************************************
C1 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C2 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C3 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C4 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C5 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
C6 CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
**************************************************
C1 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C2 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C3 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C4 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C5 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
C6 TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
**************************************************
C1 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C2 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C3 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C4 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C5 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
C6 TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
**************************************************
C1 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C2 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C3 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C4 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C5 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
C6 TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
**************************************************
C1 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C2 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C3 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C4 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C5 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
C6 GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
**************************************************
C1 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C2 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C3 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C4 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C5 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
C6 CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
************************************
>C1
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C2
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C3
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C4
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C5
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C6
ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG
CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA
TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA
TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA
TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC
GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT
CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>C1
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C2
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C3
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C4
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C5
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
>C6
MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAFHAAT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 336 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792111
Setting output file names to "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 338243029
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0001615192
Seed = 1532052708
Swapseed = 1579792111
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -751.984107 -- -24.965149
Chain 2 -- -751.984107 -- -24.965149
Chain 3 -- -751.983992 -- -24.965149
Chain 4 -- -751.984107 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -751.984107 -- -24.965149
Chain 2 -- -751.983992 -- -24.965149
Chain 3 -- -751.984107 -- -24.965149
Chain 4 -- -751.984107 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-751.984] (-751.984) (-751.984) (-751.984) * [-751.984] (-751.984) (-751.984) (-751.984)
500 -- (-472.853) [-471.552] (-473.227) (-464.764) * [-468.180] (-473.165) (-463.852) (-464.701) -- 0:00:00
1000 -- (-465.796) [-460.995] (-475.379) (-471.667) * [-460.072] (-484.642) (-463.918) (-463.187) -- 0:00:00
1500 -- (-465.951) [-461.243] (-471.618) (-465.191) * (-459.575) (-473.962) [-458.945] (-467.239) -- 0:00:00
2000 -- [-463.033] (-464.115) (-462.877) (-466.251) * (-463.852) (-478.438) (-462.195) [-467.897] -- 0:00:00
2500 -- (-473.250) [-466.483] (-463.021) (-462.699) * (-460.130) [-460.537] (-464.170) (-466.242) -- 0:00:00
3000 -- (-465.741) (-463.624) (-458.873) [-464.607] * [-460.661] (-464.004) (-466.724) (-464.967) -- 0:00:00
3500 -- (-459.181) [-460.181] (-466.904) (-457.949) * (-475.384) (-462.722) (-458.350) [-464.675] -- 0:00:00
4000 -- (-467.621) [-460.690] (-464.388) (-467.174) * (-460.844) (-462.646) (-466.040) [-469.409] -- 0:00:00
4500 -- (-460.664) (-472.336) (-469.324) [-461.016] * (-471.175) (-469.554) (-471.203) [-458.899] -- 0:00:00
5000 -- (-467.068) (-460.127) (-458.574) [-461.432] * [-461.979] (-459.347) (-466.959) (-468.268) -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-460.747) (-465.512) [-469.731] (-459.962) * (-460.807) (-460.186) [-459.737] (-465.109) -- 0:00:00
6000 -- (-464.399) (-464.867) (-468.716) [-459.760] * (-464.425) (-463.119) (-465.462) [-467.137] -- 0:00:00
6500 -- [-462.255] (-461.840) (-461.234) (-465.765) * [-463.217] (-463.281) (-470.515) (-475.337) -- 0:00:00
7000 -- (-471.043) [-457.133] (-463.090) (-474.555) * [-466.226] (-467.462) (-464.699) (-466.903) -- 0:00:00
7500 -- (-467.021) (-468.405) [-461.571] (-464.080) * (-466.022) [-462.430] (-467.270) (-477.790) -- 0:00:00
8000 -- (-466.611) [-473.334] (-473.232) (-463.027) * [-465.278] (-460.342) (-462.872) (-466.732) -- 0:00:00
8500 -- (-468.758) [-459.498] (-468.710) (-460.874) * (-461.153) (-464.713) (-463.860) [-469.221] -- 0:01:56
9000 -- [-458.970] (-465.236) (-464.080) (-460.786) * (-466.613) (-463.279) [-463.492] (-463.812) -- 0:01:50
9500 -- (-469.226) [-462.675] (-461.218) (-466.435) * (-464.002) [-461.526] (-459.567) (-470.580) -- 0:01:44
10000 -- (-477.456) (-466.512) (-464.000) [-459.156] * [-463.139] (-479.716) (-471.809) (-466.256) -- 0:01:39
Average standard deviation of split frequencies: 0.069780
10500 -- [-464.768] (-456.103) (-460.859) (-466.298) * (-457.614) (-462.995) [-462.691] (-473.133) -- 0:01:34
11000 -- (-472.527) (-463.771) (-460.827) [-465.158] * (-453.826) [-459.731] (-470.932) (-462.493) -- 0:01:29
11500 -- (-464.451) (-463.397) (-461.390) [-463.822] * [-455.817] (-463.324) (-465.908) (-470.724) -- 0:01:25
12000 -- (-456.352) (-462.801) (-470.094) [-463.448] * (-456.405) [-459.869] (-462.593) (-470.339) -- 0:01:22
12500 -- (-454.531) (-463.831) (-459.704) [-465.768] * (-453.583) (-466.323) [-464.746] (-460.598) -- 0:01:19
13000 -- (-453.422) [-456.778] (-466.935) (-458.837) * (-459.986) (-465.510) [-464.223] (-466.645) -- 0:01:15
13500 -- [-456.935] (-479.296) (-461.964) (-462.626) * (-456.897) (-465.637) (-470.300) [-468.159] -- 0:01:13
14000 -- [-455.005] (-473.019) (-466.224) (-462.394) * [-454.088] (-468.273) (-463.969) (-464.227) -- 0:01:10
14500 -- [-454.194] (-458.317) (-465.812) (-470.500) * (-454.757) (-467.202) [-456.447] (-464.214) -- 0:01:07
15000 -- (-455.672) (-459.698) (-466.467) [-463.071] * (-454.065) (-468.764) (-461.625) [-460.973] -- 0:01:05
Average standard deviation of split frequencies: 0.057192
15500 -- (-458.390) [-456.293] (-467.309) (-469.153) * (-453.993) [-461.901] (-470.252) (-470.971) -- 0:01:03
16000 -- (-458.778) (-456.922) (-482.227) [-463.844] * (-453.748) (-463.345) (-468.488) [-461.747] -- 0:01:01
16500 -- (-455.602) (-452.609) (-466.888) [-460.415] * (-454.542) [-462.160] (-469.068) (-464.060) -- 0:00:59
17000 -- (-454.475) (-453.782) (-468.704) [-464.272] * (-453.855) (-468.046) [-461.515] (-473.532) -- 0:00:57
17500 -- (-452.740) [-456.660] (-471.697) (-461.405) * (-455.849) (-471.829) (-464.893) [-466.563] -- 0:00:56
18000 -- (-453.664) (-453.287) (-461.672) [-460.609] * (-456.554) [-458.906] (-463.019) (-475.241) -- 0:00:54
18500 -- (-454.244) (-452.493) [-461.300] (-472.640) * (-456.766) (-466.916) (-460.391) [-462.764] -- 0:00:53
19000 -- (-456.814) (-457.981) [-467.909] (-465.836) * (-457.705) (-466.750) [-461.637] (-467.852) -- 0:00:51
19500 -- [-453.242] (-458.772) (-457.036) (-463.712) * (-453.631) [-463.840] (-475.414) (-464.514) -- 0:00:50
20000 -- (-456.490) (-456.553) [-467.182] (-460.853) * (-455.306) (-463.588) [-458.351] (-463.447) -- 0:00:49
Average standard deviation of split frequencies: 0.071113
20500 -- (-453.934) (-453.160) (-469.534) [-460.466] * [-454.286] (-459.987) (-460.474) (-459.314) -- 0:00:47
21000 -- (-454.964) (-453.423) (-471.716) [-460.498] * (-460.828) [-465.764] (-457.835) (-475.831) -- 0:00:46
21500 -- [-455.344] (-453.054) (-464.534) (-468.678) * (-456.020) (-462.147) (-474.465) [-461.126] -- 0:00:45
22000 -- [-456.234] (-452.935) (-460.360) (-462.425) * [-456.514] (-462.625) (-469.557) (-477.760) -- 0:00:44
22500 -- [-455.337] (-453.980) (-462.895) (-463.645) * (-456.454) [-459.583] (-458.547) (-472.267) -- 0:00:43
23000 -- (-458.321) [-454.295] (-464.582) (-464.844) * (-454.989) (-476.626) (-465.140) [-461.551] -- 0:01:24
23500 -- (-454.314) (-453.984) [-462.528] (-458.912) * [-453.968] (-461.726) (-466.322) (-469.804) -- 0:01:23
24000 -- (-455.396) [-453.476] (-460.415) (-462.653) * (-454.504) (-460.043) (-466.692) [-460.987] -- 0:01:21
24500 -- [-455.706] (-453.007) (-471.852) (-466.136) * (-454.614) (-469.582) (-461.758) [-462.399] -- 0:01:19
25000 -- (-453.888) (-454.698) [-458.552] (-468.482) * [-454.632] (-464.401) (-463.118) (-468.063) -- 0:01:18
Average standard deviation of split frequencies: 0.055256
25500 -- (-461.948) (-454.126) [-465.698] (-470.406) * [-455.766] (-465.400) (-460.783) (-475.522) -- 0:01:16
26000 -- (-453.554) (-454.810) [-467.950] (-467.263) * (-454.954) (-472.239) (-462.429) [-458.146] -- 0:01:14
26500 -- (-455.008) [-456.377] (-473.883) (-457.476) * (-457.532) (-464.850) [-460.780] (-454.372) -- 0:01:13
27000 -- (-454.362) (-456.628) (-467.542) [-459.870] * (-455.351) (-467.419) [-461.622] (-453.395) -- 0:01:12
27500 -- [-455.045] (-457.231) (-467.637) (-463.559) * (-457.377) (-464.794) [-462.978] (-455.212) -- 0:01:10
28000 -- (-455.261) [-455.564] (-462.052) (-469.807) * (-453.931) (-464.320) [-460.524] (-453.790) -- 0:01:09
28500 -- [-457.776] (-454.460) (-469.121) (-464.240) * (-454.309) [-462.931] (-463.274) (-452.825) -- 0:01:08
29000 -- (-453.251) (-456.209) [-463.836] (-465.366) * (-453.673) [-462.584] (-464.888) (-455.738) -- 0:01:06
29500 -- (-456.829) [-452.834] (-468.346) (-459.840) * [-453.482] (-463.450) (-475.231) (-455.439) -- 0:01:05
30000 -- (-463.192) [-455.532] (-462.990) (-463.729) * (-453.359) (-467.380) [-465.158] (-457.098) -- 0:01:04
Average standard deviation of split frequencies: 0.052588
30500 -- (-454.798) (-455.608) (-462.841) [-461.503] * [-453.246] (-464.012) (-463.953) (-456.245) -- 0:01:03
31000 -- (-455.926) (-457.271) (-456.847) [-464.685] * (-459.551) (-467.548) (-463.970) [-454.153] -- 0:01:02
31500 -- (-455.321) (-455.255) (-466.743) [-462.133] * (-454.019) (-471.983) (-465.650) [-452.861] -- 0:01:01
32000 -- (-455.617) (-453.131) [-465.706] (-462.651) * (-453.442) (-468.210) (-461.484) [-453.059] -- 0:01:00
32500 -- (-455.683) (-453.850) [-461.368] (-467.172) * (-455.811) [-468.000] (-462.176) (-456.974) -- 0:00:59
33000 -- (-454.721) (-455.677) [-460.924] (-469.311) * [-457.741] (-466.002) (-461.633) (-453.889) -- 0:00:58
33500 -- [-455.775] (-455.339) (-465.394) (-463.434) * (-455.016) (-468.722) (-464.678) [-453.390] -- 0:00:57
34000 -- (-455.494) [-453.229] (-462.490) (-467.892) * (-455.751) (-463.781) [-461.927] (-453.140) -- 0:00:56
34500 -- [-452.733] (-454.878) (-458.283) (-470.253) * (-456.694) [-467.950] (-464.028) (-455.065) -- 0:00:55
35000 -- (-452.865) [-453.390] (-475.398) (-463.600) * (-456.445) (-458.132) [-463.315] (-455.557) -- 0:00:55
Average standard deviation of split frequencies: 0.044108
35500 -- (-456.285) [-453.588] (-454.068) (-462.596) * (-453.578) (-468.024) [-459.866] (-453.810) -- 0:00:54
36000 -- [-453.359] (-454.473) (-455.169) (-460.725) * [-453.098] (-460.147) (-465.725) (-454.358) -- 0:00:53
36500 -- (-455.845) [-454.830] (-453.521) (-454.891) * (-453.244) (-466.623) (-462.651) [-454.203] -- 0:00:52
37000 -- (-454.375) (-458.777) [-453.635] (-454.976) * (-455.309) (-465.366) [-463.637] (-455.295) -- 0:00:52
37500 -- [-457.343] (-458.812) (-453.796) (-458.220) * [-455.592] (-465.994) (-464.354) (-456.383) -- 0:00:51
38000 -- (-453.584) [-456.113] (-453.932) (-453.731) * [-456.963] (-460.911) (-468.138) (-457.293) -- 0:01:15
38500 -- (-454.959) [-458.353] (-453.865) (-456.169) * (-453.076) (-465.366) (-464.665) [-453.852] -- 0:01:14
39000 -- [-454.523] (-454.391) (-452.859) (-456.382) * (-453.226) (-466.553) [-461.243] (-454.056) -- 0:01:13
39500 -- (-455.262) (-453.994) [-452.932] (-455.228) * [-453.849] (-468.164) (-465.803) (-457.262) -- 0:01:12
40000 -- (-456.920) (-455.759) [-452.548] (-456.346) * (-460.383) [-459.124] (-464.392) (-453.943) -- 0:01:12
Average standard deviation of split frequencies: 0.039657
40500 -- [-454.516] (-454.857) (-454.725) (-453.334) * (-453.827) (-468.140) [-460.508] (-456.168) -- 0:01:11
41000 -- (-455.303) (-453.673) [-455.467] (-454.969) * (-456.540) (-464.762) [-462.272] (-454.678) -- 0:01:10
41500 -- (-455.078) (-454.215) (-455.245) [-452.747] * (-458.696) [-463.211] (-464.031) (-453.063) -- 0:01:09
42000 -- (-452.886) (-457.132) [-456.343] (-456.340) * (-463.095) (-469.929) [-457.051] (-456.449) -- 0:01:08
42500 -- (-453.685) [-453.501] (-456.549) (-457.835) * (-462.223) (-472.100) [-460.237] (-458.575) -- 0:01:07
43000 -- [-454.030] (-454.482) (-461.278) (-457.055) * (-459.310) (-465.653) [-467.756] (-454.762) -- 0:01:06
43500 -- (-456.355) (-455.125) (-456.618) [-454.431] * (-455.173) (-466.298) (-477.375) [-455.744] -- 0:01:05
44000 -- [-453.023] (-456.990) (-456.107) (-455.469) * (-454.971) (-463.660) (-464.074) [-453.159] -- 0:01:05
44500 -- (-462.414) [-456.155] (-454.339) (-453.441) * (-457.673) (-460.822) [-463.660] (-457.818) -- 0:01:04
45000 -- [-458.248] (-455.504) (-454.764) (-454.376) * (-454.044) [-459.596] (-464.650) (-454.339) -- 0:01:03
Average standard deviation of split frequencies: 0.027157
45500 -- (-456.541) (-454.787) [-453.723] (-453.829) * (-456.881) (-459.313) (-473.020) [-454.729] -- 0:01:02
46000 -- (-454.115) (-457.694) (-452.988) [-453.028] * (-459.717) (-461.761) [-462.008] (-457.135) -- 0:01:02
46500 -- (-454.297) [-455.604] (-453.733) (-456.090) * (-458.306) (-466.287) [-463.333] (-455.481) -- 0:01:01
47000 -- (-453.286) (-454.858) [-453.993] (-456.500) * (-453.176) (-461.404) (-468.070) [-452.571] -- 0:01:00
47500 -- (-454.160) (-453.397) (-453.849) [-455.676] * (-456.466) (-462.594) [-465.913] (-457.009) -- 0:01:00
48000 -- (-454.449) [-454.150] (-452.936) (-455.645) * (-458.071) (-464.365) [-464.078] (-454.564) -- 0:00:59
48500 -- (-457.496) (-456.506) [-455.256] (-455.670) * [-457.210] (-467.942) (-463.241) (-455.266) -- 0:00:58
49000 -- (-453.916) (-458.615) [-454.516] (-454.475) * (-458.594) [-464.147] (-465.466) (-455.645) -- 0:00:58
49500 -- (-453.116) (-453.594) (-456.238) [-452.794] * (-455.008) [-453.811] (-465.639) (-454.626) -- 0:00:57
50000 -- [-454.825] (-453.473) (-455.273) (-453.145) * (-453.908) (-458.255) (-470.454) [-454.918] -- 0:00:57
Average standard deviation of split frequencies: 0.023260
50500 -- (-459.059) (-457.546) [-456.180] (-455.537) * (-459.618) (-456.546) (-474.262) [-453.383] -- 0:00:56
51000 -- (-458.367) [-454.538] (-453.287) (-455.206) * (-455.965) [-455.440] (-464.840) (-454.577) -- 0:00:55
51500 -- (-456.923) [-453.639] (-455.974) (-455.162) * (-456.467) (-453.784) (-467.683) [-455.368] -- 0:01:13
52000 -- (-455.396) (-455.505) [-452.626] (-456.296) * (-455.771) (-454.180) (-469.109) [-457.733] -- 0:01:12
52500 -- [-455.422] (-454.707) (-454.976) (-455.320) * [-452.864] (-454.787) (-465.200) (-453.572) -- 0:01:12
53000 -- (-454.380) (-455.531) (-453.553) [-453.078] * (-455.510) (-454.306) (-464.640) [-453.134] -- 0:01:11
53500 -- (-453.773) [-455.723] (-453.318) (-455.467) * (-454.980) [-453.531] (-460.162) (-455.537) -- 0:01:10
54000 -- (-457.029) (-455.029) [-453.347] (-454.373) * (-454.266) [-456.941] (-461.525) (-455.654) -- 0:01:10
54500 -- (-459.704) [-453.352] (-453.296) (-458.428) * (-456.569) (-454.424) (-463.562) [-453.146] -- 0:01:09
55000 -- [-455.744] (-454.591) (-454.116) (-453.488) * (-453.909) [-457.389] (-463.902) (-453.538) -- 0:01:08
Average standard deviation of split frequencies: 0.023925
55500 -- (-454.555) [-453.551] (-453.167) (-463.591) * (-456.166) (-454.262) [-462.419] (-454.206) -- 0:01:08
56000 -- (-459.127) [-455.846] (-455.507) (-455.155) * (-456.031) (-453.651) (-464.858) [-453.027] -- 0:01:07
56500 -- (-452.928) (-455.553) (-455.529) [-453.904] * [-453.057] (-453.881) (-463.640) (-452.851) -- 0:01:06
57000 -- (-453.653) [-453.543] (-459.691) (-452.917) * (-453.635) (-454.533) [-465.412] (-454.110) -- 0:01:06
57500 -- [-456.903] (-456.729) (-453.564) (-455.533) * (-454.187) [-456.230] (-469.582) (-454.311) -- 0:01:05
58000 -- (-454.243) (-453.958) (-454.809) [-454.434] * (-455.885) (-461.414) (-461.417) [-454.822] -- 0:01:04
58500 -- [-453.647] (-453.731) (-453.863) (-454.294) * (-454.341) [-458.662] (-463.041) (-454.313) -- 0:01:04
59000 -- (-454.023) [-454.850] (-453.955) (-458.044) * [-454.132] (-455.753) (-473.072) (-453.982) -- 0:01:03
59500 -- (-453.878) (-454.474) (-454.217) [-454.574] * (-455.192) (-453.374) [-462.610] (-453.790) -- 0:01:03
60000 -- (-456.318) [-455.053] (-455.634) (-452.630) * (-457.185) (-454.444) [-462.436] (-454.200) -- 0:01:02
Average standard deviation of split frequencies: 0.022880
60500 -- (-452.752) [-456.116] (-454.785) (-458.249) * (-453.124) (-456.577) [-458.810] (-454.775) -- 0:01:02
61000 -- (-453.759) (-456.453) (-454.283) [-458.878] * [-459.224] (-456.630) (-468.260) (-453.964) -- 0:01:01
61500 -- (-453.555) [-456.139] (-453.411) (-453.615) * [-454.282] (-456.353) (-479.166) (-453.569) -- 0:01:01
62000 -- (-455.449) [-453.628] (-452.883) (-456.484) * (-457.970) [-454.413] (-466.288) (-453.498) -- 0:01:00
62500 -- (-455.794) (-453.753) [-454.223] (-454.714) * (-455.531) [-454.234] (-464.665) (-454.799) -- 0:01:00
63000 -- (-453.126) (-454.231) (-456.078) [-454.079] * (-455.310) [-453.855] (-469.819) (-455.801) -- 0:00:59
63500 -- [-455.977] (-454.145) (-455.550) (-453.877) * (-458.129) [-453.626] (-464.088) (-461.199) -- 0:00:58
64000 -- [-454.899] (-452.987) (-455.173) (-456.297) * (-455.798) [-454.147] (-466.159) (-457.475) -- 0:00:58
64500 -- (-454.351) (-454.552) (-454.447) [-452.534] * (-456.225) [-454.603] (-465.112) (-452.859) -- 0:00:58
65000 -- (-458.309) (-459.909) (-455.030) [-453.581] * [-454.163] (-454.811) (-459.341) (-457.977) -- 0:00:57
Average standard deviation of split frequencies: 0.022788
65500 -- (-461.192) (-458.492) [-460.115] (-455.037) * [-457.351] (-455.835) (-467.892) (-456.256) -- 0:00:57
66000 -- (-456.140) [-454.810] (-458.072) (-452.477) * (-454.858) (-456.547) [-456.278] (-455.498) -- 0:00:56
66500 -- (-458.110) (-455.078) [-454.038] (-453.199) * (-452.667) (-456.378) (-454.484) [-453.878] -- 0:00:56
67000 -- (-458.188) (-455.234) [-454.521] (-457.547) * [-453.282] (-455.676) (-453.435) (-455.791) -- 0:00:55
67500 -- (-459.021) (-453.139) (-455.110) [-453.393] * (-454.958) [-453.729] (-456.584) (-456.612) -- 0:01:09
68000 -- (-458.926) [-453.803] (-453.322) (-455.211) * [-454.116] (-454.073) (-454.510) (-455.272) -- 0:01:08
68500 -- [-455.696] (-455.612) (-457.644) (-453.114) * (-458.630) (-454.647) [-454.894] (-457.851) -- 0:01:07
69000 -- (-454.040) (-456.194) (-453.315) [-452.907] * (-457.789) [-456.376] (-452.630) (-454.562) -- 0:01:07
69500 -- [-455.277] (-460.062) (-453.308) (-453.725) * (-457.246) (-459.004) [-453.287] (-453.630) -- 0:01:06
70000 -- (-454.610) [-455.319] (-454.346) (-454.200) * (-459.405) (-454.798) (-452.462) [-453.534] -- 0:01:06
Average standard deviation of split frequencies: 0.024460
70500 -- (-456.397) (-460.368) (-452.798) [-453.450] * [-454.882] (-453.212) (-453.734) (-457.756) -- 0:01:05
71000 -- (-454.752) [-453.543] (-452.955) (-458.955) * (-453.601) (-454.651) [-455.499] (-457.407) -- 0:01:05
71500 -- [-455.232] (-454.132) (-457.656) (-453.638) * [-454.345] (-453.229) (-453.564) (-454.928) -- 0:01:04
72000 -- (-454.639) [-456.310] (-454.783) (-454.552) * (-455.044) (-459.352) (-456.122) [-454.331] -- 0:01:04
72500 -- (-454.826) (-454.472) [-455.886] (-454.857) * (-455.153) (-456.458) (-452.903) [-454.904] -- 0:01:03
73000 -- [-454.670] (-452.902) (-455.267) (-456.393) * (-459.384) (-452.576) (-453.132) [-457.333] -- 0:01:03
73500 -- (-453.149) (-453.647) (-453.256) [-454.275] * (-453.612) [-452.706] (-454.364) (-453.508) -- 0:01:03
74000 -- (-457.708) (-453.318) [-454.360] (-454.222) * [-453.836] (-455.408) (-457.543) (-454.953) -- 0:01:02
74500 -- (-454.758) (-454.908) (-461.247) [-457.544] * (-454.220) (-454.228) (-454.521) [-453.905] -- 0:01:02
75000 -- (-456.771) (-454.672) (-454.853) [-456.337] * [-459.020] (-454.137) (-453.344) (-453.407) -- 0:01:01
Average standard deviation of split frequencies: 0.023831
75500 -- (-454.015) (-454.153) [-453.518] (-458.412) * [-454.569] (-458.861) (-456.971) (-453.488) -- 0:01:01
76000 -- (-456.049) [-453.575] (-455.224) (-454.619) * (-454.169) [-454.254] (-455.509) (-454.782) -- 0:01:00
76500 -- (-457.084) (-453.601) (-455.860) [-455.853] * (-452.644) (-454.740) (-455.536) [-454.150] -- 0:01:00
77000 -- [-453.664] (-457.247) (-454.425) (-454.731) * (-453.206) [-454.465] (-457.130) (-453.278) -- 0:00:59
77500 -- (-455.138) [-457.482] (-453.656) (-457.196) * [-453.134] (-455.089) (-456.203) (-453.172) -- 0:00:59
78000 -- [-454.236] (-454.799) (-456.333) (-453.975) * [-455.332] (-456.479) (-455.896) (-455.021) -- 0:00:59
78500 -- [-455.048] (-456.267) (-453.625) (-456.581) * (-455.065) [-455.423] (-454.946) (-454.697) -- 0:00:58
79000 -- [-453.776] (-454.675) (-453.585) (-453.515) * (-454.461) (-453.777) [-453.042] (-454.829) -- 0:00:58
79500 -- [-453.346] (-454.911) (-460.101) (-454.253) * (-453.932) (-457.546) [-456.134] (-454.552) -- 0:00:57
80000 -- (-454.126) [-452.726] (-454.530) (-453.751) * (-456.986) [-456.716] (-453.221) (-453.782) -- 0:00:57
Average standard deviation of split frequencies: 0.020454
80500 -- (-456.771) [-457.665] (-454.358) (-453.153) * (-454.954) [-455.935] (-453.565) (-454.215) -- 0:00:57
81000 -- (-453.401) [-456.198] (-453.555) (-453.603) * (-460.936) (-453.173) (-454.010) [-453.891] -- 0:00:56
81500 -- (-457.782) (-453.805) (-454.114) [-455.833] * (-457.946) (-455.124) [-456.129] (-453.064) -- 0:00:56
82000 -- [-456.165] (-452.955) (-455.948) (-462.116) * (-454.216) (-454.160) [-453.999] (-454.162) -- 0:00:55
82500 -- (-453.381) [-455.290] (-454.857) (-455.440) * (-455.509) (-454.234) (-455.660) [-452.936] -- 0:00:55
83000 -- [-454.676] (-453.755) (-458.001) (-462.593) * [-454.536] (-455.218) (-461.039) (-454.824) -- 0:00:55
83500 -- (-453.058) [-453.068] (-460.672) (-455.890) * (-457.898) (-456.738) (-457.193) [-456.946] -- 0:00:54
84000 -- (-454.872) (-452.713) (-456.640) [-455.222] * (-457.828) (-454.750) [-454.791] (-455.202) -- 0:00:54
84500 -- (-455.151) [-453.429] (-455.832) (-456.055) * (-454.114) (-454.388) (-454.376) [-453.048] -- 0:01:05
85000 -- (-457.845) [-454.095] (-455.157) (-453.538) * [-454.305] (-453.959) (-453.907) (-454.886) -- 0:01:04
Average standard deviation of split frequencies: 0.020483
85500 -- (-454.844) (-454.708) [-456.814] (-454.052) * [-456.390] (-456.649) (-454.366) (-460.343) -- 0:01:04
86000 -- (-453.923) (-454.916) (-453.692) [-455.896] * (-455.349) [-453.460] (-453.522) (-454.881) -- 0:01:03
86500 -- [-454.209] (-455.710) (-460.333) (-456.086) * [-453.272] (-454.372) (-454.858) (-453.944) -- 0:01:03
87000 -- (-455.554) (-454.189) (-456.210) [-454.673] * (-453.467) (-454.326) [-453.809] (-455.864) -- 0:01:02
87500 -- (-453.147) (-455.945) [-453.914] (-454.095) * [-454.557] (-455.139) (-458.039) (-455.320) -- 0:01:02
88000 -- [-453.310] (-454.114) (-453.339) (-453.550) * [-453.287] (-457.438) (-459.401) (-452.707) -- 0:01:02
88500 -- (-454.026) [-454.828] (-453.147) (-457.734) * (-453.515) [-452.985] (-453.910) (-455.358) -- 0:01:01
89000 -- (-455.109) (-457.394) (-455.920) [-458.551] * (-456.594) [-453.678] (-454.810) (-455.181) -- 0:01:01
89500 -- (-454.646) (-453.933) [-454.250] (-458.615) * (-457.771) (-453.848) [-454.096] (-454.681) -- 0:01:01
90000 -- (-455.385) [-453.932] (-454.000) (-459.379) * [-457.565] (-456.279) (-454.696) (-459.237) -- 0:01:00
Average standard deviation of split frequencies: 0.020250
90500 -- (-454.474) (-454.571) (-455.340) [-454.518] * (-456.986) (-455.638) (-455.978) [-455.427] -- 0:01:00
91000 -- (-454.679) (-454.789) [-456.875] (-454.212) * (-456.655) (-455.275) [-454.048] (-453.408) -- 0:00:59
91500 -- [-453.850] (-455.411) (-454.567) (-454.336) * (-457.406) [-455.680] (-454.278) (-457.009) -- 0:00:59
92000 -- (-453.517) (-461.359) (-452.920) [-453.633] * (-456.370) [-455.641] (-453.937) (-455.968) -- 0:00:59
92500 -- (-455.318) (-457.627) [-453.261] (-455.477) * (-458.765) (-454.439) [-459.248] (-454.158) -- 0:00:58
93000 -- (-454.917) (-453.557) [-454.170] (-458.778) * (-457.550) (-454.590) [-453.383] (-456.134) -- 0:00:58
93500 -- [-456.037] (-455.134) (-457.755) (-455.634) * (-458.470) (-456.460) (-456.097) [-456.338] -- 0:00:58
94000 -- (-456.546) (-455.971) (-456.222) [-456.228] * (-455.264) (-453.880) (-456.719) [-454.502] -- 0:00:57
94500 -- (-455.113) [-454.160] (-453.895) (-457.720) * (-457.029) (-454.051) [-456.768] (-455.406) -- 0:00:57
95000 -- [-453.147] (-457.932) (-454.427) (-455.210) * (-454.420) [-452.627] (-455.865) (-454.846) -- 0:00:57
Average standard deviation of split frequencies: 0.021709
95500 -- [-452.893] (-455.470) (-456.061) (-454.210) * (-455.879) [-452.878] (-458.698) (-454.670) -- 0:00:56
96000 -- [-454.405] (-452.983) (-454.492) (-455.658) * (-457.027) (-454.065) [-453.765] (-459.900) -- 0:00:56
96500 -- (-453.671) (-456.946) (-454.792) [-457.978] * [-455.313] (-454.403) (-455.794) (-457.065) -- 0:00:56
97000 -- (-454.684) (-455.915) (-452.829) [-453.797] * (-454.369) (-453.802) [-454.041] (-455.868) -- 0:00:55
97500 -- (-453.440) (-453.820) [-455.447] (-453.936) * (-455.593) (-454.390) (-456.177) [-453.611] -- 0:00:55
98000 -- (-452.957) (-456.027) (-453.138) [-453.193] * (-453.848) [-452.897] (-454.912) (-452.931) -- 0:00:55
98500 -- (-453.200) [-453.650] (-455.293) (-453.148) * (-455.535) [-453.428] (-456.431) (-455.589) -- 0:00:54
99000 -- (-453.183) (-454.851) [-453.358] (-454.228) * (-455.652) (-455.584) [-458.120] (-458.463) -- 0:00:54
99500 -- (-453.196) (-454.915) (-454.474) [-456.825] * [-453.658] (-456.403) (-453.079) (-457.412) -- 0:00:54
100000 -- [-456.616] (-454.676) (-455.595) (-453.711) * (-453.995) (-457.815) (-453.099) [-454.533] -- 0:00:54
Average standard deviation of split frequencies: 0.020032
100500 -- (-458.386) [-455.918] (-453.605) (-453.011) * (-452.599) [-458.206] (-453.223) (-454.436) -- 0:00:53
101000 -- (-454.799) [-455.263] (-455.444) (-456.329) * [-452.818] (-456.446) (-454.521) (-453.154) -- 0:00:53
101500 -- (-453.936) (-458.088) (-453.050) [-455.297] * (-457.333) (-456.271) (-463.533) [-453.136] -- 0:01:01
102000 -- (-455.854) [-454.579] (-453.743) (-454.144) * [-453.514] (-457.792) (-452.640) (-453.733) -- 0:01:01
102500 -- [-455.328] (-457.513) (-456.225) (-452.545) * (-455.383) (-458.191) [-453.942] (-457.254) -- 0:01:01
103000 -- (-454.338) [-454.402] (-459.921) (-453.090) * (-454.176) [-458.564] (-458.270) (-453.317) -- 0:01:00
103500 -- (-455.578) (-454.768) [-454.480] (-457.947) * (-457.131) (-457.392) [-456.017] (-454.565) -- 0:01:00
104000 -- (-454.460) [-456.039] (-454.528) (-453.245) * (-456.022) (-453.632) (-453.379) [-453.448] -- 0:01:00
104500 -- (-461.868) (-458.660) [-456.190] (-456.364) * (-454.676) (-454.389) [-453.940] (-455.039) -- 0:00:59
105000 -- [-461.247] (-457.423) (-460.025) (-453.178) * (-452.982) (-452.921) [-452.785] (-457.432) -- 0:00:59
Average standard deviation of split frequencies: 0.021495
105500 -- (-458.319) [-454.473] (-458.637) (-455.810) * (-455.720) [-453.323] (-456.296) (-454.302) -- 0:00:59
106000 -- (-454.375) (-455.966) (-454.227) [-456.965] * [-455.918] (-456.936) (-454.505) (-453.218) -- 0:00:59
106500 -- (-455.576) [-453.425] (-456.666) (-454.632) * [-453.623] (-456.099) (-454.376) (-452.849) -- 0:00:58
107000 -- (-455.123) [-455.952] (-454.179) (-455.577) * (-455.897) (-459.322) (-456.864) [-453.558] -- 0:00:58
107500 -- [-457.297] (-455.190) (-456.855) (-454.309) * [-453.347] (-455.487) (-453.132) (-455.660) -- 0:00:58
108000 -- (-457.798) (-452.594) (-454.919) [-454.473] * (-453.316) (-458.527) [-454.848] (-457.879) -- 0:00:57
108500 -- (-457.284) (-455.257) (-455.306) [-454.888] * (-453.889) (-454.854) [-454.648] (-455.744) -- 0:00:57
109000 -- (-458.340) (-457.181) (-455.479) [-456.135] * (-454.385) (-456.424) [-455.806] (-457.124) -- 0:00:57
109500 -- (-457.422) (-455.252) (-454.227) [-453.123] * (-455.691) [-454.561] (-454.206) (-454.114) -- 0:00:56
110000 -- (-454.308) (-454.210) (-455.917) [-454.512] * (-454.536) (-456.479) (-456.863) [-454.648] -- 0:00:56
Average standard deviation of split frequencies: 0.019642
110500 -- [-456.792] (-453.881) (-457.833) (-458.677) * (-453.644) (-453.279) [-453.484] (-453.342) -- 0:00:56
111000 -- (-454.730) (-454.143) [-456.283] (-457.864) * [-455.506] (-458.811) (-453.551) (-453.668) -- 0:00:56
111500 -- (-454.284) (-453.413) (-453.850) [-457.121] * [-453.037] (-453.377) (-455.357) (-456.346) -- 0:00:55
112000 -- [-454.481] (-455.868) (-458.240) (-456.826) * (-453.672) (-453.705) [-453.837] (-456.304) -- 0:00:55
112500 -- [-454.860] (-455.615) (-452.712) (-456.331) * (-453.805) [-452.764] (-454.615) (-455.853) -- 0:00:55
113000 -- (-453.939) [-455.119] (-458.422) (-457.360) * (-453.088) (-453.398) [-455.692] (-457.827) -- 0:00:54
113500 -- [-456.011] (-453.019) (-456.203) (-456.695) * (-455.176) [-453.686] (-454.785) (-458.717) -- 0:00:54
114000 -- (-456.334) (-453.277) (-455.069) [-454.663] * (-456.330) (-454.094) [-453.323] (-458.854) -- 0:00:54
114500 -- (-455.070) [-454.163] (-454.516) (-455.672) * (-456.367) (-454.952) [-456.395] (-456.627) -- 0:00:54
115000 -- (-454.184) (-456.032) (-458.040) [-455.435] * [-456.288] (-452.580) (-452.957) (-455.580) -- 0:00:53
Average standard deviation of split frequencies: 0.019642
115500 -- [-452.708] (-453.475) (-456.668) (-455.670) * (-455.339) (-452.934) (-455.869) [-457.521] -- 0:00:53
116000 -- (-456.219) [-457.965] (-457.021) (-457.390) * (-455.810) (-457.829) (-458.681) [-454.974] -- 0:00:53
116500 -- (-457.534) (-454.675) [-455.635] (-456.918) * [-454.628] (-454.125) (-454.195) (-454.245) -- 0:00:53
117000 -- (-457.572) (-453.950) [-455.212] (-457.903) * (-456.942) (-456.446) (-456.342) [-457.493] -- 0:00:52
117500 -- (-455.010) (-458.413) (-454.922) [-453.068] * (-457.798) (-456.289) (-454.257) [-455.271] -- 0:00:52
118000 -- [-454.165] (-456.972) (-456.095) (-454.002) * (-455.080) (-455.000) (-455.525) [-454.984] -- 0:00:52
118500 -- (-454.918) (-455.984) [-455.747] (-453.170) * (-457.736) (-453.104) (-454.836) [-454.604] -- 0:00:59
119000 -- (-453.449) [-454.069] (-454.395) (-455.400) * (-455.281) (-452.732) (-456.849) [-457.003] -- 0:00:59
119500 -- (-454.462) [-454.493] (-454.747) (-455.406) * [-455.022] (-455.944) (-458.143) (-455.255) -- 0:00:58
120000 -- (-460.048) (-452.808) [-453.597] (-457.821) * (-453.294) (-454.001) [-454.926] (-454.079) -- 0:00:58
Average standard deviation of split frequencies: 0.021270
120500 -- (-454.427) (-455.737) (-453.405) [-453.395] * (-453.893) (-454.559) (-455.564) [-457.872] -- 0:00:58
121000 -- (-454.270) (-456.980) [-457.532] (-457.771) * (-455.001) (-458.891) (-455.048) [-455.070] -- 0:00:58
121500 -- (-457.590) (-455.528) (-455.102) [-458.734] * (-454.068) (-455.283) (-453.571) [-455.503] -- 0:00:57
122000 -- [-454.500] (-455.916) (-454.311) (-463.016) * (-454.509) [-453.731] (-453.690) (-454.289) -- 0:00:57
122500 -- (-453.207) (-458.008) [-453.475] (-460.185) * (-457.510) (-457.260) [-453.290] (-457.745) -- 0:00:57
123000 -- (-454.765) (-455.014) (-454.818) [-459.328] * (-453.977) (-456.227) (-454.668) [-454.147] -- 0:00:57
123500 -- [-453.533] (-453.389) (-455.589) (-454.242) * (-457.322) (-460.069) [-456.042] (-456.988) -- 0:00:56
124000 -- (-453.458) [-452.940] (-457.282) (-453.718) * (-454.592) [-453.930] (-455.472) (-453.213) -- 0:00:56
124500 -- (-454.380) [-454.327] (-454.552) (-458.508) * (-454.845) (-452.819) (-454.895) [-453.620] -- 0:00:56
125000 -- (-454.656) (-453.332) [-455.138] (-454.220) * (-454.874) (-454.263) (-453.341) [-454.011] -- 0:00:56
Average standard deviation of split frequencies: 0.021857
125500 -- (-454.661) (-453.369) [-455.304] (-454.891) * (-454.907) (-457.871) [-454.819] (-453.072) -- 0:00:55
126000 -- (-455.382) (-453.913) [-454.579] (-453.514) * (-455.077) (-453.704) (-454.992) [-453.083] -- 0:00:55
126500 -- (-454.255) [-453.791] (-456.510) (-453.707) * [-453.486] (-453.857) (-453.629) (-454.190) -- 0:00:55
127000 -- (-453.987) (-455.399) (-456.664) [-454.519] * [-455.442] (-461.414) (-453.327) (-454.982) -- 0:00:54
127500 -- [-455.280] (-454.718) (-454.276) (-453.690) * (-452.893) [-453.273] (-453.258) (-455.798) -- 0:00:54
128000 -- (-455.002) (-458.600) (-458.216) [-455.438] * (-453.063) (-455.228) [-453.522] (-456.165) -- 0:00:54
128500 -- (-453.494) [-455.469] (-455.654) (-454.767) * (-453.947) [-456.329] (-455.592) (-453.445) -- 0:00:54
129000 -- (-454.242) (-456.105) [-456.257] (-454.146) * (-460.370) (-454.929) [-454.961] (-453.361) -- 0:00:54
129500 -- (-454.285) (-453.738) [-453.574] (-453.022) * (-454.133) (-455.887) [-455.247] (-454.200) -- 0:00:53
130000 -- (-454.448) (-454.810) (-454.783) [-453.510] * (-456.023) (-452.901) (-454.532) [-452.962] -- 0:00:53
Average standard deviation of split frequencies: 0.021646
130500 -- (-454.744) [-457.014] (-453.548) (-455.746) * (-453.643) [-453.604] (-458.391) (-455.372) -- 0:00:53
131000 -- (-453.193) (-453.646) [-453.461] (-455.441) * [-454.179] (-455.285) (-453.699) (-460.274) -- 0:00:53
131500 -- (-456.193) (-453.612) [-452.824] (-455.652) * (-455.366) (-462.749) [-453.700] (-453.591) -- 0:00:52
132000 -- (-457.473) (-452.894) [-453.876] (-454.519) * (-453.856) (-457.300) (-456.088) [-455.308] -- 0:00:52
132500 -- (-457.596) (-453.463) (-456.177) [-455.980] * (-454.426) (-454.878) (-453.461) [-454.035] -- 0:00:52
133000 -- (-460.962) (-452.591) [-454.074] (-456.504) * (-454.053) (-453.319) (-454.196) [-455.726] -- 0:00:52
133500 -- (-457.175) (-453.097) (-454.621) [-454.971] * (-455.080) (-453.893) (-455.268) [-457.295] -- 0:00:51
134000 -- (-458.185) [-453.273] (-454.762) (-454.575) * (-454.844) (-453.124) [-454.487] (-454.717) -- 0:00:51
134500 -- (-456.479) [-453.055] (-454.131) (-453.494) * [-453.590] (-455.172) (-454.066) (-454.906) -- 0:00:51
135000 -- (-454.652) [-454.011] (-453.910) (-453.684) * (-456.114) (-454.714) [-457.150] (-459.359) -- 0:00:51
Average standard deviation of split frequencies: 0.021345
135500 -- (-453.904) (-453.135) [-454.980] (-454.168) * [-454.093] (-456.905) (-454.955) (-453.260) -- 0:00:57
136000 -- (-460.707) [-452.736] (-456.630) (-457.310) * (-452.882) [-455.913] (-454.115) (-455.098) -- 0:00:57
136500 -- (-453.500) [-456.304] (-454.802) (-457.404) * (-452.841) (-454.601) (-455.557) [-453.154] -- 0:00:56
137000 -- [-453.306] (-454.213) (-454.512) (-453.170) * (-457.029) (-457.352) [-454.981] (-453.920) -- 0:00:56
137500 -- (-454.237) (-453.793) (-456.632) [-454.794] * (-455.581) (-454.500) [-459.284] (-455.537) -- 0:00:56
138000 -- (-453.327) (-455.856) [-457.324] (-458.967) * (-454.131) [-453.225] (-457.135) (-456.268) -- 0:00:56
138500 -- (-455.557) (-454.498) [-452.707] (-458.955) * (-456.681) (-452.911) (-456.349) [-455.709] -- 0:00:55
139000 -- [-453.404] (-452.777) (-457.812) (-454.810) * [-455.343] (-458.256) (-454.223) (-459.536) -- 0:00:55
139500 -- [-452.835] (-453.283) (-455.619) (-455.097) * (-454.557) [-453.659] (-454.311) (-454.671) -- 0:00:55
140000 -- (-452.954) (-453.402) [-452.937] (-462.330) * (-453.888) [-454.641] (-453.627) (-455.098) -- 0:00:55
Average standard deviation of split frequencies: 0.018873
140500 -- (-455.067) (-453.532) [-453.660] (-457.326) * [-454.356] (-454.457) (-452.978) (-453.520) -- 0:00:55
141000 -- (-455.516) [-458.301] (-453.122) (-462.038) * (-456.360) (-454.770) (-452.741) [-454.888] -- 0:00:54
141500 -- (-453.397) (-457.806) (-453.541) [-461.993] * [-454.018] (-454.350) (-458.047) (-452.817) -- 0:00:54
142000 -- (-453.391) (-458.132) [-454.856] (-454.560) * [-455.907] (-454.862) (-458.449) (-453.015) -- 0:00:54
142500 -- [-453.451] (-456.131) (-454.751) (-459.131) * (-455.644) (-456.608) (-457.091) [-453.935] -- 0:00:54
143000 -- (-456.315) [-458.817] (-455.895) (-458.491) * (-456.277) (-455.321) [-455.844] (-456.180) -- 0:00:53
143500 -- (-456.565) (-455.081) [-460.493] (-454.399) * (-453.133) (-455.504) [-454.285] (-454.369) -- 0:00:53
144000 -- (-461.003) (-455.446) (-454.698) [-459.230] * (-453.577) (-459.031) (-454.986) [-454.905] -- 0:00:53
144500 -- (-457.117) (-456.701) [-452.757] (-455.648) * (-453.710) (-454.204) [-453.489] (-455.313) -- 0:00:53
145000 -- (-460.210) (-455.786) [-453.112] (-461.373) * (-455.208) (-454.681) [-457.352] (-453.376) -- 0:00:53
Average standard deviation of split frequencies: 0.016314
145500 -- (-460.749) [-452.646] (-455.184) (-458.000) * (-452.989) (-452.947) [-458.016] (-455.090) -- 0:00:52
146000 -- (-462.800) (-452.955) (-457.722) [-453.448] * (-452.903) (-453.536) [-452.913] (-454.452) -- 0:00:52
146500 -- [-457.593] (-453.840) (-454.931) (-456.610) * (-454.707) [-452.910] (-456.007) (-459.260) -- 0:00:52
147000 -- [-455.149] (-456.138) (-455.054) (-455.455) * (-456.612) (-455.617) (-454.486) [-459.038] -- 0:00:52
147500 -- (-454.598) (-455.548) (-457.092) [-455.428] * (-455.378) [-455.315] (-455.138) (-459.621) -- 0:00:52
148000 -- (-456.450) (-453.309) (-458.319) [-456.524] * [-453.368] (-453.845) (-452.833) (-455.850) -- 0:00:51
148500 -- (-453.998) (-456.247) (-461.484) [-455.815] * (-453.460) (-459.091) (-453.560) [-454.832] -- 0:00:51
149000 -- (-454.143) [-453.865] (-460.253) (-457.786) * (-455.770) (-457.017) [-452.866] (-454.144) -- 0:00:51
149500 -- (-456.348) (-455.361) [-457.645] (-457.671) * (-454.455) [-454.226] (-455.482) (-458.624) -- 0:00:51
150000 -- (-455.494) (-455.819) [-454.753] (-454.603) * (-455.141) (-453.526) [-453.903] (-454.750) -- 0:00:51
Average standard deviation of split frequencies: 0.014775
150500 -- (-456.594) (-455.023) [-456.549] (-454.043) * (-453.529) (-453.119) (-459.762) [-453.208] -- 0:00:50
151000 -- (-457.217) [-455.414] (-454.873) (-453.979) * (-457.708) (-455.007) [-455.765] (-456.216) -- 0:00:50
151500 -- (-454.886) [-455.589] (-455.062) (-454.280) * (-455.268) [-456.306] (-454.428) (-456.805) -- 0:00:50
152000 -- (-455.348) [-456.586] (-460.708) (-454.790) * (-454.164) (-455.313) [-454.688] (-454.703) -- 0:00:50
152500 -- (-459.233) [-454.527] (-456.431) (-455.285) * (-455.558) [-453.866] (-455.271) (-455.529) -- 0:00:55
153000 -- (-457.585) (-456.331) (-456.516) [-454.438] * (-456.160) (-455.550) [-455.660] (-454.940) -- 0:00:55
153500 -- (-454.346) (-453.334) [-457.433] (-455.432) * (-453.924) [-453.809] (-453.631) (-453.414) -- 0:00:55
154000 -- [-454.931] (-454.410) (-454.952) (-457.841) * (-454.875) (-456.398) [-455.351] (-455.114) -- 0:00:54
154500 -- (-457.475) (-455.811) [-454.770] (-456.137) * (-454.820) (-455.656) [-455.247] (-458.266) -- 0:00:54
155000 -- [-453.613] (-457.196) (-454.984) (-457.938) * (-455.785) (-453.624) [-453.391] (-458.950) -- 0:00:54
Average standard deviation of split frequencies: 0.015277
155500 -- (-453.646) (-454.918) (-456.086) [-455.945] * (-452.662) [-456.197] (-456.119) (-453.330) -- 0:00:54
156000 -- (-454.424) [-458.278] (-459.778) (-453.549) * [-460.151] (-454.628) (-455.112) (-456.198) -- 0:00:54
156500 -- (-456.264) [-452.935] (-456.439) (-454.674) * (-460.597) (-454.040) [-453.524] (-457.258) -- 0:00:53
157000 -- (-454.604) (-453.242) [-456.055] (-458.121) * (-456.325) (-456.189) [-455.302] (-456.250) -- 0:00:53
157500 -- (-455.044) [-454.592] (-456.135) (-455.997) * (-455.239) [-454.717] (-454.534) (-453.339) -- 0:00:53
158000 -- [-453.942] (-454.572) (-453.609) (-454.769) * [-456.200] (-455.483) (-454.380) (-453.273) -- 0:00:53
158500 -- (-455.390) [-455.767] (-455.910) (-456.758) * [-456.141] (-456.072) (-459.044) (-453.186) -- 0:00:53
159000 -- (-458.195) (-453.790) (-453.999) [-454.545] * [-454.693] (-453.772) (-454.435) (-456.859) -- 0:00:52
159500 -- (-457.758) (-453.305) (-453.766) [-454.271] * (-454.211) (-455.697) [-453.476] (-460.371) -- 0:00:52
160000 -- (-461.997) (-452.870) [-457.477] (-454.451) * [-454.004] (-456.504) (-458.366) (-456.713) -- 0:00:52
Average standard deviation of split frequencies: 0.017441
160500 -- (-456.916) (-453.066) [-456.818] (-456.744) * (-457.525) [-455.781] (-454.210) (-459.257) -- 0:00:52
161000 -- (-454.281) [-454.321] (-457.286) (-456.295) * (-459.878) (-453.278) [-453.770] (-453.680) -- 0:00:52
161500 -- (-455.376) (-454.247) (-459.171) [-452.948] * (-456.054) [-453.677] (-454.265) (-455.642) -- 0:00:51
162000 -- (-456.922) [-453.288] (-454.342) (-455.841) * (-458.103) (-457.087) [-454.154] (-457.431) -- 0:00:51
162500 -- (-458.094) (-454.391) [-454.817] (-455.404) * (-455.003) [-454.045] (-454.082) (-452.937) -- 0:00:51
163000 -- (-456.435) (-454.007) [-456.567] (-457.994) * (-456.092) (-456.643) [-454.443] (-454.633) -- 0:00:51
163500 -- (-452.774) [-454.299] (-454.378) (-458.477) * (-456.248) [-455.620] (-453.850) (-455.411) -- 0:00:51
164000 -- (-454.561) [-453.182] (-454.937) (-454.607) * [-453.693] (-458.621) (-455.333) (-454.801) -- 0:00:50
164500 -- (-456.924) (-453.522) [-455.669] (-454.531) * (-452.970) [-456.414] (-454.904) (-453.545) -- 0:00:50
165000 -- (-455.498) (-453.629) (-455.131) [-454.409] * (-454.726) (-452.864) [-453.487] (-453.102) -- 0:00:50
Average standard deviation of split frequencies: 0.015303
165500 -- (-456.867) (-453.273) [-456.450] (-454.329) * (-453.377) [-453.953] (-452.836) (-454.753) -- 0:00:50
166000 -- (-455.939) (-454.532) [-453.189] (-456.318) * (-453.244) (-454.209) (-455.627) [-453.680] -- 0:00:50
166500 -- (-454.150) [-454.196] (-454.222) (-455.815) * (-454.572) [-457.857] (-456.060) (-453.509) -- 0:00:50
167000 -- (-455.452) (-453.926) (-455.073) [-453.809] * (-455.858) (-457.586) [-455.769] (-454.476) -- 0:00:49
167500 -- (-456.642) (-454.441) (-456.948) [-454.267] * (-453.230) (-456.103) (-458.902) [-455.483] -- 0:00:49
168000 -- (-454.660) [-456.901] (-455.420) (-453.466) * (-460.904) (-458.680) [-456.818] (-453.046) -- 0:00:49
168500 -- (-455.984) (-456.987) (-454.019) [-454.630] * (-458.309) [-453.443] (-461.410) (-453.965) -- 0:00:49
169000 -- (-457.344) (-453.930) [-454.741] (-454.024) * (-457.078) [-454.304] (-455.187) (-459.393) -- 0:00:54
169500 -- (-453.262) (-455.706) (-456.291) [-453.731] * (-454.369) [-454.451] (-453.837) (-456.490) -- 0:00:53
170000 -- (-454.185) [-455.771] (-453.986) (-452.494) * (-452.891) [-455.149] (-454.651) (-454.258) -- 0:00:53
Average standard deviation of split frequencies: 0.014623
170500 -- [-454.278] (-455.921) (-458.318) (-457.947) * (-452.940) (-454.485) (-454.401) [-454.732] -- 0:00:53
171000 -- (-455.355) (-460.614) (-457.861) [-457.551] * [-452.925] (-454.683) (-453.321) (-458.161) -- 0:00:53
171500 -- (-455.689) (-456.739) (-462.740) [-453.361] * (-456.445) [-455.499] (-453.063) (-458.015) -- 0:00:53
172000 -- (-457.913) (-458.104) [-454.239] (-455.757) * (-457.004) (-453.827) [-454.615] (-454.768) -- 0:00:52
172500 -- (-453.090) (-454.250) [-455.798] (-452.948) * (-455.468) (-453.064) [-453.438] (-454.853) -- 0:00:52
173000 -- (-454.410) (-456.039) (-453.503) [-453.666] * [-454.034] (-453.949) (-454.763) (-457.755) -- 0:00:52
173500 -- (-456.444) (-457.234) [-456.952] (-453.965) * [-453.509] (-455.997) (-454.055) (-457.186) -- 0:00:52
174000 -- (-455.884) [-453.648] (-460.014) (-454.245) * (-454.011) (-454.826) [-454.610] (-460.791) -- 0:00:52
174500 -- [-453.356] (-455.613) (-454.910) (-460.897) * [-454.325] (-453.297) (-456.325) (-454.448) -- 0:00:52
175000 -- (-453.406) (-455.170) (-454.286) [-453.565] * [-453.837] (-452.894) (-457.269) (-453.583) -- 0:00:51
Average standard deviation of split frequencies: 0.015283
175500 -- [-457.271] (-455.048) (-452.760) (-454.787) * (-456.596) [-454.747] (-458.284) (-454.128) -- 0:00:51
176000 -- (-458.609) (-460.013) (-452.851) [-453.336] * [-457.043] (-453.752) (-453.419) (-454.172) -- 0:00:51
176500 -- [-454.498] (-457.169) (-453.602) (-455.914) * (-454.361) (-459.300) [-452.938] (-454.160) -- 0:00:51
177000 -- (-453.411) (-456.608) [-453.689] (-454.692) * [-454.062] (-458.231) (-456.546) (-455.523) -- 0:00:51
177500 -- (-457.064) (-454.366) (-452.958) [-454.295] * (-457.733) [-454.588] (-457.166) (-455.160) -- 0:00:50
178000 -- (-453.339) (-455.811) (-452.548) [-453.843] * (-454.473) (-453.433) (-452.958) [-453.195] -- 0:00:50
178500 -- [-452.777] (-455.677) (-455.024) (-453.699) * [-455.079] (-455.826) (-454.041) (-453.694) -- 0:00:50
179000 -- (-457.851) [-454.960] (-455.689) (-455.752) * (-454.738) (-453.023) (-454.580) [-454.599] -- 0:00:50
179500 -- (-455.853) (-457.244) (-453.349) [-453.087] * (-454.271) (-453.864) (-454.592) [-454.416] -- 0:00:50
180000 -- (-456.799) (-458.553) [-452.863] (-457.419) * (-453.861) [-457.786] (-455.985) (-454.339) -- 0:00:50
Average standard deviation of split frequencies: 0.015518
180500 -- (-454.102) [-457.549] (-453.592) (-456.719) * (-457.757) (-456.412) (-456.204) [-455.708] -- 0:00:49
181000 -- (-459.377) (-456.335) [-453.716] (-454.275) * (-453.556) (-454.123) (-456.742) [-455.851] -- 0:00:49
181500 -- (-456.738) (-455.294) (-457.730) [-458.031] * (-458.966) [-454.057] (-460.669) (-455.089) -- 0:00:49
182000 -- [-455.513] (-453.951) (-453.277) (-455.306) * (-456.411) [-454.095] (-456.343) (-453.788) -- 0:00:49
182500 -- (-456.522) (-454.903) (-453.781) [-453.579] * (-455.890) [-455.540] (-453.875) (-453.822) -- 0:00:49
183000 -- (-453.752) [-453.408] (-453.778) (-456.403) * (-459.269) [-453.533] (-454.790) (-454.994) -- 0:00:49
183500 -- (-454.595) (-454.307) [-454.677] (-455.871) * [-454.749] (-455.256) (-454.080) (-458.687) -- 0:00:48
184000 -- (-454.677) [-455.490] (-454.141) (-455.522) * (-452.546) [-453.155] (-453.438) (-453.516) -- 0:00:48
184500 -- [-453.907] (-456.161) (-455.814) (-453.963) * [-453.133] (-456.303) (-453.481) (-452.962) -- 0:00:48
185000 -- [-454.195] (-456.343) (-454.811) (-456.181) * [-453.204] (-454.210) (-453.257) (-456.588) -- 0:00:48
Average standard deviation of split frequencies: 0.015607
185500 -- [-454.343] (-456.124) (-456.538) (-458.292) * (-454.265) (-457.329) [-453.657] (-454.639) -- 0:00:48
186000 -- (-454.174) (-453.021) [-453.180] (-454.537) * [-455.093] (-456.368) (-459.530) (-454.936) -- 0:00:52
186500 -- [-456.144] (-452.546) (-453.604) (-456.537) * (-454.924) [-453.159] (-453.854) (-455.501) -- 0:00:52
187000 -- (-458.067) [-452.704] (-457.350) (-454.381) * (-454.135) (-457.179) [-455.224] (-454.453) -- 0:00:52
187500 -- (-455.378) [-456.707] (-455.405) (-455.606) * (-456.179) (-454.825) (-456.433) [-455.573] -- 0:00:52
188000 -- (-454.171) [-456.661] (-453.197) (-462.551) * (-454.490) (-456.619) (-454.361) [-454.301] -- 0:00:51
188500 -- (-453.349) (-453.068) [-452.822] (-457.103) * (-452.772) [-453.852] (-453.622) (-455.644) -- 0:00:51
189000 -- (-454.001) [-452.852] (-457.989) (-454.840) * (-453.591) (-456.720) (-453.150) [-457.452] -- 0:00:51
189500 -- [-454.538] (-453.173) (-459.896) (-455.808) * (-454.396) [-456.539] (-452.714) (-458.717) -- 0:00:51
190000 -- (-460.706) (-453.659) (-455.089) [-454.455] * (-454.498) (-456.207) [-454.206] (-458.008) -- 0:00:51
Average standard deviation of split frequencies: 0.015796
190500 -- (-460.254) (-453.593) [-455.162] (-453.271) * (-454.117) (-456.059) (-454.993) [-454.883] -- 0:00:50
191000 -- (-462.739) (-454.038) (-461.657) [-454.529] * (-454.920) (-454.369) (-454.863) [-456.540] -- 0:00:50
191500 -- (-453.731) (-455.640) [-456.503] (-455.349) * (-453.642) [-455.451] (-456.401) (-453.466) -- 0:00:50
192000 -- (-455.390) (-456.160) (-454.964) [-452.738] * [-452.802] (-453.371) (-453.344) (-453.893) -- 0:00:50
192500 -- (-456.874) [-456.717] (-455.746) (-455.829) * (-454.064) (-456.089) [-454.048] (-453.557) -- 0:00:50
193000 -- (-457.175) (-454.742) [-456.547] (-455.272) * (-456.364) [-458.775] (-453.992) (-455.131) -- 0:00:50
193500 -- (-454.524) (-454.369) (-457.973) [-454.496] * [-455.131] (-462.605) (-459.381) (-455.926) -- 0:00:50
194000 -- (-454.980) (-458.269) [-453.183] (-458.225) * [-455.550] (-453.132) (-459.447) (-453.225) -- 0:00:49
194500 -- (-454.524) (-458.225) [-460.233] (-454.732) * (-453.333) (-454.483) (-453.673) [-454.096] -- 0:00:49
195000 -- (-456.268) (-460.856) [-454.770] (-457.927) * (-454.321) (-458.025) [-455.270] (-452.606) -- 0:00:49
Average standard deviation of split frequencies: 0.015280
195500 -- (-453.996) [-458.818] (-455.118) (-457.437) * (-454.302) (-457.183) [-454.447] (-453.478) -- 0:00:49
196000 -- (-453.509) (-455.579) [-453.688] (-457.730) * [-454.290] (-458.318) (-454.457) (-453.856) -- 0:00:49
196500 -- (-453.588) (-454.869) (-453.282) [-454.857] * [-455.390] (-454.256) (-454.605) (-453.013) -- 0:00:49
197000 -- (-452.983) (-453.709) (-457.481) [-452.919] * (-456.475) (-455.997) (-454.643) [-454.128] -- 0:00:48
197500 -- (-457.171) (-453.729) (-455.758) [-454.923] * [-453.269] (-456.317) (-454.490) (-452.852) -- 0:00:48
198000 -- (-455.781) (-453.341) [-456.773] (-455.551) * (-453.759) (-454.372) (-455.100) [-453.462] -- 0:00:48
198500 -- (-459.169) (-454.545) (-458.679) [-455.474] * (-456.144) (-456.170) [-453.946] (-454.166) -- 0:00:48
199000 -- [-456.059] (-455.979) (-456.064) (-454.246) * (-454.539) [-454.844] (-456.435) (-454.177) -- 0:00:48
199500 -- (-457.319) [-453.880] (-454.418) (-456.077) * (-454.515) (-455.252) (-457.030) [-454.286] -- 0:00:48
200000 -- (-455.783) (-454.256) [-463.133] (-453.549) * (-456.061) (-453.943) (-454.681) [-454.429] -- 0:00:48
Average standard deviation of split frequencies: 0.016859
200500 -- [-453.648] (-454.356) (-455.243) (-453.897) * (-453.476) (-460.501) [-454.971] (-454.178) -- 0:00:47
201000 -- [-456.452] (-452.773) (-460.501) (-453.768) * [-455.139] (-454.569) (-457.464) (-459.269) -- 0:00:47
201500 -- (-459.947) (-454.696) (-459.106) [-453.589] * (-456.879) (-458.164) [-455.944] (-458.330) -- 0:00:47
202000 -- [-456.041] (-454.761) (-454.676) (-457.649) * (-455.867) [-455.882] (-453.905) (-458.173) -- 0:00:47
202500 -- (-459.002) [-457.573] (-453.390) (-454.166) * (-454.951) (-454.943) [-453.310] (-460.471) -- 0:00:47
203000 -- [-453.945] (-456.859) (-456.327) (-459.313) * [-453.997] (-453.747) (-454.123) (-455.209) -- 0:00:51
203500 -- [-453.447] (-459.204) (-453.061) (-453.196) * (-453.733) (-453.695) [-454.349] (-453.150) -- 0:00:50
204000 -- [-453.093] (-454.003) (-455.805) (-456.783) * [-453.217] (-455.173) (-452.549) (-454.091) -- 0:00:50
204500 -- (-454.559) [-454.684] (-452.953) (-453.413) * [-452.589] (-457.003) (-453.551) (-452.663) -- 0:00:50
205000 -- (-455.424) [-457.600] (-455.311) (-453.199) * [-454.691] (-454.756) (-453.779) (-453.825) -- 0:00:50
Average standard deviation of split frequencies: 0.016557
205500 -- (-456.324) [-458.629] (-452.933) (-455.889) * (-459.272) (-454.959) (-454.866) [-455.176] -- 0:00:50
206000 -- [-456.223] (-455.742) (-457.372) (-455.337) * (-455.674) (-455.471) (-455.326) [-452.734] -- 0:00:50
206500 -- (-459.260) (-460.246) [-454.716] (-454.193) * [-456.137] (-454.486) (-456.006) (-454.442) -- 0:00:49
207000 -- (-456.775) (-457.164) (-453.711) [-455.873] * (-456.143) (-457.188) [-454.634] (-460.005) -- 0:00:49
207500 -- [-454.379] (-454.482) (-453.411) (-456.237) * [-457.181] (-459.119) (-455.325) (-453.918) -- 0:00:49
208000 -- (-454.419) [-453.546] (-454.545) (-454.318) * (-454.831) (-455.614) (-454.344) [-455.263] -- 0:00:49
208500 -- [-455.771] (-453.697) (-456.994) (-455.731) * (-460.836) [-456.234] (-454.639) (-454.953) -- 0:00:49
209000 -- (-455.180) (-454.517) (-454.975) [-454.072] * (-458.041) (-454.103) [-454.831] (-455.600) -- 0:00:49
209500 -- (-458.901) (-454.265) (-454.828) [-457.099] * (-457.418) [-453.392] (-457.020) (-456.743) -- 0:00:49
210000 -- [-454.337] (-457.674) (-457.113) (-455.979) * (-458.940) [-455.002] (-455.195) (-454.843) -- 0:00:48
Average standard deviation of split frequencies: 0.015532
210500 -- (-455.591) (-454.662) (-456.459) [-460.033] * (-453.161) (-455.319) (-456.486) [-453.940] -- 0:00:48
211000 -- [-454.841] (-455.192) (-454.350) (-453.212) * (-453.505) [-456.787] (-455.528) (-457.370) -- 0:00:48
211500 -- [-453.486] (-454.481) (-455.201) (-457.225) * (-454.613) (-457.255) (-454.342) [-453.282] -- 0:00:48
212000 -- (-455.574) [-454.938] (-454.545) (-457.249) * (-458.485) [-454.230] (-456.231) (-455.257) -- 0:00:48
212500 -- (-454.191) (-459.890) (-455.226) [-454.228] * [-453.304] (-453.935) (-452.952) (-458.083) -- 0:00:48
213000 -- (-457.589) (-452.921) (-455.082) [-453.783] * (-454.835) [-454.702] (-454.118) (-457.120) -- 0:00:48
213500 -- (-458.774) [-452.570] (-457.043) (-454.245) * [-454.926] (-454.961) (-454.224) (-453.875) -- 0:00:47
214000 -- (-456.859) [-452.675] (-455.527) (-455.680) * (-454.652) [-454.360] (-457.831) (-453.672) -- 0:00:47
214500 -- (-457.797) (-453.307) [-454.531] (-453.661) * (-454.203) (-455.008) (-454.907) [-453.141] -- 0:00:47
215000 -- (-452.994) (-452.712) (-452.897) [-452.451] * [-453.867] (-453.547) (-455.997) (-455.654) -- 0:00:47
Average standard deviation of split frequencies: 0.014507
215500 -- [-455.720] (-455.483) (-453.757) (-456.005) * [-455.686] (-456.096) (-454.901) (-453.794) -- 0:00:47
216000 -- [-453.336] (-453.823) (-453.965) (-459.432) * [-456.094] (-455.938) (-454.199) (-452.847) -- 0:00:47
216500 -- [-456.163] (-453.807) (-455.192) (-455.337) * [-453.623] (-454.466) (-453.249) (-454.287) -- 0:00:47
217000 -- [-453.998] (-454.230) (-454.598) (-454.891) * (-455.750) [-452.590] (-453.998) (-453.285) -- 0:00:46
217500 -- [-453.038] (-456.237) (-454.403) (-453.998) * (-455.478) (-455.406) [-452.987] (-454.037) -- 0:00:46
218000 -- (-454.219) (-456.819) (-457.965) [-453.757] * (-454.820) (-455.501) [-453.603] (-453.146) -- 0:00:46
218500 -- (-455.529) [-455.224] (-455.125) (-455.856) * (-457.331) (-453.395) (-454.069) [-459.680] -- 0:00:46
219000 -- (-454.746) (-456.221) [-455.316] (-453.854) * (-456.127) [-453.374] (-453.527) (-454.455) -- 0:00:46
219500 -- (-455.055) (-455.117) (-453.083) [-455.623] * (-453.638) [-458.330] (-454.631) (-455.239) -- 0:00:46
220000 -- (-454.956) (-454.113) (-452.977) [-454.862] * (-454.224) [-454.411] (-456.188) (-455.265) -- 0:00:49
Average standard deviation of split frequencies: 0.013949
220500 -- [-455.511] (-453.978) (-454.866) (-453.420) * (-453.782) [-453.621] (-455.918) (-455.084) -- 0:00:49
221000 -- [-456.076] (-454.545) (-458.123) (-453.075) * (-454.655) (-453.173) (-454.044) [-453.671] -- 0:00:49
221500 -- (-454.857) [-452.594] (-455.139) (-455.036) * (-458.365) [-453.748] (-456.295) (-453.222) -- 0:00:49
222000 -- (-456.893) [-454.636] (-457.562) (-454.810) * (-453.805) (-453.977) (-455.984) [-454.488] -- 0:00:49
222500 -- [-452.796] (-452.537) (-456.662) (-454.468) * (-453.593) [-454.196] (-456.853) (-453.686) -- 0:00:48
223000 -- (-457.994) (-453.482) [-452.991] (-453.994) * (-453.661) (-455.592) (-460.224) [-453.356] -- 0:00:48
223500 -- (-457.338) (-453.506) [-453.042] (-456.261) * (-457.515) (-455.365) (-457.076) [-455.956] -- 0:00:48
224000 -- (-456.271) (-453.236) [-458.550] (-455.122) * [-453.800] (-458.671) (-454.928) (-455.047) -- 0:00:48
224500 -- (-454.347) [-455.571] (-456.902) (-453.262) * (-454.933) (-455.351) [-452.680] (-455.768) -- 0:00:48
225000 -- (-452.423) (-455.179) (-453.655) [-454.723] * (-453.152) (-459.291) [-454.878] (-459.356) -- 0:00:48
Average standard deviation of split frequencies: 0.014233
225500 -- (-453.776) (-455.855) (-454.710) [-454.807] * (-456.639) (-454.947) [-455.806] (-458.933) -- 0:00:48
226000 -- (-455.150) [-454.538] (-454.085) (-453.138) * [-456.141] (-454.731) (-453.857) (-456.751) -- 0:00:47
226500 -- (-452.925) (-454.763) (-454.429) [-453.298] * [-454.835] (-452.793) (-455.664) (-455.567) -- 0:00:47
227000 -- [-455.927] (-459.673) (-454.639) (-454.490) * (-453.982) [-453.132] (-456.009) (-453.833) -- 0:00:47
227500 -- (-455.316) (-453.652) (-454.073) [-453.699] * (-454.386) (-456.954) [-453.187] (-454.022) -- 0:00:47
228000 -- (-454.101) (-454.852) (-452.515) [-454.732] * (-455.230) (-454.156) (-453.951) [-455.236] -- 0:00:47
228500 -- (-454.358) (-452.864) [-455.327] (-455.584) * (-454.390) (-454.909) (-454.664) [-455.184] -- 0:00:47
229000 -- (-452.702) (-454.044) [-453.172] (-457.922) * (-453.464) (-456.092) (-454.930) [-455.734] -- 0:00:47
229500 -- (-452.674) [-453.169] (-458.066) (-456.816) * (-454.461) [-458.735] (-457.223) (-454.767) -- 0:00:47
230000 -- (-454.181) (-454.291) [-453.691] (-452.822) * (-456.448) (-453.303) [-456.837] (-457.457) -- 0:00:46
Average standard deviation of split frequencies: 0.012262
230500 -- [-453.921] (-452.770) (-457.089) (-454.681) * (-457.622) (-459.076) (-454.843) [-458.386] -- 0:00:46
231000 -- [-454.989] (-455.040) (-453.313) (-454.512) * (-456.385) [-455.476] (-452.811) (-455.569) -- 0:00:46
231500 -- [-453.310] (-454.335) (-456.774) (-454.519) * (-455.296) (-455.210) (-453.828) [-455.012] -- 0:00:46
232000 -- (-455.306) (-455.252) (-454.364) [-453.757] * (-455.072) (-460.024) (-453.898) [-452.805] -- 0:00:46
232500 -- (-454.587) (-453.239) [-455.131] (-452.760) * (-453.877) [-453.652] (-454.554) (-454.444) -- 0:00:46
233000 -- (-452.470) [-453.005] (-453.885) (-455.306) * (-454.030) (-453.707) [-453.960] (-454.372) -- 0:00:46
233500 -- [-452.860] (-456.585) (-454.886) (-454.599) * (-456.830) [-455.959] (-455.008) (-453.436) -- 0:00:45
234000 -- (-455.155) (-456.036) [-453.664] (-455.197) * (-457.157) (-453.563) (-455.351) [-456.119] -- 0:00:45
234500 -- [-453.033] (-453.224) (-452.668) (-469.412) * (-453.823) [-458.675] (-454.816) (-457.980) -- 0:00:45
235000 -- [-455.493] (-457.327) (-454.688) (-463.987) * [-457.251] (-453.460) (-454.776) (-456.588) -- 0:00:45
Average standard deviation of split frequencies: 0.011735
235500 -- (-459.509) [-455.191] (-455.199) (-454.856) * (-454.599) (-454.944) (-454.672) [-454.928] -- 0:00:45
236000 -- (-459.778) (-454.558) [-457.116] (-454.642) * (-456.202) (-454.327) (-453.159) [-455.469] -- 0:00:45
236500 -- (-456.449) (-454.623) (-455.161) [-455.116] * (-453.780) (-453.896) [-453.335] (-455.681) -- 0:00:45
237000 -- (-454.186) (-454.676) [-457.115] (-455.783) * (-454.169) (-453.323) [-454.034] (-455.391) -- 0:00:48
237500 -- (-453.979) (-457.514) [-453.970] (-454.039) * (-453.105) (-452.756) (-457.040) [-456.987] -- 0:00:48
238000 -- [-452.949] (-455.973) (-457.073) (-456.104) * (-456.971) (-455.103) (-454.247) [-453.697] -- 0:00:48
238500 -- (-456.473) [-454.399] (-454.587) (-457.671) * (-454.741) (-454.584) [-453.298] (-453.365) -- 0:00:47
239000 -- (-456.231) (-457.201) (-456.364) [-452.618] * (-454.286) (-453.018) [-454.458] (-452.729) -- 0:00:47
239500 -- (-455.038) [-452.549] (-455.175) (-453.574) * [-456.089] (-454.310) (-456.477) (-453.337) -- 0:00:47
240000 -- (-455.404) (-453.450) (-454.202) [-453.495] * (-455.549) (-453.282) (-457.295) [-455.077] -- 0:00:47
Average standard deviation of split frequencies: 0.012120
240500 -- (-459.680) [-454.205] (-453.688) (-458.880) * (-453.664) (-453.321) [-452.665] (-453.782) -- 0:00:47
241000 -- (-452.926) (-456.392) (-454.293) [-456.732] * (-455.162) (-453.770) [-453.299] (-455.585) -- 0:00:47
241500 -- (-455.689) (-455.895) (-453.791) [-454.645] * (-455.991) (-453.558) (-455.922) [-455.389] -- 0:00:47
242000 -- (-453.699) (-454.792) [-453.435] (-457.476) * [-456.189] (-453.967) (-457.017) (-455.488) -- 0:00:46
242500 -- (-453.308) [-453.567] (-453.609) (-457.162) * (-456.311) (-454.468) (-455.537) [-452.994] -- 0:00:46
243000 -- (-452.998) (-458.483) [-456.489] (-458.211) * (-460.373) (-457.248) [-453.268] (-455.936) -- 0:00:46
243500 -- (-457.834) [-453.238] (-454.159) (-455.955) * [-453.770] (-453.528) (-454.088) (-456.476) -- 0:00:46
244000 -- [-453.660] (-454.182) (-454.514) (-457.444) * (-453.756) [-453.124] (-454.011) (-457.682) -- 0:00:46
244500 -- (-453.002) (-455.064) [-454.477] (-455.146) * (-455.774) (-453.796) (-455.897) [-454.069] -- 0:00:46
245000 -- (-456.327) (-454.433) [-453.598] (-455.531) * (-453.153) [-453.404] (-459.791) (-456.124) -- 0:00:46
Average standard deviation of split frequencies: 0.010483
245500 -- (-455.218) [-454.682] (-457.967) (-453.748) * (-456.055) [-453.869] (-454.672) (-454.709) -- 0:00:46
246000 -- [-453.359] (-453.970) (-455.655) (-453.900) * [-454.196] (-457.534) (-456.422) (-458.202) -- 0:00:45
246500 -- (-456.146) (-453.795) (-454.028) [-453.747] * (-454.818) [-458.203] (-453.251) (-453.924) -- 0:00:45
247000 -- (-456.737) (-454.726) (-454.772) [-457.076] * (-454.561) (-455.904) (-452.772) [-453.134] -- 0:00:45
247500 -- [-452.956] (-454.975) (-456.220) (-453.740) * (-455.643) [-456.517] (-454.871) (-453.457) -- 0:00:45
248000 -- (-453.249) (-456.082) (-456.111) [-453.481] * [-456.271] (-453.914) (-456.868) (-454.002) -- 0:00:45
248500 -- (-453.917) (-456.532) (-459.307) [-456.966] * (-454.204) (-454.899) (-454.751) [-454.377] -- 0:00:45
249000 -- (-455.516) [-454.674] (-453.908) (-455.804) * (-457.864) [-456.143] (-455.212) (-453.598) -- 0:00:45
249500 -- [-455.826] (-455.171) (-454.299) (-455.905) * (-457.059) [-455.805] (-455.663) (-455.800) -- 0:00:45
250000 -- [-462.455] (-459.225) (-455.075) (-453.618) * [-453.314] (-469.059) (-454.666) (-456.222) -- 0:00:45
Average standard deviation of split frequencies: 0.011388
250500 -- [-455.885] (-455.416) (-457.435) (-457.120) * [-453.345] (-454.183) (-454.887) (-452.915) -- 0:00:44
251000 -- [-457.582] (-454.290) (-455.246) (-455.450) * (-455.181) (-454.312) [-458.851] (-454.604) -- 0:00:44
251500 -- (-453.299) (-454.316) [-454.499] (-454.096) * (-456.964) (-452.962) [-454.083] (-454.738) -- 0:00:44
252000 -- (-453.516) (-454.309) (-454.722) [-455.046] * [-456.444] (-453.049) (-462.339) (-457.435) -- 0:00:44
252500 -- (-452.996) [-453.045] (-452.973) (-454.911) * (-457.605) [-453.875] (-454.583) (-454.496) -- 0:00:44
253000 -- (-454.987) [-453.849] (-456.490) (-454.454) * (-455.506) [-454.824] (-455.000) (-461.149) -- 0:00:44
253500 -- (-455.085) (-458.090) [-455.226] (-458.292) * (-454.724) [-454.586] (-454.969) (-454.876) -- 0:00:44
254000 -- (-457.051) [-457.264] (-454.615) (-454.463) * (-454.382) [-454.635] (-454.958) (-458.978) -- 0:00:46
254500 -- (-456.840) (-455.434) (-460.615) [-455.012] * (-454.986) [-457.021] (-457.125) (-454.766) -- 0:00:46
255000 -- (-455.236) (-456.680) (-455.587) [-453.994] * (-455.998) (-454.832) [-454.098] (-455.673) -- 0:00:46
Average standard deviation of split frequencies: 0.011157
255500 -- (-454.019) [-453.784] (-458.733) (-453.211) * (-455.987) [-454.907] (-455.195) (-458.024) -- 0:00:46
256000 -- (-454.285) [-454.638] (-456.790) (-458.847) * (-454.329) [-453.180] (-453.691) (-455.111) -- 0:00:46
256500 -- (-453.549) (-454.945) [-455.097] (-457.099) * (-456.296) (-457.409) [-452.869] (-453.454) -- 0:00:46
257000 -- (-454.268) (-453.951) [-453.745] (-457.930) * [-453.714] (-455.038) (-458.524) (-453.044) -- 0:00:46
257500 -- (-454.146) [-453.469] (-459.755) (-452.977) * (-453.296) (-457.352) [-459.760] (-455.117) -- 0:00:46
258000 -- (-453.276) (-455.097) [-455.257] (-456.151) * (-453.214) (-454.794) [-453.986] (-456.081) -- 0:00:46
258500 -- [-455.522] (-459.259) (-453.884) (-457.742) * [-454.620] (-456.199) (-456.062) (-455.053) -- 0:00:45
259000 -- (-454.461) (-454.916) (-455.006) [-456.076] * [-455.469] (-454.704) (-458.217) (-453.833) -- 0:00:45
259500 -- (-455.084) (-454.012) [-456.628] (-453.713) * [-454.893] (-455.631) (-453.943) (-455.278) -- 0:00:45
260000 -- [-452.472] (-455.494) (-458.067) (-454.129) * (-453.195) (-455.561) [-454.000] (-457.366) -- 0:00:45
Average standard deviation of split frequencies: 0.012659
260500 -- [-456.997] (-455.182) (-454.379) (-456.934) * [-453.802] (-453.256) (-453.794) (-455.569) -- 0:00:45
261000 -- [-459.397] (-461.096) (-452.815) (-456.074) * (-455.228) (-456.775) [-454.273] (-457.376) -- 0:00:45
261500 -- (-457.214) (-454.730) [-455.957] (-455.487) * (-454.338) (-453.860) (-457.667) [-453.349] -- 0:00:45
262000 -- [-459.926] (-454.060) (-453.366) (-459.566) * [-453.030] (-452.537) (-453.973) (-454.654) -- 0:00:45
262500 -- (-454.777) [-456.651] (-454.098) (-454.532) * (-454.817) (-456.503) [-453.977] (-455.870) -- 0:00:44
263000 -- (-454.567) [-454.647] (-453.422) (-454.882) * (-452.925) [-453.251] (-456.291) (-456.423) -- 0:00:44
263500 -- (-459.007) [-454.202] (-454.079) (-452.821) * (-452.818) [-453.821] (-455.584) (-455.547) -- 0:00:44
264000 -- (-458.007) [-455.334] (-456.105) (-453.872) * (-455.722) (-453.656) [-454.709] (-456.704) -- 0:00:44
264500 -- [-457.006] (-455.514) (-456.539) (-458.913) * (-456.795) (-455.718) (-452.735) [-453.699] -- 0:00:44
265000 -- [-455.388] (-453.981) (-453.545) (-457.629) * (-454.773) (-454.150) [-454.328] (-455.684) -- 0:00:44
Average standard deviation of split frequencies: 0.013390
265500 -- [-453.367] (-454.506) (-455.809) (-457.951) * (-455.411) [-453.709] (-459.681) (-452.686) -- 0:00:44
266000 -- [-456.125] (-454.896) (-455.880) (-458.065) * (-452.596) [-454.726] (-453.685) (-454.805) -- 0:00:44
266500 -- (-453.658) (-452.872) [-453.654] (-456.048) * (-453.581) [-454.979] (-453.835) (-453.525) -- 0:00:44
267000 -- (-456.744) (-454.661) (-455.000) [-453.816] * [-456.582] (-454.250) (-454.165) (-453.217) -- 0:00:43
267500 -- (-454.627) [-456.169] (-454.576) (-453.890) * [-455.825] (-463.405) (-453.546) (-453.581) -- 0:00:43
268000 -- [-455.770] (-453.743) (-459.768) (-458.676) * [-455.493] (-458.115) (-455.128) (-456.323) -- 0:00:43
268500 -- (-453.003) [-454.863] (-453.297) (-453.291) * (-454.846) (-452.714) (-454.519) [-453.692] -- 0:00:43
269000 -- (-459.935) [-454.106] (-452.958) (-454.193) * (-455.285) [-453.059] (-456.978) (-456.594) -- 0:00:43
269500 -- [-454.818] (-453.321) (-454.808) (-456.266) * [-454.507] (-452.976) (-457.192) (-458.942) -- 0:00:43
270000 -- (-458.574) (-456.676) [-458.077] (-452.780) * (-454.861) [-454.793] (-456.055) (-456.061) -- 0:00:43
Average standard deviation of split frequencies: 0.012869
270500 -- (-457.019) (-454.199) [-453.098] (-453.182) * (-456.016) [-455.289] (-455.188) (-456.253) -- 0:00:43
271000 -- (-456.553) (-455.665) [-454.054] (-453.061) * [-454.626] (-455.841) (-461.390) (-455.337) -- 0:00:45
271500 -- [-454.796] (-452.854) (-453.578) (-453.584) * (-458.975) [-457.073] (-455.457) (-455.374) -- 0:00:45
272000 -- [-454.132] (-454.868) (-454.582) (-455.039) * (-454.398) (-452.664) [-453.880] (-453.963) -- 0:00:45
272500 -- [-454.581] (-455.859) (-454.857) (-455.734) * (-452.895) [-455.156] (-453.888) (-456.055) -- 0:00:45
273000 -- (-452.863) [-454.114] (-454.244) (-454.778) * (-455.960) (-453.100) [-454.499] (-454.091) -- 0:00:45
273500 -- (-454.585) (-454.453) [-454.306] (-454.250) * (-454.385) (-455.614) (-453.334) [-457.485] -- 0:00:45
274000 -- (-453.313) (-456.673) (-453.181) [-452.861] * (-455.922) (-452.913) [-457.948] (-456.405) -- 0:00:45
274500 -- (-457.344) (-454.996) (-454.201) [-452.990] * (-454.066) (-454.745) [-453.002] (-453.524) -- 0:00:44
275000 -- (-453.750) (-453.508) (-452.539) [-453.048] * (-453.995) (-454.398) [-453.367] (-456.064) -- 0:00:44
Average standard deviation of split frequencies: 0.013284
275500 -- [-454.843] (-453.555) (-452.611) (-454.727) * (-453.570) (-455.284) (-454.899) [-456.135] -- 0:00:44
276000 -- (-454.129) (-452.883) (-456.503) [-452.729] * [-455.686] (-454.602) (-453.038) (-455.760) -- 0:00:44
276500 -- (-458.101) (-453.921) [-454.671] (-452.942) * [-456.762] (-456.364) (-456.115) (-459.072) -- 0:00:44
277000 -- (-456.555) (-455.698) (-455.933) [-459.443] * (-459.404) [-458.057] (-452.984) (-460.302) -- 0:00:44
277500 -- (-456.373) [-455.741] (-453.905) (-458.315) * [-456.005] (-453.706) (-455.667) (-459.162) -- 0:00:44
278000 -- [-460.501] (-453.629) (-454.302) (-455.462) * (-456.500) [-460.452] (-458.558) (-454.348) -- 0:00:44
278500 -- [-457.571] (-457.843) (-454.614) (-457.690) * (-453.064) (-456.936) (-453.176) [-452.835] -- 0:00:44
279000 -- (-454.513) (-453.476) (-457.691) [-453.286] * (-454.636) (-453.560) [-453.831] (-456.242) -- 0:00:43
279500 -- (-453.987) [-456.347] (-455.234) (-453.117) * (-454.461) (-453.925) [-453.543] (-453.871) -- 0:00:43
280000 -- (-454.710) (-453.614) (-454.908) [-453.282] * (-455.994) (-455.638) (-454.963) [-456.940] -- 0:00:43
Average standard deviation of split frequencies: 0.011757
280500 -- [-453.826] (-452.832) (-457.325) (-453.557) * (-454.217) [-454.684] (-455.822) (-454.800) -- 0:00:43
281000 -- (-454.704) (-455.629) [-453.741] (-452.672) * (-453.812) [-454.645] (-455.578) (-455.217) -- 0:00:43
281500 -- (-453.023) (-453.785) [-455.663] (-454.253) * (-457.823) (-454.483) [-454.113] (-455.094) -- 0:00:43
282000 -- (-457.239) [-454.947] (-453.447) (-455.496) * (-454.730) [-454.894] (-458.478) (-458.433) -- 0:00:43
282500 -- (-454.619) [-453.626] (-454.007) (-453.919) * [-453.181] (-454.676) (-454.070) (-460.845) -- 0:00:43
283000 -- (-455.119) (-460.894) (-459.153) [-456.056] * (-453.865) [-454.983] (-455.959) (-460.138) -- 0:00:43
283500 -- (-456.416) [-455.343] (-457.206) (-454.257) * (-452.924) [-454.252] (-454.620) (-453.983) -- 0:00:42
284000 -- (-454.609) (-454.744) [-456.385] (-454.120) * [-455.721] (-452.841) (-455.430) (-454.058) -- 0:00:42
284500 -- [-455.473] (-455.161) (-454.643) (-455.178) * [-454.647] (-453.852) (-453.397) (-453.112) -- 0:00:42
285000 -- (-453.509) (-455.641) [-453.008] (-454.301) * (-453.406) (-456.364) (-454.953) [-452.726] -- 0:00:42
Average standard deviation of split frequencies: 0.013380
285500 -- [-457.178] (-458.793) (-455.016) (-459.590) * (-455.943) (-457.012) [-457.451] (-455.097) -- 0:00:42
286000 -- (-455.214) [-456.002] (-454.234) (-458.128) * (-463.210) (-458.382) (-457.195) [-453.345] -- 0:00:42
286500 -- (-456.309) (-459.384) (-463.712) [-457.689] * (-463.804) (-455.996) (-453.375) [-453.156] -- 0:00:42
287000 -- (-454.618) (-456.055) (-455.217) [-455.218] * (-456.696) (-453.892) (-459.313) [-452.857] -- 0:00:42
287500 -- (-455.089) (-454.844) [-453.518] (-456.536) * (-455.810) [-453.893] (-460.541) (-453.277) -- 0:00:42
288000 -- (-455.448) [-453.311] (-454.985) (-454.880) * [-455.359] (-455.318) (-456.273) (-456.447) -- 0:00:44
288500 -- (-455.538) (-454.655) [-455.581] (-453.291) * [-453.711] (-455.036) (-456.812) (-454.929) -- 0:00:44
289000 -- [-455.324] (-455.328) (-454.654) (-454.935) * (-455.102) (-454.575) (-453.137) [-453.674] -- 0:00:44
289500 -- (-454.570) (-454.584) (-460.467) [-459.493] * (-454.165) [-454.975] (-454.097) (-456.257) -- 0:00:44
290000 -- (-456.669) [-453.414] (-456.395) (-454.308) * (-453.707) (-457.422) [-453.604] (-453.745) -- 0:00:44
Average standard deviation of split frequencies: 0.012688
290500 -- (-454.045) [-454.104] (-455.657) (-454.060) * [-456.380] (-454.041) (-455.259) (-453.773) -- 0:00:43
291000 -- (-457.492) (-454.099) [-455.092] (-453.060) * (-457.395) (-455.680) [-457.241] (-458.657) -- 0:00:43
291500 -- (-454.848) (-456.708) (-457.189) [-455.374] * (-453.788) [-454.588] (-456.647) (-455.297) -- 0:00:43
292000 -- [-453.951] (-457.532) (-456.129) (-453.611) * [-454.102] (-455.151) (-455.033) (-456.213) -- 0:00:43
292500 -- (-454.498) (-458.122) [-453.000] (-455.505) * (-454.261) (-454.112) (-455.015) [-456.075] -- 0:00:43
293000 -- (-459.892) (-456.839) (-456.865) [-453.074] * (-455.563) (-453.866) [-454.532] (-455.269) -- 0:00:43
293500 -- [-452.865] (-452.701) (-453.896) (-454.559) * (-453.309) (-456.028) [-456.446] (-454.719) -- 0:00:43
294000 -- (-455.909) (-453.694) [-454.412] (-456.345) * (-453.545) [-454.321] (-454.100) (-454.893) -- 0:00:43
294500 -- (-453.515) (-452.764) [-458.203] (-454.365) * (-456.943) (-458.195) (-454.721) [-452.730] -- 0:00:43
295000 -- [-454.409] (-453.176) (-457.533) (-455.173) * [-456.522] (-455.669) (-454.347) (-455.660) -- 0:00:43
Average standard deviation of split frequencies: 0.010849
295500 -- (-453.351) [-456.703] (-455.798) (-455.849) * (-456.453) (-455.315) [-452.580] (-457.454) -- 0:00:42
296000 -- [-455.194] (-454.447) (-455.752) (-455.062) * (-454.164) [-454.632] (-454.283) (-453.901) -- 0:00:42
296500 -- [-459.778] (-453.919) (-455.805) (-456.907) * (-454.629) (-454.904) [-453.160] (-456.305) -- 0:00:42
297000 -- (-457.361) [-456.985] (-456.671) (-453.307) * (-455.749) (-455.705) (-454.794) [-454.010] -- 0:00:42
297500 -- (-454.157) (-454.828) (-454.834) [-456.513] * (-456.202) (-453.895) (-456.322) [-453.944] -- 0:00:42
298000 -- (-454.959) [-452.735] (-453.247) (-455.853) * (-456.866) (-453.578) [-454.282] (-459.911) -- 0:00:42
298500 -- [-455.504] (-457.644) (-453.391) (-456.125) * [-455.740] (-453.898) (-453.968) (-457.595) -- 0:00:42
299000 -- (-456.027) [-453.294] (-455.274) (-453.997) * (-456.307) (-454.458) (-455.539) [-454.104] -- 0:00:42
299500 -- (-454.111) [-452.923] (-456.669) (-456.278) * (-457.291) [-453.799] (-452.685) (-454.260) -- 0:00:42
300000 -- (-452.804) (-452.971) [-454.279] (-462.521) * (-457.719) [-452.926] (-458.380) (-454.628) -- 0:00:42
Average standard deviation of split frequencies: 0.009407
300500 -- [-454.155] (-454.344) (-454.341) (-456.235) * [-455.438] (-455.890) (-461.636) (-454.951) -- 0:00:41
301000 -- (-453.592) (-453.800) (-453.820) [-456.010] * [-456.091] (-456.524) (-453.262) (-454.587) -- 0:00:41
301500 -- (-454.772) (-455.355) (-455.323) [-457.226] * (-456.408) [-453.196] (-458.388) (-454.174) -- 0:00:41
302000 -- [-457.765] (-456.280) (-455.203) (-456.763) * (-454.709) (-454.334) [-456.964] (-458.316) -- 0:00:41
302500 -- [-452.957] (-454.389) (-453.995) (-457.669) * (-454.621) (-454.834) (-460.083) [-454.384] -- 0:00:41
303000 -- (-454.358) (-458.652) [-458.351] (-455.616) * [-453.372] (-454.769) (-453.738) (-454.468) -- 0:00:41
303500 -- (-457.764) (-459.010) [-454.630] (-456.447) * [-453.009] (-454.362) (-459.830) (-454.433) -- 0:00:41
304000 -- (-457.080) (-457.097) [-453.438] (-457.686) * (-453.683) (-454.101) (-459.801) [-453.746] -- 0:00:41
304500 -- (-454.018) (-456.785) (-453.635) [-457.831] * (-454.980) [-453.545] (-456.721) (-456.705) -- 0:00:41
305000 -- [-453.488] (-455.114) (-453.775) (-453.492) * (-456.885) (-455.779) [-454.689] (-454.336) -- 0:00:43
Average standard deviation of split frequencies: 0.009628
305500 -- (-454.051) (-458.027) (-453.573) [-454.294] * (-456.547) (-454.862) [-454.878] (-455.923) -- 0:00:43
306000 -- (-453.816) [-452.993] (-456.136) (-454.819) * [-454.236] (-455.477) (-453.784) (-455.792) -- 0:00:43
306500 -- (-453.662) (-454.253) [-454.502] (-453.641) * [-456.132] (-455.145) (-457.343) (-453.956) -- 0:00:42
307000 -- [-454.564] (-456.000) (-454.094) (-453.463) * (-453.313) (-453.345) [-454.286] (-457.008) -- 0:00:42
307500 -- (-454.867) [-452.938] (-454.959) (-454.746) * [-452.868] (-455.202) (-457.543) (-455.870) -- 0:00:42
308000 -- (-455.572) (-452.820) (-454.230) [-452.626] * [-456.554] (-456.833) (-455.289) (-454.024) -- 0:00:42
308500 -- (-453.941) (-452.983) [-454.086] (-452.726) * (-454.583) (-452.955) (-455.357) [-455.342] -- 0:00:42
309000 -- (-454.446) [-454.119] (-453.165) (-454.657) * (-455.376) (-453.078) [-455.460] (-455.020) -- 0:00:42
309500 -- (-456.228) (-457.868) (-453.926) [-454.536] * [-453.577] (-455.737) (-455.246) (-456.329) -- 0:00:42
310000 -- [-455.906] (-456.841) (-455.637) (-456.077) * (-456.342) [-458.711] (-455.579) (-453.067) -- 0:00:42
Average standard deviation of split frequencies: 0.010432
310500 -- (-455.949) (-454.017) (-455.472) [-453.412] * (-459.566) (-459.212) [-455.854] (-456.470) -- 0:00:42
311000 -- (-453.622) [-453.585] (-453.531) (-454.614) * (-455.119) (-460.143) [-453.646] (-455.618) -- 0:00:42
311500 -- (-454.777) (-455.525) (-454.306) [-453.433] * (-455.082) (-453.374) (-453.795) [-454.815] -- 0:00:41
312000 -- (-454.436) [-455.030] (-454.368) (-456.000) * [-454.362] (-457.192) (-457.450) (-454.354) -- 0:00:41
312500 -- [-454.166] (-453.761) (-458.322) (-461.914) * [-453.315] (-459.900) (-457.505) (-458.958) -- 0:00:41
313000 -- (-454.422) [-453.268] (-456.980) (-455.819) * (-456.245) (-454.370) (-458.557) [-453.436] -- 0:00:41
313500 -- (-457.289) (-459.955) [-453.396] (-453.087) * (-454.367) (-455.005) [-453.194] (-454.664) -- 0:00:41
314000 -- [-455.392] (-454.973) (-453.908) (-452.519) * (-456.856) (-456.017) [-453.991] (-455.524) -- 0:00:41
314500 -- [-456.706] (-455.782) (-456.467) (-455.071) * (-455.489) (-455.096) [-454.032] (-454.881) -- 0:00:41
315000 -- (-457.825) (-455.863) (-457.370) [-455.784] * [-458.664] (-454.500) (-453.329) (-455.543) -- 0:00:41
Average standard deviation of split frequencies: 0.011375
315500 -- (-454.260) (-453.644) [-453.903] (-454.438) * [-454.733] (-453.767) (-457.607) (-453.044) -- 0:00:41
316000 -- (-453.042) (-454.112) (-453.269) [-453.027] * [-456.639] (-457.057) (-458.721) (-455.010) -- 0:00:41
316500 -- (-454.328) (-457.708) (-455.684) [-455.823] * [-453.357] (-455.196) (-455.839) (-456.033) -- 0:00:41
317000 -- (-455.756) [-455.514] (-454.123) (-459.474) * (-454.263) (-454.521) (-453.540) [-453.510] -- 0:00:40
317500 -- (-456.356) (-456.610) [-454.959] (-453.856) * [-453.259] (-455.030) (-455.116) (-452.945) -- 0:00:40
318000 -- (-457.596) (-459.572) (-456.186) [-454.411] * (-454.365) [-453.182] (-455.525) (-453.460) -- 0:00:40
318500 -- (-458.368) (-455.614) (-456.828) [-456.205] * (-457.993) [-453.587] (-453.871) (-455.974) -- 0:00:40
319000 -- [-454.415] (-456.920) (-453.519) (-453.188) * [-453.759] (-454.226) (-453.508) (-455.237) -- 0:00:40
319500 -- (-454.016) (-454.593) (-453.638) [-453.676] * [-454.224] (-454.221) (-457.344) (-454.989) -- 0:00:40
320000 -- (-456.259) (-453.591) (-456.347) [-453.104] * (-453.451) (-454.893) [-455.681] (-455.086) -- 0:00:40
Average standard deviation of split frequencies: 0.011669
320500 -- (-452.746) [-453.885] (-458.497) (-454.924) * [-453.046] (-457.536) (-459.390) (-455.107) -- 0:00:40
321000 -- (-452.762) [-452.676] (-454.701) (-454.959) * (-453.437) [-457.210] (-460.598) (-460.108) -- 0:00:40
321500 -- (-453.614) (-452.635) (-453.019) [-454.363] * (-454.094) (-454.325) (-458.204) [-454.593] -- 0:00:40
322000 -- (-455.278) (-455.317) (-453.028) [-454.337] * (-453.443) [-454.436] (-456.819) (-453.150) -- 0:00:42
322500 -- [-457.105] (-455.510) (-460.977) (-454.008) * (-455.512) (-453.181) [-454.265] (-456.323) -- 0:00:42
323000 -- (-457.537) (-453.822) [-453.527] (-455.587) * (-452.520) (-453.611) [-453.212] (-455.048) -- 0:00:41
323500 -- [-454.041] (-457.725) (-456.730) (-455.997) * (-456.289) (-455.028) [-456.928] (-456.403) -- 0:00:41
324000 -- (-455.862) (-458.209) [-456.029] (-456.066) * (-454.878) [-453.821] (-454.539) (-453.907) -- 0:00:41
324500 -- (-456.966) (-455.407) (-457.674) [-453.544] * (-453.786) (-456.644) (-455.588) [-454.538] -- 0:00:41
325000 -- (-457.185) (-456.098) (-455.762) [-453.340] * [-454.159] (-455.368) (-453.786) (-454.436) -- 0:00:41
Average standard deviation of split frequencies: 0.011387
325500 -- (-455.093) (-458.341) [-454.236] (-453.174) * (-456.658) [-455.780] (-453.550) (-455.671) -- 0:00:41
326000 -- (-455.698) (-454.956) [-454.632] (-455.034) * (-455.179) (-455.704) (-453.730) [-455.430] -- 0:00:41
326500 -- (-455.343) (-455.443) (-458.355) [-454.151] * (-454.929) (-457.678) (-453.840) [-454.612] -- 0:00:41
327000 -- [-453.521] (-458.366) (-452.843) (-454.320) * (-455.188) [-457.055] (-453.378) (-454.824) -- 0:00:41
327500 -- [-455.213] (-456.894) (-458.768) (-454.227) * (-455.928) (-454.297) (-454.899) [-452.914] -- 0:00:41
328000 -- [-454.802] (-455.970) (-453.894) (-455.592) * (-456.878) (-453.306) (-458.801) [-452.984] -- 0:00:40
328500 -- [-456.504] (-454.546) (-453.109) (-454.948) * (-454.270) (-454.301) [-455.488] (-455.240) -- 0:00:40
329000 -- (-454.858) [-454.116] (-459.526) (-457.285) * (-455.602) (-454.216) (-454.407) [-453.026] -- 0:00:40
329500 -- (-453.937) (-454.734) (-455.331) [-456.772] * (-455.486) [-456.863] (-453.140) (-454.070) -- 0:00:40
330000 -- (-459.432) [-457.376] (-459.016) (-454.064) * [-453.555] (-454.359) (-453.417) (-455.337) -- 0:00:40
Average standard deviation of split frequencies: 0.011761
330500 -- (-455.739) [-454.268] (-454.408) (-454.028) * (-456.183) [-456.347] (-454.013) (-456.139) -- 0:00:40
331000 -- (-455.188) (-454.205) (-452.772) [-458.003] * (-455.663) (-454.753) [-453.304] (-454.148) -- 0:00:40
331500 -- (-455.825) (-453.399) [-452.719] (-454.511) * (-458.199) [-456.307] (-454.202) (-457.259) -- 0:00:40
332000 -- [-457.259] (-454.160) (-452.898) (-454.463) * (-457.577) (-454.511) [-453.489] (-459.578) -- 0:00:40
332500 -- (-459.191) [-455.277] (-454.673) (-455.395) * [-455.062] (-453.981) (-453.543) (-457.991) -- 0:00:40
333000 -- (-459.408) (-453.729) (-454.491) [-452.990] * (-454.876) (-453.930) [-454.149] (-456.133) -- 0:00:40
333500 -- (-459.355) [-454.493] (-455.684) (-452.851) * [-453.801] (-452.671) (-453.586) (-453.746) -- 0:00:39
334000 -- (-457.046) (-454.060) [-454.469] (-455.425) * (-455.223) (-454.371) (-456.934) [-454.355] -- 0:00:39
334500 -- (-453.103) (-454.470) (-455.267) [-456.489] * [-454.699] (-458.873) (-455.493) (-452.750) -- 0:00:39
335000 -- (-454.423) (-457.984) [-453.486] (-456.377) * (-456.725) [-453.961] (-461.124) (-452.882) -- 0:00:39
Average standard deviation of split frequencies: 0.012890
335500 -- [-455.052] (-453.610) (-459.042) (-455.681) * (-453.248) (-453.270) (-457.339) [-454.541] -- 0:00:39
336000 -- (-454.643) [-455.263] (-460.505) (-455.303) * (-456.438) (-456.118) [-454.645] (-467.899) -- 0:00:39
336500 -- (-453.782) [-453.265] (-456.038) (-453.751) * (-456.067) [-454.616] (-454.933) (-456.236) -- 0:00:39
337000 -- (-454.468) [-454.245] (-454.835) (-453.634) * [-455.151] (-454.394) (-455.932) (-453.504) -- 0:00:39
337500 -- (-456.715) (-453.424) [-456.516] (-455.963) * [-454.326] (-456.222) (-454.779) (-453.401) -- 0:00:39
338000 -- [-453.738] (-457.273) (-454.456) (-455.273) * (-454.388) (-456.706) [-453.634] (-454.648) -- 0:00:39
338500 -- (-453.770) (-453.492) [-457.052] (-454.941) * (-454.042) (-458.183) (-454.146) [-455.312] -- 0:00:39
339000 -- (-457.165) (-457.404) (-455.399) [-452.928] * (-457.839) (-455.621) [-454.782] (-453.276) -- 0:00:40
339500 -- (-455.830) (-454.348) (-455.408) [-453.293] * [-455.304] (-453.953) (-455.227) (-464.687) -- 0:00:40
340000 -- (-457.801) (-455.112) (-454.254) [-454.623] * [-453.778] (-459.508) (-457.112) (-458.002) -- 0:00:40
Average standard deviation of split frequencies: 0.013059
340500 -- (-455.325) [-457.613] (-459.692) (-454.724) * (-454.685) (-453.471) (-453.900) [-456.949] -- 0:00:40
341000 -- [-459.413] (-457.701) (-454.127) (-453.649) * [-453.038] (-461.157) (-453.452) (-458.610) -- 0:00:40
341500 -- (-453.777) (-452.993) (-455.911) [-453.229] * [-454.141] (-455.446) (-453.680) (-456.292) -- 0:00:40
342000 -- (-452.871) (-456.470) (-455.881) [-455.169] * (-454.902) [-455.928] (-453.912) (-456.260) -- 0:00:40
342500 -- (-453.028) (-455.036) (-453.736) [-452.430] * (-454.770) [-454.761] (-454.539) (-455.782) -- 0:00:40
343000 -- (-453.988) (-453.747) (-453.844) [-452.776] * (-454.192) (-455.827) (-455.791) [-458.932] -- 0:00:40
343500 -- [-455.905] (-454.433) (-453.815) (-453.202) * (-454.233) [-455.681] (-462.283) (-452.819) -- 0:00:40
344000 -- (-455.179) (-454.369) (-454.734) [-456.124] * (-456.448) [-455.278] (-458.581) (-453.504) -- 0:00:40
344500 -- (-456.210) [-455.128] (-454.226) (-457.213) * (-456.637) (-453.319) (-455.977) [-452.891] -- 0:00:39
345000 -- (-453.264) [-458.641] (-456.336) (-454.492) * (-455.269) (-457.620) (-456.417) [-454.478] -- 0:00:39
Average standard deviation of split frequencies: 0.012262
345500 -- (-453.359) (-453.369) (-454.278) [-454.322] * [-454.690] (-453.929) (-453.947) (-455.635) -- 0:00:39
346000 -- (-453.917) (-456.921) (-455.355) [-453.473] * (-454.270) (-455.702) (-453.534) [-456.264] -- 0:00:39
346500 -- (-455.498) [-455.933] (-458.746) (-452.521) * [-452.645] (-452.841) (-455.160) (-454.030) -- 0:00:39
347000 -- (-454.107) [-456.549] (-455.815) (-452.868) * (-453.656) (-454.390) (-456.169) [-455.192] -- 0:00:39
347500 -- (-453.495) (-456.264) (-455.532) [-454.786] * (-455.832) (-456.381) [-455.831] (-455.491) -- 0:00:39
348000 -- (-455.695) (-454.603) [-456.609] (-461.128) * (-453.135) [-455.848] (-454.702) (-455.403) -- 0:00:39
348500 -- (-454.834) [-455.234] (-453.505) (-455.097) * (-456.540) (-452.864) [-453.454] (-454.683) -- 0:00:39
349000 -- (-456.368) (-460.350) (-454.782) [-454.140] * (-455.363) (-455.563) [-458.106] (-453.223) -- 0:00:39
349500 -- (-455.064) (-458.320) [-453.253] (-455.311) * (-455.213) [-453.535] (-455.734) (-454.954) -- 0:00:39
350000 -- (-455.591) [-454.937] (-452.620) (-454.560) * (-454.346) (-453.873) (-462.695) [-455.182] -- 0:00:39
Average standard deviation of split frequencies: 0.011343
350500 -- (-455.835) [-456.624] (-455.682) (-455.148) * (-454.895) (-456.112) [-453.480] (-459.240) -- 0:00:38
351000 -- [-453.321] (-453.890) (-456.011) (-453.376) * (-454.046) (-453.752) [-454.290] (-460.098) -- 0:00:38
351500 -- (-454.178) (-457.190) (-456.055) [-456.455] * (-455.303) (-453.611) [-455.652] (-459.789) -- 0:00:38
352000 -- [-457.077] (-455.890) (-457.567) (-457.361) * (-455.173) (-454.080) [-453.658] (-455.770) -- 0:00:38
352500 -- [-457.729] (-454.657) (-455.039) (-454.498) * (-454.733) (-456.676) [-453.029] (-453.662) -- 0:00:38
353000 -- (-455.265) (-457.039) [-455.291] (-453.488) * (-453.808) (-453.730) [-457.407] (-452.715) -- 0:00:38
353500 -- (-454.454) (-458.895) [-454.350] (-454.836) * (-452.605) (-453.203) (-455.800) [-453.044] -- 0:00:38
354000 -- [-455.479] (-458.329) (-455.619) (-458.235) * (-456.997) (-453.318) (-458.361) [-455.034] -- 0:00:38
354500 -- (-457.626) (-457.917) (-453.832) [-454.218] * (-458.466) (-454.723) [-453.392] (-454.981) -- 0:00:38
355000 -- [-453.787] (-453.573) (-453.888) (-455.065) * (-455.339) (-453.460) (-456.168) [-454.631] -- 0:00:38
Average standard deviation of split frequencies: 0.011338
355500 -- [-454.028] (-454.524) (-454.544) (-457.994) * [-454.884] (-454.341) (-455.018) (-454.028) -- 0:00:38
356000 -- (-453.754) [-454.150] (-452.990) (-454.381) * (-456.222) [-454.304] (-454.058) (-458.429) -- 0:00:39
356500 -- (-455.560) (-454.543) [-455.451] (-463.156) * (-457.049) (-454.060) [-453.441] (-455.027) -- 0:00:39
357000 -- (-454.317) (-452.953) [-456.416] (-457.340) * (-457.586) (-455.986) [-456.098] (-455.640) -- 0:00:39
357500 -- (-456.245) [-452.880] (-455.534) (-453.890) * (-457.750) (-453.963) [-455.290] (-454.617) -- 0:00:39
358000 -- (-453.633) (-454.137) [-453.757] (-453.832) * (-456.557) [-453.414] (-455.931) (-455.273) -- 0:00:39
358500 -- (-454.707) (-453.026) (-453.508) [-452.895] * [-454.422] (-456.567) (-457.108) (-454.264) -- 0:00:39
359000 -- (-453.798) (-453.748) (-456.145) [-454.102] * [-455.240] (-455.647) (-453.339) (-454.919) -- 0:00:39
359500 -- (-455.116) (-453.643) [-456.765] (-452.981) * (-453.756) (-453.143) [-454.194] (-455.668) -- 0:00:39
360000 -- (-459.746) (-454.168) (-453.815) [-452.534] * (-459.219) (-454.399) [-453.311] (-454.201) -- 0:00:39
Average standard deviation of split frequencies: 0.010048
360500 -- (-459.783) (-456.910) (-454.457) [-454.910] * [-457.117] (-454.169) (-457.727) (-453.597) -- 0:00:39
361000 -- (-456.290) (-453.102) [-454.093] (-457.351) * (-453.774) (-457.001) [-456.713] (-455.748) -- 0:00:38
361500 -- (-457.611) (-454.246) [-454.112] (-454.162) * (-452.639) (-455.773) (-453.876) [-454.650] -- 0:00:38
362000 -- (-453.678) (-456.275) (-453.257) [-452.651] * (-452.375) (-454.042) (-457.214) [-454.024] -- 0:00:38
362500 -- (-459.561) (-459.311) [-455.533] (-453.409) * (-454.345) (-455.933) [-453.104] (-455.570) -- 0:00:38
363000 -- (-453.450) (-454.575) [-453.258] (-456.359) * [-454.325] (-454.648) (-453.790) (-455.529) -- 0:00:38
363500 -- (-454.188) (-453.309) (-456.776) [-452.999] * [-452.462] (-454.162) (-453.650) (-453.765) -- 0:00:38
364000 -- (-455.761) (-453.448) [-455.978] (-454.682) * (-454.545) (-454.984) (-453.526) [-455.768] -- 0:00:38
364500 -- [-454.419] (-453.411) (-455.458) (-456.177) * (-455.591) (-456.684) [-456.329] (-456.634) -- 0:00:38
365000 -- [-454.073] (-454.632) (-455.523) (-459.509) * (-456.882) (-454.829) (-456.531) [-453.925] -- 0:00:38
Average standard deviation of split frequencies: 0.009177
365500 -- (-455.646) (-455.753) (-454.330) [-453.358] * (-456.987) [-454.017] (-454.064) (-458.149) -- 0:00:38
366000 -- (-455.412) (-455.588) (-453.247) [-454.403] * (-454.470) (-454.020) [-455.157] (-454.845) -- 0:00:38
366500 -- (-452.900) (-456.398) [-453.121] (-455.616) * [-453.143] (-458.395) (-453.877) (-454.997) -- 0:00:38
367000 -- (-454.729) [-454.725] (-453.754) (-456.380) * (-452.571) (-457.620) (-455.316) [-456.075] -- 0:00:37
367500 -- (-456.897) (-455.718) [-454.539] (-454.243) * (-452.944) (-456.151) (-458.206) [-453.348] -- 0:00:37
368000 -- (-453.767) (-453.815) [-453.313] (-457.684) * (-454.578) [-455.836] (-454.074) (-453.142) -- 0:00:37
368500 -- [-454.585] (-459.151) (-452.688) (-457.723) * (-457.319) [-456.677] (-454.028) (-453.568) -- 0:00:37
369000 -- (-456.108) (-453.833) (-455.026) [-455.223] * (-455.876) [-453.216] (-455.402) (-456.578) -- 0:00:37
369500 -- [-454.828] (-455.520) (-454.340) (-454.539) * (-454.277) (-455.919) (-455.371) [-454.559] -- 0:00:37
370000 -- [-455.943] (-454.541) (-455.015) (-453.908) * (-457.474) (-457.859) [-453.205] (-453.709) -- 0:00:37
Average standard deviation of split frequencies: 0.009141
370500 -- [-453.895] (-455.169) (-458.812) (-454.904) * [-455.354] (-453.292) (-456.856) (-454.733) -- 0:00:37
371000 -- (-453.149) (-458.568) (-457.107) [-453.777] * (-455.355) (-457.130) (-456.570) [-457.985] -- 0:00:37
371500 -- (-453.819) (-457.066) [-454.081] (-452.951) * [-453.702] (-454.611) (-458.680) (-457.565) -- 0:00:37
372000 -- (-454.303) [-456.399] (-458.762) (-457.922) * (-454.958) [-454.752] (-455.161) (-453.990) -- 0:00:38
372500 -- (-454.474) [-459.382] (-454.196) (-460.548) * (-454.951) (-454.196) [-457.879] (-454.988) -- 0:00:38
373000 -- [-453.271] (-455.130) (-455.323) (-459.025) * [-457.375] (-456.623) (-454.441) (-456.365) -- 0:00:38
373500 -- [-452.718] (-453.472) (-452.658) (-454.535) * (-456.667) (-456.297) (-453.799) [-455.289] -- 0:00:38
374000 -- (-458.260) (-455.220) [-457.726] (-454.623) * (-458.272) (-453.067) (-455.820) [-452.977] -- 0:00:38
374500 -- (-453.159) [-457.335] (-453.800) (-455.553) * (-455.202) [-454.465] (-459.160) (-452.628) -- 0:00:38
375000 -- [-454.420] (-457.382) (-454.817) (-454.583) * (-454.816) (-454.408) (-454.863) [-455.153] -- 0:00:38
Average standard deviation of split frequencies: 0.010343
375500 -- (-454.319) [-457.094] (-463.706) (-453.476) * [-454.332] (-454.041) (-453.437) (-455.221) -- 0:00:38
376000 -- (-456.068) (-457.370) (-456.280) [-454.451] * (-460.210) (-454.760) (-455.917) [-454.070] -- 0:00:38
376500 -- [-452.960] (-455.984) (-455.807) (-455.467) * (-460.380) [-455.001] (-455.056) (-457.608) -- 0:00:38
377000 -- (-453.751) (-457.167) (-452.906) [-454.753] * (-454.918) (-453.430) [-455.134] (-456.294) -- 0:00:38
377500 -- [-454.809] (-457.570) (-453.395) (-454.468) * (-458.717) (-453.650) (-457.289) [-455.358] -- 0:00:37
378000 -- (-454.544) (-455.904) (-453.532) [-457.926] * (-453.269) (-454.132) [-454.966] (-453.744) -- 0:00:37
378500 -- (-454.291) (-457.650) (-456.547) [-454.869] * (-453.155) (-454.777) (-454.135) [-454.126] -- 0:00:37
379000 -- (-456.761) [-454.651] (-457.557) (-454.450) * (-453.895) (-454.993) (-455.877) [-453.940] -- 0:00:37
379500 -- (-455.104) [-453.698] (-456.501) (-460.773) * (-454.676) [-453.445] (-455.410) (-454.593) -- 0:00:37
380000 -- (-454.288) (-453.882) [-454.993] (-457.886) * (-457.021) [-453.630] (-454.908) (-454.573) -- 0:00:37
Average standard deviation of split frequencies: 0.009752
380500 -- (-458.832) (-457.080) [-453.861] (-456.237) * [-458.406] (-453.432) (-453.134) (-454.932) -- 0:00:37
381000 -- (-455.655) [-455.785] (-453.498) (-456.523) * (-455.781) (-453.274) (-454.287) [-455.614] -- 0:00:37
381500 -- (-456.722) (-456.053) (-458.481) [-457.033] * (-458.444) [-454.652] (-457.697) (-453.351) -- 0:00:37
382000 -- (-453.368) (-456.191) (-456.701) [-455.686] * [-456.655] (-453.650) (-454.650) (-455.942) -- 0:00:37
382500 -- [-455.184] (-454.804) (-458.408) (-454.077) * (-461.534) (-455.262) (-455.207) [-456.516] -- 0:00:37
383000 -- (-453.427) (-456.914) [-453.668] (-454.886) * (-454.526) [-454.787] (-455.138) (-453.543) -- 0:00:37
383500 -- (-453.791) [-453.849] (-454.677) (-456.428) * (-454.394) (-453.824) [-452.864] (-456.849) -- 0:00:36
384000 -- (-454.979) (-459.954) [-457.928] (-455.722) * [-456.347] (-453.785) (-457.551) (-454.876) -- 0:00:36
384500 -- [-453.299] (-456.293) (-455.467) (-456.744) * (-454.539) (-454.221) (-459.465) [-453.482] -- 0:00:36
385000 -- (-455.015) (-453.438) [-453.890] (-455.504) * (-453.601) (-454.450) (-457.068) [-453.869] -- 0:00:36
Average standard deviation of split frequencies: 0.011566
385500 -- (-456.389) [-453.508] (-454.160) (-462.238) * (-453.763) (-457.780) [-453.980] (-453.877) -- 0:00:36
386000 -- (-455.581) (-454.193) (-456.884) [-455.482] * (-453.359) (-454.886) (-455.636) [-454.504] -- 0:00:36
386500 -- [-455.787] (-455.350) (-455.768) (-455.579) * (-453.393) (-456.710) [-453.949] (-455.065) -- 0:00:36
387000 -- (-454.807) (-455.041) (-459.318) [-453.217] * [-454.451] (-456.095) (-453.119) (-457.643) -- 0:00:36
387500 -- (-454.024) (-456.835) (-454.563) [-455.112] * (-453.761) (-455.847) (-454.330) [-455.870] -- 0:00:36
388000 -- (-458.525) [-453.937] (-453.998) (-453.635) * (-453.865) (-455.258) (-454.195) [-452.932] -- 0:00:36
388500 -- (-453.597) (-456.723) [-453.681] (-454.173) * (-453.154) (-453.853) [-457.684] (-454.743) -- 0:00:37
389000 -- (-453.311) (-455.655) [-454.713] (-455.341) * (-459.639) (-452.955) [-454.067] (-454.445) -- 0:00:37
389500 -- [-456.273] (-454.343) (-453.864) (-456.800) * [-456.294] (-454.523) (-455.353) (-454.006) -- 0:00:37
390000 -- (-456.978) (-452.960) (-454.712) [-454.711] * (-460.605) [-453.746] (-459.856) (-454.674) -- 0:00:37
Average standard deviation of split frequencies: 0.011313
390500 -- (-453.091) (-453.944) [-454.052] (-456.765) * (-457.336) (-453.754) [-453.868] (-459.112) -- 0:00:37
391000 -- (-454.460) (-455.325) (-454.105) [-454.353] * (-454.948) (-454.337) [-453.793] (-457.497) -- 0:00:37
391500 -- (-456.298) (-455.612) [-454.622] (-454.321) * (-456.932) [-454.090] (-454.855) (-454.470) -- 0:00:37
392000 -- (-457.223) (-454.058) [-455.330] (-456.478) * [-453.856] (-452.914) (-453.757) (-459.164) -- 0:00:37
392500 -- (-456.232) [-455.564] (-454.656) (-453.605) * (-455.238) (-453.076) [-452.817] (-458.855) -- 0:00:37
393000 -- (-452.736) [-452.465] (-455.974) (-455.874) * (-455.287) (-454.084) (-453.495) [-456.674] -- 0:00:37
393500 -- (-454.133) (-453.099) (-454.396) [-455.746] * (-453.106) (-454.556) [-456.421] (-453.673) -- 0:00:36
394000 -- (-453.392) [-456.351] (-455.181) (-460.820) * [-453.220] (-454.220) (-455.194) (-453.050) -- 0:00:36
394500 -- (-456.200) (-455.859) [-453.403] (-460.881) * (-454.300) (-457.425) (-453.347) [-454.038] -- 0:00:36
395000 -- [-455.763] (-453.201) (-457.464) (-454.135) * [-453.074] (-454.507) (-458.067) (-454.590) -- 0:00:36
Average standard deviation of split frequencies: 0.011979
395500 -- (-453.533) [-456.130] (-455.996) (-455.541) * [-455.352] (-454.231) (-455.563) (-453.603) -- 0:00:36
396000 -- (-453.096) (-454.212) [-454.022] (-454.030) * (-458.899) (-454.517) [-453.477] (-454.322) -- 0:00:36
396500 -- (-452.785) (-453.727) [-452.912] (-452.528) * (-454.602) [-453.829] (-453.182) (-453.603) -- 0:00:36
397000 -- (-456.776) (-453.435) (-452.908) [-456.197] * (-456.254) [-463.108] (-456.539) (-453.964) -- 0:00:36
397500 -- (-458.914) (-454.722) [-452.717] (-456.466) * (-457.431) (-456.834) [-456.764] (-453.915) -- 0:00:36
398000 -- (-455.179) (-453.749) (-454.641) [-457.578] * [-455.748] (-453.253) (-454.521) (-453.939) -- 0:00:36
398500 -- (-456.308) (-454.540) [-453.881] (-455.872) * (-457.168) [-453.414] (-453.148) (-456.607) -- 0:00:36
399000 -- (-456.777) (-455.118) [-455.668] (-453.528) * (-455.043) [-453.946] (-452.740) (-454.587) -- 0:00:36
399500 -- (-454.650) (-455.291) (-456.794) [-454.053] * (-454.287) (-454.835) [-453.625] (-453.996) -- 0:00:36
400000 -- (-454.008) (-455.961) (-455.646) [-453.673] * (-457.464) (-456.100) [-452.863] (-452.439) -- 0:00:36
Average standard deviation of split frequencies: 0.011766
400500 -- (-453.919) [-455.853] (-455.052) (-452.533) * [-454.456] (-456.792) (-454.793) (-452.603) -- 0:00:35
401000 -- (-453.510) (-461.309) [-456.314] (-453.006) * (-454.501) [-453.098] (-452.902) (-454.044) -- 0:00:35
401500 -- (-454.796) (-455.015) [-452.949] (-455.351) * (-457.747) (-455.943) (-456.492) [-459.418] -- 0:00:35
402000 -- (-453.616) (-456.564) (-455.758) [-452.764] * (-456.619) (-456.827) (-463.163) [-454.286] -- 0:00:35
402500 -- (-453.492) (-455.030) [-454.152] (-454.920) * (-455.600) (-457.936) [-455.381] (-454.497) -- 0:00:35
403000 -- (-455.973) (-456.348) [-455.575] (-453.928) * (-457.071) [-454.112] (-455.267) (-458.815) -- 0:00:35
403500 -- [-453.840] (-454.349) (-456.491) (-456.123) * (-455.853) (-453.148) (-459.392) [-453.246] -- 0:00:35
404000 -- (-453.725) (-461.036) (-457.914) [-455.180] * (-457.692) (-455.310) [-456.456] (-457.217) -- 0:00:35
404500 -- (-454.768) (-452.821) (-453.663) [-457.908] * (-456.683) (-456.696) [-454.642] (-454.882) -- 0:00:35
405000 -- (-455.285) [-454.150] (-453.286) (-462.192) * (-456.779) (-457.594) [-453.525] (-454.246) -- 0:00:35
Average standard deviation of split frequencies: 0.011466
405500 -- (-453.447) (-454.134) [-457.156] (-455.911) * [-455.318] (-459.407) (-453.536) (-453.839) -- 0:00:36
406000 -- (-453.653) (-459.072) (-455.283) [-452.773] * (-455.897) [-453.693] (-455.776) (-453.417) -- 0:00:36
406500 -- [-453.828] (-454.810) (-453.949) (-452.634) * (-453.569) (-454.873) [-455.169] (-453.633) -- 0:00:36
407000 -- (-456.475) [-453.838] (-455.808) (-455.858) * (-458.597) (-455.748) (-457.386) [-453.014] -- 0:00:36
407500 -- [-454.093] (-452.863) (-456.609) (-455.527) * (-453.104) (-456.148) [-454.883] (-452.563) -- 0:00:36
408000 -- (-456.482) (-453.697) [-454.275] (-456.037) * (-457.996) (-454.640) (-453.588) [-455.678] -- 0:00:36
408500 -- (-457.188) (-453.812) [-457.462] (-454.192) * (-456.147) [-453.214] (-456.337) (-454.029) -- 0:00:36
409000 -- (-454.051) [-454.644] (-457.559) (-455.229) * (-457.495) [-453.217] (-457.607) (-452.640) -- 0:00:36
409500 -- (-455.811) (-456.019) (-455.385) [-457.677] * (-454.544) (-456.226) (-454.881) [-453.419] -- 0:00:36
410000 -- (-458.501) (-458.169) [-457.114] (-453.992) * (-453.396) (-455.800) (-455.826) [-454.176] -- 0:00:35
Average standard deviation of split frequencies: 0.012154
410500 -- (-454.357) (-464.195) (-456.591) [-453.931] * [-453.808] (-455.492) (-454.671) (-454.700) -- 0:00:35
411000 -- (-457.666) [-453.755] (-458.823) (-457.976) * (-453.728) [-454.257] (-455.018) (-454.862) -- 0:00:35
411500 -- (-454.263) [-453.274] (-463.061) (-456.825) * [-456.908] (-455.566) (-454.589) (-454.733) -- 0:00:35
412000 -- (-453.920) (-456.830) [-454.969] (-454.606) * [-454.735] (-453.006) (-455.703) (-453.060) -- 0:00:35
412500 -- [-454.142] (-454.292) (-453.698) (-453.433) * (-455.655) (-453.710) (-453.462) [-453.857] -- 0:00:35
413000 -- (-453.452) (-453.922) (-455.166) [-454.719] * [-452.683] (-453.688) (-455.396) (-453.717) -- 0:00:35
413500 -- (-453.378) (-454.438) [-455.975] (-454.438) * (-462.244) (-454.135) (-452.925) [-454.135] -- 0:00:35
414000 -- [-454.936] (-454.192) (-454.036) (-457.397) * (-454.809) [-453.530] (-453.713) (-455.638) -- 0:00:35
414500 -- (-454.582) [-458.054] (-454.323) (-460.239) * [-452.547] (-456.171) (-453.101) (-453.597) -- 0:00:35
415000 -- (-458.434) [-453.743] (-454.534) (-453.146) * [-454.717] (-452.608) (-453.347) (-455.592) -- 0:00:35
Average standard deviation of split frequencies: 0.011265
415500 -- (-453.648) [-454.823] (-453.629) (-456.261) * [-455.354] (-453.686) (-455.121) (-455.468) -- 0:00:35
416000 -- [-453.673] (-454.657) (-455.061) (-454.918) * (-453.111) [-456.981] (-455.205) (-454.744) -- 0:00:35
416500 -- [-453.737] (-453.366) (-456.952) (-454.618) * [-453.187] (-453.953) (-455.044) (-454.866) -- 0:00:35
417000 -- (-452.934) [-457.877] (-454.096) (-455.204) * (-456.762) (-453.479) (-460.901) [-453.448] -- 0:00:34
417500 -- (-453.423) [-455.592] (-454.087) (-453.869) * (-456.823) [-453.112] (-459.919) (-453.234) -- 0:00:34
418000 -- [-455.090] (-456.841) (-456.272) (-455.522) * (-454.780) [-453.230] (-456.096) (-455.336) -- 0:00:34
418500 -- (-455.205) [-453.898] (-456.121) (-455.245) * (-453.295) [-454.228] (-453.058) (-455.474) -- 0:00:34
419000 -- (-453.962) [-457.852] (-455.146) (-454.249) * (-454.358) (-455.121) (-457.782) [-458.262] -- 0:00:34
419500 -- (-453.915) [-453.520] (-455.754) (-457.237) * (-454.581) (-453.713) [-454.245] (-454.878) -- 0:00:34
420000 -- (-454.263) [-453.563] (-459.983) (-452.810) * [-453.282] (-455.712) (-455.961) (-456.307) -- 0:00:34
Average standard deviation of split frequencies: 0.010086
420500 -- [-453.042] (-455.894) (-458.394) (-455.104) * [-455.165] (-454.478) (-456.584) (-455.115) -- 0:00:34
421000 -- [-456.612] (-453.819) (-453.770) (-456.193) * (-453.887) (-454.186) [-457.152] (-457.785) -- 0:00:34
421500 -- [-454.310] (-455.847) (-457.989) (-456.046) * (-453.582) (-454.744) (-453.671) [-454.177] -- 0:00:34
422000 -- (-454.159) (-454.143) [-453.219] (-455.267) * (-455.061) [-458.364] (-453.845) (-456.678) -- 0:00:34
422500 -- (-456.762) (-454.940) [-452.774] (-454.466) * (-454.189) [-453.601] (-456.933) (-454.981) -- 0:00:35
423000 -- (-456.450) (-457.084) (-458.879) [-453.167] * [-453.779] (-454.975) (-455.349) (-454.708) -- 0:00:35
423500 -- [-460.677] (-454.192) (-453.593) (-460.069) * (-454.448) (-453.125) [-453.095] (-453.861) -- 0:00:35
424000 -- (-453.567) (-454.343) (-456.781) [-452.942] * [-453.161] (-456.625) (-453.720) (-453.419) -- 0:00:35
424500 -- (-456.074) (-453.807) (-454.730) [-456.583] * (-453.953) [-455.691] (-454.301) (-455.709) -- 0:00:35
425000 -- (-453.319) (-455.633) (-455.117) [-457.456] * (-454.568) [-454.195] (-453.783) (-454.516) -- 0:00:35
Average standard deviation of split frequencies: 0.009129
425500 -- (-455.405) (-462.459) [-455.710] (-453.168) * (-453.485) (-456.047) [-453.046] (-453.018) -- 0:00:35
426000 -- [-455.289] (-458.880) (-454.440) (-452.630) * (-456.748) (-457.828) (-452.842) [-453.744] -- 0:00:35
426500 -- (-455.818) (-454.741) (-456.293) [-455.512] * (-454.527) (-453.826) (-453.295) [-453.147] -- 0:00:34
427000 -- (-454.826) [-454.571] (-454.967) (-458.360) * (-456.381) (-456.255) (-456.449) [-453.716] -- 0:00:34
427500 -- (-455.374) [-453.508] (-454.745) (-455.745) * (-455.692) (-453.843) [-454.995] (-453.859) -- 0:00:34
428000 -- [-454.303] (-456.167) (-458.058) (-454.180) * (-453.324) (-453.539) [-453.968] (-456.542) -- 0:00:34
428500 -- (-455.438) (-454.775) (-458.081) [-456.677] * (-454.521) [-454.225] (-454.220) (-453.941) -- 0:00:34
429000 -- [-453.901] (-453.544) (-456.812) (-454.393) * (-459.402) (-457.655) [-453.871] (-456.548) -- 0:00:34
429500 -- (-455.021) (-453.050) (-459.534) [-455.331] * [-456.942] (-456.452) (-454.607) (-458.706) -- 0:00:34
430000 -- (-454.728) [-453.831] (-454.179) (-456.610) * [-452.962] (-455.486) (-455.886) (-456.631) -- 0:00:34
Average standard deviation of split frequencies: 0.009167
430500 -- [-453.594] (-458.019) (-454.484) (-455.438) * (-453.753) (-454.518) (-455.618) [-453.482] -- 0:00:34
431000 -- [-457.796] (-454.494) (-456.412) (-455.350) * (-455.998) (-458.079) (-455.497) [-454.007] -- 0:00:34
431500 -- (-454.811) [-453.682] (-457.384) (-456.448) * (-454.928) (-456.290) [-454.470] (-452.987) -- 0:00:34
432000 -- [-454.716] (-453.052) (-454.303) (-461.587) * (-455.438) (-454.227) [-453.892] (-454.260) -- 0:00:34
432500 -- (-454.112) (-455.655) (-453.991) [-457.024] * (-453.996) (-454.869) (-454.469) [-454.403] -- 0:00:34
433000 -- (-455.383) (-455.857) (-455.251) [-453.708] * (-455.406) (-458.697) [-458.092] (-454.014) -- 0:00:34
433500 -- (-453.574) (-455.955) [-452.753] (-453.439) * (-458.215) (-454.732) (-453.984) [-454.887] -- 0:00:33
434000 -- (-453.313) (-453.214) [-454.290] (-455.349) * [-453.936] (-455.605) (-454.169) (-458.857) -- 0:00:33
434500 -- (-453.419) (-453.995) [-453.883] (-458.024) * [-455.043] (-454.680) (-454.151) (-454.718) -- 0:00:33
435000 -- [-453.238] (-455.850) (-454.824) (-453.315) * (-454.632) (-455.652) [-453.719] (-453.684) -- 0:00:33
Average standard deviation of split frequencies: 0.008920
435500 -- (-456.743) (-457.454) (-456.069) [-453.375] * (-455.991) [-452.976] (-455.420) (-453.808) -- 0:00:33
436000 -- (-453.190) (-453.086) [-456.801] (-456.781) * (-456.122) (-455.964) [-453.796] (-454.956) -- 0:00:33
436500 -- (-455.785) [-458.403] (-455.740) (-457.802) * (-456.249) (-453.568) (-456.742) [-456.254] -- 0:00:33
437000 -- (-452.495) (-457.895) (-454.746) [-457.562] * [-457.516] (-455.567) (-459.751) (-457.268) -- 0:00:33
437500 -- (-452.609) [-456.983] (-453.487) (-457.442) * (-455.315) (-456.799) [-453.422] (-453.130) -- 0:00:33
438000 -- (-453.134) [-459.649] (-454.940) (-453.916) * (-458.238) (-458.041) (-457.102) [-454.962] -- 0:00:33
438500 -- (-453.658) (-453.266) [-455.177] (-454.508) * (-456.049) (-457.620) (-456.566) [-456.307] -- 0:00:33
439000 -- [-455.017] (-454.915) (-455.226) (-456.489) * (-454.240) (-454.888) [-455.458] (-456.068) -- 0:00:33
439500 -- (-456.687) [-453.238] (-452.539) (-455.420) * (-454.136) (-454.213) (-454.384) [-454.712] -- 0:00:34
440000 -- (-456.328) (-453.926) (-458.608) [-456.103] * (-458.410) (-457.879) (-455.921) [-454.263] -- 0:00:34
Average standard deviation of split frequencies: 0.009565
440500 -- (-454.667) (-453.461) [-452.622] (-454.167) * (-456.069) (-454.175) (-455.068) [-453.755] -- 0:00:34
441000 -- (-455.873) (-453.071) (-455.227) [-454.799] * (-456.445) [-454.465] (-453.676) (-455.440) -- 0:00:34
441500 -- (-453.384) (-453.300) (-452.802) [-453.263] * [-455.144] (-455.204) (-456.055) (-456.445) -- 0:00:34
442000 -- [-453.815] (-453.212) (-455.777) (-454.111) * [-454.635] (-454.030) (-453.756) (-455.927) -- 0:00:34
442500 -- [-453.729] (-453.272) (-454.719) (-455.032) * (-458.013) [-454.312] (-453.499) (-452.984) -- 0:00:34
443000 -- [-454.764] (-452.853) (-452.985) (-456.398) * (-453.842) (-454.704) (-456.162) [-456.605] -- 0:00:33
443500 -- (-452.840) (-457.937) [-455.118] (-453.546) * [-455.227] (-455.955) (-456.081) (-453.425) -- 0:00:33
444000 -- (-455.108) (-455.905) (-453.433) [-453.507] * (-453.714) [-452.934] (-455.020) (-464.501) -- 0:00:33
444500 -- (-453.090) (-459.378) [-453.341] (-452.816) * (-456.335) (-454.188) (-453.217) [-457.103] -- 0:00:33
445000 -- (-453.963) (-454.864) (-456.091) [-456.405] * (-457.320) (-455.462) [-454.004] (-455.346) -- 0:00:33
Average standard deviation of split frequencies: 0.009761
445500 -- [-456.084] (-453.703) (-456.804) (-454.448) * (-455.547) (-460.410) [-452.884] (-458.071) -- 0:00:33
446000 -- [-455.711] (-457.717) (-453.780) (-456.453) * (-458.269) (-455.883) (-454.039) [-457.509] -- 0:00:33
446500 -- (-453.713) (-454.764) [-454.304] (-458.695) * (-455.976) (-462.412) [-455.283] (-456.294) -- 0:00:33
447000 -- [-452.904] (-453.177) (-452.790) (-452.704) * (-456.844) (-456.410) (-454.611) [-455.225] -- 0:00:33
447500 -- (-452.959) [-460.909] (-456.792) (-453.216) * (-454.132) [-455.651] (-454.035) (-455.685) -- 0:00:33
448000 -- (-456.321) [-457.800] (-453.216) (-459.980) * (-454.334) (-454.991) [-453.799] (-454.128) -- 0:00:33
448500 -- [-455.505] (-457.984) (-455.114) (-455.177) * (-458.641) [-454.876] (-454.391) (-454.728) -- 0:00:33
449000 -- (-458.239) [-453.513] (-454.969) (-457.331) * (-454.110) (-456.827) [-453.258] (-454.183) -- 0:00:33
449500 -- [-454.403] (-459.076) (-455.910) (-453.657) * (-455.755) [-453.111] (-454.571) (-453.493) -- 0:00:33
450000 -- (-454.366) (-453.029) [-453.027] (-454.169) * (-453.062) (-453.174) (-453.153) [-455.428] -- 0:00:33
Average standard deviation of split frequencies: 0.009476
450500 -- [-454.313] (-456.558) (-453.913) (-456.052) * (-455.773) (-453.601) [-454.023] (-454.943) -- 0:00:32
451000 -- (-457.011) [-454.211] (-458.637) (-458.055) * (-454.629) (-455.830) [-453.063] (-455.327) -- 0:00:32
451500 -- (-457.051) (-460.848) [-456.786] (-456.842) * (-456.392) [-457.855] (-454.771) (-452.617) -- 0:00:32
452000 -- (-454.237) (-453.122) (-454.156) [-453.503] * (-455.712) (-455.993) (-455.550) [-455.323] -- 0:00:32
452500 -- (-455.617) [-458.455] (-457.146) (-454.086) * (-456.224) (-455.608) [-454.148] (-454.937) -- 0:00:32
453000 -- [-455.369] (-460.120) (-453.721) (-455.017) * [-455.006] (-456.383) (-456.858) (-456.965) -- 0:00:32
453500 -- (-458.003) (-454.098) (-454.440) [-456.562] * [-453.635] (-456.651) (-454.944) (-455.665) -- 0:00:32
454000 -- (-454.868) (-455.599) [-455.283] (-453.885) * (-453.393) [-455.215] (-456.530) (-455.187) -- 0:00:32
454500 -- (-453.478) [-457.353] (-453.245) (-457.844) * (-453.336) (-454.828) [-455.081] (-454.255) -- 0:00:32
455000 -- (-453.883) (-454.610) [-453.808] (-456.729) * [-453.548] (-460.061) (-454.895) (-455.823) -- 0:00:32
Average standard deviation of split frequencies: 0.008723
455500 -- [-455.018] (-463.185) (-455.351) (-455.720) * [-453.707] (-454.221) (-454.376) (-456.107) -- 0:00:32
456000 -- [-453.466] (-454.925) (-453.903) (-455.049) * (-455.604) (-458.744) [-455.619] (-458.302) -- 0:00:32
456500 -- (-454.940) (-453.736) (-455.168) [-454.787] * (-455.125) [-454.254] (-455.512) (-459.600) -- 0:00:33
457000 -- [-456.874] (-454.022) (-453.279) (-456.191) * (-456.818) (-454.706) [-454.301] (-455.980) -- 0:00:33
457500 -- (-455.009) (-453.619) [-454.234] (-454.086) * (-452.980) [-456.441] (-456.930) (-453.800) -- 0:00:33
458000 -- (-455.584) (-454.921) (-454.969) [-453.301] * (-453.150) (-454.558) (-455.737) [-454.052] -- 0:00:33
458500 -- (-452.764) (-455.344) (-454.057) [-453.781] * (-459.472) [-454.377] (-457.061) (-455.741) -- 0:00:33
459000 -- [-453.410] (-454.855) (-453.107) (-455.681) * (-458.378) [-454.218] (-455.756) (-453.852) -- 0:00:33
459500 -- [-453.447] (-457.930) (-454.741) (-454.748) * (-456.647) [-454.907] (-456.860) (-454.144) -- 0:00:32
460000 -- [-454.733] (-455.445) (-455.110) (-454.910) * (-453.953) [-453.685] (-455.192) (-455.036) -- 0:00:32
Average standard deviation of split frequencies: 0.008890
460500 -- (-454.490) [-455.482] (-454.186) (-459.334) * (-457.386) (-459.719) (-457.627) [-453.705] -- 0:00:32
461000 -- (-454.950) [-455.192] (-456.037) (-454.901) * (-456.358) [-458.424] (-458.462) (-453.058) -- 0:00:32
461500 -- (-456.105) (-457.090) (-455.180) [-456.152] * (-457.120) (-454.880) (-461.295) [-455.257] -- 0:00:32
462000 -- (-456.106) [-455.453] (-457.892) (-454.206) * (-453.710) (-456.894) (-456.364) [-455.161] -- 0:00:32
462500 -- (-457.291) (-455.188) (-454.966) [-453.261] * (-453.001) [-458.371] (-455.437) (-453.955) -- 0:00:32
463000 -- [-457.614] (-461.417) (-458.061) (-454.671) * (-457.571) [-453.884] (-453.552) (-454.661) -- 0:00:32
463500 -- [-452.980] (-458.640) (-456.798) (-453.589) * (-456.171) (-453.226) (-453.463) [-454.234] -- 0:00:32
464000 -- [-453.407] (-453.239) (-460.793) (-455.616) * (-456.086) (-454.269) (-452.799) [-453.587] -- 0:00:32
464500 -- [-453.353] (-452.600) (-454.380) (-453.644) * (-454.856) (-455.565) (-456.368) [-453.811] -- 0:00:32
465000 -- (-453.837) [-454.479] (-453.198) (-453.637) * (-454.953) (-454.881) (-455.087) [-454.506] -- 0:00:32
Average standard deviation of split frequencies: 0.008788
465500 -- (-455.803) (-454.227) [-454.028] (-453.385) * (-455.200) (-454.302) (-456.374) [-454.451] -- 0:00:32
466000 -- (-456.825) (-454.175) (-453.074) [-455.558] * (-454.631) (-455.267) [-453.842] (-454.924) -- 0:00:32
466500 -- [-453.974] (-457.365) (-454.074) (-458.785) * (-453.917) (-453.923) [-454.365] (-456.931) -- 0:00:32
467000 -- (-453.993) (-456.217) (-454.869) [-455.274] * (-456.867) [-455.642] (-454.581) (-454.657) -- 0:00:31
467500 -- (-455.129) (-454.564) (-453.230) [-456.150] * (-455.299) (-456.102) (-454.828) [-454.938] -- 0:00:31
468000 -- (-453.938) (-453.615) [-452.824] (-456.205) * (-456.028) (-459.882) [-453.133] (-457.879) -- 0:00:31
468500 -- (-456.613) (-454.349) (-452.516) [-455.803] * (-455.110) (-456.945) [-452.707] (-454.973) -- 0:00:31
469000 -- [-455.908] (-454.401) (-457.811) (-457.352) * [-454.955] (-454.473) (-452.707) (-453.634) -- 0:00:31
469500 -- (-455.748) (-453.919) (-456.251) [-456.113] * (-454.723) (-454.790) (-456.069) [-454.084] -- 0:00:31
470000 -- (-456.300) (-455.241) (-455.704) [-456.505] * (-454.847) [-454.601] (-459.980) (-458.267) -- 0:00:31
Average standard deviation of split frequencies: 0.008388
470500 -- (-454.591) [-457.126] (-453.692) (-453.358) * (-455.941) [-453.871] (-456.038) (-457.262) -- 0:00:31
471000 -- (-456.240) [-456.059] (-455.720) (-456.159) * (-455.051) [-453.998] (-453.470) (-462.547) -- 0:00:31
471500 -- [-453.897] (-456.285) (-455.693) (-453.277) * (-456.255) [-456.970] (-455.046) (-454.406) -- 0:00:31
472000 -- (-454.158) (-454.319) [-454.729] (-453.908) * (-454.072) [-453.892] (-455.357) (-454.630) -- 0:00:31
472500 -- [-454.978] (-455.378) (-453.477) (-453.418) * (-454.106) (-454.421) [-454.553] (-454.488) -- 0:00:31
473000 -- (-454.509) (-454.727) [-452.586] (-453.269) * [-453.656] (-456.309) (-457.348) (-457.140) -- 0:00:31
473500 -- (-455.761) [-452.791] (-454.055) (-454.960) * (-456.157) (-453.990) [-456.039] (-456.922) -- 0:00:31
474000 -- [-457.213] (-453.786) (-453.644) (-454.136) * [-456.406] (-455.239) (-455.895) (-460.355) -- 0:00:32
474500 -- (-454.590) (-454.087) [-453.772] (-455.584) * (-456.837) (-455.779) [-456.530] (-454.172) -- 0:00:32
475000 -- [-454.658] (-455.642) (-453.360) (-454.339) * [-453.802] (-453.502) (-454.893) (-455.256) -- 0:00:32
Average standard deviation of split frequencies: 0.007428
475500 -- (-455.886) [-455.931] (-457.535) (-457.138) * [-455.649] (-455.865) (-459.953) (-456.801) -- 0:00:31
476000 -- [-453.159] (-454.313) (-458.215) (-454.054) * [-453.867] (-453.529) (-454.088) (-455.276) -- 0:00:31
476500 -- (-457.743) [-453.844] (-454.691) (-455.662) * [-453.681] (-453.407) (-456.087) (-456.086) -- 0:00:31
477000 -- (-458.303) (-454.362) (-456.707) [-454.227] * (-453.447) [-455.984] (-459.305) (-455.303) -- 0:00:31
477500 -- (-455.024) (-457.719) [-453.634] (-453.627) * (-455.596) (-457.006) [-455.123] (-456.961) -- 0:00:31
478000 -- (-454.474) (-453.188) (-453.981) [-453.506] * (-452.755) [-455.679] (-454.890) (-453.335) -- 0:00:31
478500 -- (-454.179) (-453.225) [-456.695] (-458.668) * (-454.062) (-455.732) [-454.113] (-453.506) -- 0:00:31
479000 -- [-454.712] (-453.497) (-455.875) (-454.414) * (-456.272) [-453.448] (-453.259) (-455.117) -- 0:00:31
479500 -- [-455.021] (-453.348) (-454.226) (-454.552) * (-453.233) (-453.807) (-456.290) [-453.678] -- 0:00:31
480000 -- (-456.163) (-453.981) [-453.342] (-454.325) * (-453.540) [-453.828] (-453.831) (-454.097) -- 0:00:31
Average standard deviation of split frequencies: 0.009346
480500 -- (-457.122) [-454.936] (-454.843) (-454.679) * (-455.420) (-453.927) [-454.146] (-457.691) -- 0:00:31
481000 -- (-456.700) (-454.965) [-456.827] (-457.128) * (-459.522) (-452.707) [-453.927] (-456.651) -- 0:00:31
481500 -- [-455.285] (-455.098) (-455.335) (-457.473) * (-453.153) (-453.665) [-453.846] (-457.607) -- 0:00:31
482000 -- (-456.698) [-454.729] (-454.292) (-454.491) * (-455.817) (-456.882) [-453.611] (-454.140) -- 0:00:31
482500 -- (-453.390) (-454.195) (-457.246) [-454.606] * [-453.516] (-458.157) (-458.370) (-455.188) -- 0:00:31
483000 -- (-453.648) [-453.671] (-455.026) (-453.972) * (-454.735) (-452.864) (-455.971) [-453.042] -- 0:00:31
483500 -- (-454.187) (-456.935) (-456.492) [-455.287] * [-455.378] (-456.723) (-454.930) (-453.774) -- 0:00:30
484000 -- (-458.279) (-454.488) (-454.061) [-455.176] * [-456.619] (-455.234) (-458.470) (-455.113) -- 0:00:30
484500 -- [-454.404] (-454.559) (-454.565) (-457.096) * (-453.652) (-454.690) [-455.143] (-454.392) -- 0:00:30
485000 -- (-452.579) [-453.990] (-456.957) (-454.592) * (-462.396) [-458.077] (-457.473) (-453.495) -- 0:00:30
Average standard deviation of split frequencies: 0.009243
485500 -- (-453.178) (-454.086) (-456.152) [-453.381] * (-455.209) (-454.702) [-456.737] (-456.496) -- 0:00:30
486000 -- (-453.764) (-453.193) [-453.016] (-455.596) * [-456.276] (-453.501) (-454.941) (-453.697) -- 0:00:30
486500 -- (-452.752) [-454.594] (-452.918) (-456.115) * (-455.636) (-454.418) (-454.827) [-454.248] -- 0:00:30
487000 -- (-452.811) (-453.938) (-457.931) [-458.105] * (-453.526) (-455.734) [-454.508] (-453.998) -- 0:00:30
487500 -- (-454.289) [-454.125] (-454.122) (-456.803) * (-456.410) [-453.648] (-457.004) (-466.960) -- 0:00:30
488000 -- (-456.312) (-453.870) (-455.054) [-454.135] * (-455.581) [-454.495] (-454.437) (-456.064) -- 0:00:30
488500 -- (-460.275) (-458.269) [-453.674] (-458.428) * [-454.551] (-453.556) (-454.622) (-454.633) -- 0:00:30
489000 -- (-456.487) (-454.865) [-453.971] (-453.200) * (-453.347) [-454.540] (-453.005) (-453.262) -- 0:00:30
489500 -- (-454.186) (-458.085) (-453.733) [-455.248] * (-453.515) (-456.869) (-454.935) [-454.766] -- 0:00:30
490000 -- (-456.227) [-457.828] (-454.665) (-452.910) * (-456.851) (-454.045) (-458.287) [-453.344] -- 0:00:30
Average standard deviation of split frequencies: 0.009833
490500 -- (-456.268) [-455.913] (-456.841) (-454.683) * (-454.430) (-454.533) (-456.923) [-456.020] -- 0:00:30
491000 -- (-456.325) (-458.777) [-453.810] (-453.451) * (-458.840) (-455.682) [-457.444] (-456.776) -- 0:00:31
491500 -- (-457.779) [-457.767] (-454.138) (-453.267) * [-454.632] (-454.661) (-454.672) (-457.023) -- 0:00:31
492000 -- (-457.238) [-455.272] (-454.304) (-452.837) * [-453.416] (-455.773) (-455.017) (-459.840) -- 0:00:30
492500 -- (-454.491) (-457.520) [-454.977] (-454.176) * (-454.947) (-454.676) (-455.802) [-453.082] -- 0:00:30
493000 -- (-457.859) (-455.509) (-453.312) [-455.451] * (-455.143) [-455.200] (-455.266) (-452.803) -- 0:00:30
493500 -- (-461.190) (-455.235) [-452.985] (-454.442) * [-452.984] (-457.543) (-452.922) (-453.897) -- 0:00:30
494000 -- (-453.323) (-453.521) (-460.727) [-454.954] * [-452.964] (-454.180) (-453.542) (-455.071) -- 0:00:30
494500 -- [-453.369] (-458.586) (-455.070) (-454.704) * [-454.890] (-454.512) (-459.644) (-455.169) -- 0:00:30
495000 -- (-454.569) (-458.250) [-454.048] (-455.616) * (-455.716) (-461.871) (-456.509) [-454.332] -- 0:00:30
Average standard deviation of split frequencies: 0.009326
495500 -- [-454.764] (-456.000) (-453.570) (-454.246) * (-457.869) (-459.121) (-456.518) [-454.628] -- 0:00:30
496000 -- (-456.516) (-456.069) (-455.324) [-454.998] * (-460.065) [-454.111] (-454.052) (-453.964) -- 0:00:30
496500 -- (-455.114) [-454.608] (-459.262) (-455.939) * (-455.062) (-453.225) (-455.888) [-453.454] -- 0:00:30
497000 -- (-455.355) (-453.243) (-453.060) [-455.610] * (-454.646) (-454.797) (-458.265) [-456.371] -- 0:00:30
497500 -- (-454.764) (-454.892) (-455.357) [-453.745] * [-453.928] (-458.032) (-458.152) (-456.563) -- 0:00:30
498000 -- (-453.780) (-455.103) [-453.385] (-454.730) * (-456.038) [-454.680] (-455.842) (-453.338) -- 0:00:30
498500 -- (-455.949) [-456.124] (-454.619) (-455.341) * (-457.132) (-453.464) [-454.068] (-453.989) -- 0:00:30
499000 -- (-454.744) (-453.587) [-453.270] (-454.017) * (-456.691) (-453.986) [-453.314] (-453.878) -- 0:00:30
499500 -- [-455.104] (-454.121) (-454.412) (-457.386) * (-456.480) (-455.472) (-453.725) [-455.119] -- 0:00:30
500000 -- (-453.888) (-455.350) [-454.719] (-457.116) * (-459.458) [-455.090] (-454.610) (-454.197) -- 0:00:30
Average standard deviation of split frequencies: 0.010136
500500 -- [-453.524] (-453.945) (-455.748) (-455.466) * [-461.354] (-455.797) (-452.788) (-454.314) -- 0:00:29
501000 -- (-454.143) [-454.151] (-455.011) (-453.751) * (-454.435) (-455.856) [-453.409] (-453.503) -- 0:00:29
501500 -- (-454.649) [-454.352] (-455.821) (-452.927) * (-453.508) (-455.839) (-453.716) [-457.036] -- 0:00:29
502000 -- (-453.475) (-454.034) (-456.594) [-453.445] * (-454.222) (-454.615) [-453.768] (-461.136) -- 0:00:29
502500 -- [-456.091] (-461.099) (-455.720) (-458.445) * [-453.464] (-458.025) (-458.112) (-457.135) -- 0:00:29
503000 -- [-455.331] (-458.467) (-454.298) (-455.020) * (-452.848) (-453.338) (-455.092) [-454.479] -- 0:00:29
503500 -- (-455.408) [-455.688] (-456.945) (-455.358) * (-455.110) [-452.749] (-458.585) (-456.646) -- 0:00:29
504000 -- [-454.309] (-452.721) (-456.864) (-455.503) * [-456.496] (-453.625) (-453.788) (-456.268) -- 0:00:29
504500 -- (-454.526) (-455.791) [-453.504] (-455.459) * (-456.634) [-453.451] (-452.749) (-455.529) -- 0:00:29
505000 -- [-454.436] (-453.373) (-454.951) (-455.967) * (-454.860) (-452.888) [-453.390] (-456.051) -- 0:00:29
Average standard deviation of split frequencies: 0.009371
505500 -- (-455.147) (-454.915) (-455.464) [-456.818] * (-456.455) [-452.919] (-453.523) (-454.456) -- 0:00:29
506000 -- [-455.498] (-455.015) (-458.112) (-455.973) * (-456.498) (-454.744) (-455.848) [-454.514] -- 0:00:29
506500 -- [-453.370] (-455.618) (-456.029) (-454.717) * (-454.106) [-454.623] (-453.214) (-456.156) -- 0:00:29
507000 -- (-456.271) [-455.134] (-455.281) (-455.237) * (-456.606) (-456.164) (-453.932) [-453.756] -- 0:00:29
507500 -- (-457.994) (-454.811) [-455.965] (-457.612) * (-456.544) (-455.350) [-453.623] (-455.519) -- 0:00:29
508000 -- (-456.225) (-453.176) [-455.106] (-454.863) * [-454.571] (-456.333) (-453.611) (-452.996) -- 0:00:30
508500 -- (-454.108) [-454.288] (-457.714) (-456.242) * [-452.608] (-458.886) (-453.604) (-453.130) -- 0:00:29
509000 -- (-453.850) (-454.358) (-454.425) [-456.751] * [-456.349] (-457.348) (-453.932) (-454.369) -- 0:00:29
509500 -- [-459.971] (-452.913) (-459.338) (-454.679) * (-454.374) [-455.332] (-452.772) (-458.074) -- 0:00:29
510000 -- (-454.555) (-458.672) (-455.114) [-454.422] * (-455.048) [-453.533] (-455.140) (-456.367) -- 0:00:29
Average standard deviation of split frequencies: 0.009340
510500 -- (-454.816) (-456.111) [-453.905] (-454.423) * (-461.131) (-453.645) [-453.113] (-455.037) -- 0:00:29
511000 -- (-454.196) (-458.114) [-455.128] (-456.489) * [-453.928] (-454.833) (-456.591) (-454.844) -- 0:00:29
511500 -- (-457.169) [-457.398] (-453.957) (-456.157) * [-454.749] (-453.156) (-454.423) (-453.844) -- 0:00:29
512000 -- (-455.715) (-459.433) [-456.578] (-460.396) * [-454.396] (-455.622) (-455.231) (-456.780) -- 0:00:29
512500 -- (-456.522) (-454.142) (-458.844) [-453.712] * (-456.143) [-455.613] (-458.172) (-455.086) -- 0:00:29
513000 -- (-453.104) (-462.241) (-454.467) [-453.694] * (-454.329) (-454.421) [-456.821] (-454.957) -- 0:00:29
513500 -- (-453.607) [-453.416] (-455.852) (-454.237) * (-453.365) (-454.119) (-459.187) [-453.166] -- 0:00:29
514000 -- (-453.954) [-453.423] (-456.545) (-454.397) * (-455.151) (-458.911) [-455.918] (-454.140) -- 0:00:29
514500 -- [-454.412] (-454.590) (-453.695) (-459.508) * (-455.769) (-454.542) (-459.980) [-455.422] -- 0:00:29
515000 -- [-455.885] (-455.750) (-455.938) (-455.920) * [-453.875] (-454.126) (-454.943) (-459.055) -- 0:00:29
Average standard deviation of split frequencies: 0.008565
515500 -- (-455.959) [-454.260] (-454.115) (-455.334) * (-453.388) (-454.502) (-454.662) [-456.965] -- 0:00:29
516000 -- (-455.461) [-453.220] (-454.451) (-454.157) * (-456.638) [-452.538] (-455.574) (-454.382) -- 0:00:29
516500 -- (-454.460) (-454.631) (-459.160) [-455.030] * (-454.066) (-454.845) [-454.810] (-455.321) -- 0:00:29
517000 -- (-455.005) (-458.501) (-455.501) [-455.579] * (-456.388) (-454.951) (-455.330) [-452.533] -- 0:00:28
517500 -- (-456.171) (-452.834) (-459.443) [-456.332] * (-454.721) (-458.171) [-453.927] (-452.714) -- 0:00:28
518000 -- [-454.668] (-452.878) (-455.902) (-455.501) * (-455.929) (-461.247) (-453.479) [-456.841] -- 0:00:28
518500 -- (-456.274) (-454.486) (-457.322) [-455.490] * (-456.174) (-462.154) (-455.565) [-454.354] -- 0:00:28
519000 -- [-455.117] (-455.845) (-453.696) (-455.989) * (-459.394) (-455.151) (-452.959) [-456.570] -- 0:00:28
519500 -- (-455.244) (-455.775) [-454.184] (-456.283) * (-455.051) (-454.636) (-454.115) [-460.382] -- 0:00:28
520000 -- (-456.748) (-453.183) (-455.854) [-454.183] * (-455.625) (-454.039) (-456.119) [-456.939] -- 0:00:28
Average standard deviation of split frequencies: 0.009167
520500 -- (-454.435) (-455.347) [-455.002] (-454.251) * [-454.389] (-455.203) (-455.081) (-460.090) -- 0:00:28
521000 -- (-453.770) (-453.726) (-454.936) [-453.233] * (-454.068) (-455.993) [-454.637] (-454.728) -- 0:00:28
521500 -- (-455.808) (-455.287) [-456.893] (-453.088) * (-454.010) (-453.113) (-459.606) [-454.007] -- 0:00:28
522000 -- (-456.454) (-453.203) [-455.702] (-453.034) * (-459.478) (-454.368) (-454.294) [-453.911] -- 0:00:28
522500 -- (-455.309) (-454.291) (-455.641) [-454.429] * (-456.275) [-456.089] (-458.854) (-456.202) -- 0:00:28
523000 -- [-454.336] (-456.184) (-454.229) (-453.857) * (-457.919) (-454.623) (-457.919) [-453.948] -- 0:00:28
523500 -- (-454.639) (-456.711) (-454.483) [-454.316] * (-461.891) (-454.599) [-453.792] (-453.867) -- 0:00:28
524000 -- [-455.328] (-455.917) (-456.014) (-455.906) * (-457.612) (-456.738) (-455.287) [-454.312] -- 0:00:28
524500 -- [-456.473] (-454.764) (-455.566) (-455.524) * (-455.422) (-453.680) (-457.628) [-454.556] -- 0:00:29
525000 -- (-454.970) [-453.831] (-453.226) (-454.897) * (-455.394) [-452.794] (-455.081) (-455.347) -- 0:00:28
Average standard deviation of split frequencies: 0.009437
525500 -- (-454.658) (-455.255) [-454.495] (-454.176) * (-453.918) (-454.263) [-455.668] (-453.501) -- 0:00:28
526000 -- [-453.951] (-454.711) (-456.714) (-454.144) * (-453.171) (-452.898) (-454.321) [-453.262] -- 0:00:28
526500 -- (-459.235) (-452.701) [-455.330] (-454.356) * (-454.424) [-454.377] (-452.844) (-459.846) -- 0:00:28
527000 -- (-453.526) (-453.091) (-456.249) [-453.432] * (-455.120) (-455.792) (-453.998) [-456.176] -- 0:00:28
527500 -- (-458.235) (-453.119) [-454.021] (-454.435) * (-454.166) (-457.455) (-456.905) [-454.416] -- 0:00:28
528000 -- (-453.584) [-454.068] (-454.443) (-454.626) * (-454.257) [-454.532] (-461.217) (-454.436) -- 0:00:28
528500 -- (-453.183) [-456.446] (-453.991) (-455.634) * (-457.357) (-465.543) [-454.170] (-457.014) -- 0:00:28
529000 -- (-453.005) (-456.456) (-455.939) [-453.644] * [-457.233] (-457.831) (-453.755) (-454.017) -- 0:00:28
529500 -- (-453.482) [-454.879] (-457.667) (-453.578) * [-455.427] (-454.798) (-456.669) (-454.516) -- 0:00:28
530000 -- (-454.161) [-454.679] (-456.867) (-454.479) * (-456.991) (-453.776) (-455.826) [-455.154] -- 0:00:28
Average standard deviation of split frequencies: 0.008106
530500 -- (-453.436) [-453.461] (-456.797) (-457.216) * (-458.913) (-454.065) [-456.437] (-455.595) -- 0:00:28
531000 -- (-456.247) [-459.766] (-454.111) (-453.954) * [-454.738] (-455.158) (-456.157) (-457.400) -- 0:00:28
531500 -- (-455.782) (-456.466) [-454.021] (-454.458) * [-455.129] (-454.726) (-457.536) (-454.131) -- 0:00:28
532000 -- (-458.186) (-454.740) [-453.387] (-457.832) * (-454.775) (-462.875) [-457.066] (-458.848) -- 0:00:28
532500 -- (-459.110) (-459.173) [-453.108] (-460.992) * (-453.842) (-458.115) [-456.035] (-454.750) -- 0:00:28
533000 -- [-454.166] (-453.578) (-454.861) (-455.329) * (-452.979) (-457.313) (-453.729) [-453.617] -- 0:00:28
533500 -- [-455.928] (-453.073) (-460.394) (-457.535) * (-453.039) (-454.636) (-453.414) [-453.719] -- 0:00:27
534000 -- (-458.254) (-453.376) [-454.309] (-455.186) * (-453.336) [-454.739] (-453.605) (-453.779) -- 0:00:27
534500 -- [-454.041] (-456.351) (-453.976) (-455.104) * (-453.564) [-454.043] (-454.110) (-453.711) -- 0:00:27
535000 -- (-454.756) [-457.715] (-454.477) (-455.987) * (-453.216) (-454.862) (-459.590) [-455.992] -- 0:00:27
Average standard deviation of split frequencies: 0.007696
535500 -- (-458.576) (-456.677) (-454.209) [-455.665] * (-453.380) [-454.414] (-453.976) (-454.497) -- 0:00:27
536000 -- (-454.454) [-453.164] (-455.343) (-454.845) * (-454.463) [-453.248] (-453.778) (-459.149) -- 0:00:27
536500 -- [-455.001] (-453.639) (-452.859) (-457.748) * (-456.266) (-453.702) [-453.784] (-455.412) -- 0:00:27
537000 -- [-454.758] (-453.901) (-456.292) (-459.756) * [-457.385] (-456.078) (-452.599) (-455.866) -- 0:00:27
537500 -- (-454.186) (-455.699) (-456.275) [-454.985] * (-455.785) [-455.812] (-454.900) (-455.934) -- 0:00:27
538000 -- (-454.023) [-453.092] (-459.058) (-453.770) * (-456.318) (-455.807) (-453.654) [-454.349] -- 0:00:27
538500 -- (-454.225) (-455.750) [-454.196] (-454.040) * (-456.458) [-456.619] (-455.550) (-454.106) -- 0:00:27
539000 -- [-453.294] (-453.901) (-453.658) (-457.309) * (-457.575) (-461.202) [-455.481] (-453.891) -- 0:00:27
539500 -- (-453.676) (-454.344) (-454.260) [-456.369] * [-454.722] (-456.870) (-456.462) (-455.817) -- 0:00:27
540000 -- [-454.079] (-455.128) (-456.200) (-454.719) * (-454.538) (-458.974) [-460.891] (-454.860) -- 0:00:27
Average standard deviation of split frequencies: 0.007575
540500 -- (-453.581) (-454.864) (-457.792) [-456.307] * [-456.693] (-454.698) (-455.546) (-456.135) -- 0:00:27
541000 -- (-455.993) [-453.753] (-455.602) (-460.768) * (-454.777) (-454.225) [-456.881] (-454.288) -- 0:00:27
541500 -- (-457.587) [-455.838] (-459.287) (-460.956) * (-453.942) (-453.885) [-456.865] (-453.859) -- 0:00:27
542000 -- [-455.142] (-455.732) (-454.984) (-458.913) * (-453.759) (-455.197) (-454.039) [-452.680] -- 0:00:27
542500 -- (-455.339) (-455.472) (-454.971) [-453.758] * (-454.666) [-454.517] (-454.920) (-453.351) -- 0:00:27
543000 -- (-453.367) [-454.035] (-456.599) (-454.044) * (-455.415) (-454.237) (-453.878) [-455.893] -- 0:00:27
543500 -- (-460.758) (-453.970) (-454.186) [-454.273] * (-453.553) [-453.272] (-453.870) (-453.894) -- 0:00:27
544000 -- [-454.289] (-453.679) (-452.845) (-457.135) * [-453.886] (-457.164) (-455.971) (-456.458) -- 0:00:27
544500 -- [-455.330] (-453.410) (-454.857) (-454.742) * (-454.922) [-456.428] (-459.094) (-455.073) -- 0:00:27
545000 -- (-453.675) [-453.442] (-454.005) (-453.795) * (-453.788) [-453.709] (-455.241) (-454.319) -- 0:00:27
Average standard deviation of split frequencies: 0.007824
545500 -- [-454.374] (-453.526) (-452.663) (-454.433) * (-457.461) (-456.339) (-457.541) [-454.220] -- 0:00:27
546000 -- (-452.706) [-453.602] (-456.661) (-455.675) * [-457.384] (-461.705) (-455.697) (-457.284) -- 0:00:27
546500 -- (-457.163) (-453.687) [-454.602] (-456.083) * (-454.905) [-453.432] (-454.341) (-454.567) -- 0:00:27
547000 -- [-453.268] (-453.811) (-455.901) (-454.901) * (-453.660) (-454.410) [-457.753] (-454.494) -- 0:00:27
547500 -- (-454.496) (-454.692) (-456.129) [-454.909] * [-453.406] (-454.131) (-459.346) (-454.943) -- 0:00:27
548000 -- (-455.656) [-455.225] (-454.824) (-455.162) * (-455.427) (-454.521) [-454.788] (-455.529) -- 0:00:27
548500 -- [-453.527] (-455.097) (-454.355) (-456.896) * (-454.867) [-452.994] (-455.632) (-454.016) -- 0:00:27
549000 -- (-453.403) (-455.229) [-454.345] (-460.944) * (-458.185) (-453.856) [-454.679] (-454.232) -- 0:00:27
549500 -- [-452.998] (-455.947) (-453.093) (-453.664) * (-456.109) [-456.876] (-452.856) (-453.045) -- 0:00:27
550000 -- [-454.737] (-459.141) (-455.701) (-454.004) * [-457.048] (-456.391) (-452.816) (-453.066) -- 0:00:27
Average standard deviation of split frequencies: 0.007437
550500 -- [-453.913] (-459.623) (-453.709) (-455.076) * (-454.835) (-457.692) [-454.954] (-456.416) -- 0:00:26
551000 -- [-454.836] (-455.461) (-453.030) (-456.372) * (-454.383) (-458.129) (-453.878) [-454.513] -- 0:00:26
551500 -- (-453.583) (-454.847) (-454.474) [-454.156] * (-459.204) (-454.456) (-455.256) [-454.143] -- 0:00:26
552000 -- (-455.802) (-455.886) (-454.183) [-453.159] * (-457.719) (-454.086) [-454.163] (-454.937) -- 0:00:26
552500 -- (-457.771) (-454.128) (-455.436) [-454.490] * (-463.229) (-453.552) (-456.285) [-454.584] -- 0:00:26
553000 -- (-455.089) [-455.873] (-455.776) (-452.750) * (-454.183) (-453.612) (-458.001) [-453.107] -- 0:00:26
553500 -- (-458.593) [-454.760] (-457.130) (-457.168) * (-453.897) (-454.138) [-456.426] (-454.344) -- 0:00:26
554000 -- [-457.547] (-457.828) (-454.709) (-452.652) * (-455.861) (-453.291) (-458.371) [-454.274] -- 0:00:26
554500 -- (-456.811) (-456.185) (-459.576) [-457.986] * (-455.311) [-454.215] (-456.380) (-454.609) -- 0:00:26
555000 -- (-456.236) [-452.972] (-456.427) (-457.270) * (-455.855) (-453.803) (-454.504) [-456.556] -- 0:00:26
Average standard deviation of split frequencies: 0.006465
555500 -- (-459.510) [-453.696] (-452.462) (-455.755) * [-455.045] (-453.127) (-456.266) (-454.067) -- 0:00:26
556000 -- (-453.709) [-456.867] (-454.784) (-456.011) * (-455.709) (-455.982) [-453.395] (-453.296) -- 0:00:26
556500 -- (-453.951) [-457.531] (-454.602) (-454.297) * (-454.129) (-457.916) [-454.344] (-453.072) -- 0:00:26
557000 -- (-458.201) [-454.403] (-455.111) (-461.768) * (-453.722) (-457.880) [-454.827] (-457.815) -- 0:00:26
557500 -- (-455.565) (-454.528) [-453.828] (-454.734) * (-456.028) (-454.620) (-454.837) [-457.393] -- 0:00:26
558000 -- (-453.754) (-455.150) (-454.033) [-456.516] * [-454.158] (-454.779) (-454.195) (-455.921) -- 0:00:26
558500 -- (-455.018) [-455.786] (-455.620) (-455.686) * (-455.279) (-453.448) [-453.110] (-460.718) -- 0:00:26
559000 -- (-454.587) [-456.268] (-457.307) (-454.711) * [-456.253] (-460.304) (-453.574) (-456.772) -- 0:00:26
559500 -- (-456.298) [-454.213] (-456.751) (-457.502) * (-463.890) [-457.976] (-453.929) (-456.022) -- 0:00:26
560000 -- (-453.514) [-453.522] (-456.766) (-456.693) * (-460.919) [-458.745] (-454.551) (-454.437) -- 0:00:26
Average standard deviation of split frequencies: 0.006937
560500 -- (-453.019) [-453.861] (-453.650) (-455.708) * (-454.597) (-455.298) (-454.653) [-453.539] -- 0:00:26
561000 -- (-453.356) (-464.061) (-453.432) [-454.260] * (-455.601) (-455.261) (-454.933) [-458.733] -- 0:00:26
561500 -- (-454.183) (-455.195) [-454.312] (-459.828) * (-455.480) (-454.012) [-453.690] (-456.612) -- 0:00:26
562000 -- (-458.064) [-454.857] (-452.958) (-458.562) * (-453.745) (-453.312) (-455.205) [-456.165] -- 0:00:26
562500 -- (-457.093) (-456.520) [-454.021] (-454.826) * (-453.840) [-453.733] (-455.761) (-453.541) -- 0:00:26
563000 -- [-454.945] (-456.976) (-457.741) (-453.862) * (-453.958) (-455.273) (-454.786) [-453.200] -- 0:00:26
563500 -- (-454.982) (-462.320) [-454.544] (-452.991) * (-454.389) (-457.560) (-455.307) [-454.103] -- 0:00:26
564000 -- [-455.111] (-456.438) (-453.632) (-453.365) * (-456.712) [-456.274] (-453.708) (-453.950) -- 0:00:26
564500 -- (-457.019) (-453.854) (-456.966) [-455.019] * (-455.945) [-456.582] (-453.256) (-454.052) -- 0:00:26
565000 -- (-455.956) [-454.443] (-454.264) (-458.600) * (-457.504) (-454.829) (-459.912) [-453.218] -- 0:00:26
Average standard deviation of split frequencies: 0.007300
565500 -- (-455.663) (-455.488) [-455.599] (-456.416) * (-455.956) (-453.170) [-453.032] (-456.885) -- 0:00:26
566000 -- (-455.055) (-457.539) [-454.017] (-452.854) * (-453.532) (-457.772) (-452.642) [-455.810] -- 0:00:26
566500 -- [-454.437] (-455.195) (-454.899) (-452.915) * (-453.413) [-453.331] (-458.845) (-453.865) -- 0:00:26
567000 -- (-453.726) [-454.060] (-454.616) (-455.540) * (-455.943) (-453.409) [-453.696] (-455.544) -- 0:00:25
567500 -- (-454.869) [-452.849] (-457.175) (-458.410) * (-459.116) [-453.885] (-454.636) (-455.994) -- 0:00:25
568000 -- (-453.633) [-453.782] (-454.524) (-455.900) * (-453.277) (-457.442) (-455.668) [-457.483] -- 0:00:25
568500 -- (-454.290) (-453.754) (-456.988) [-454.972] * (-454.261) (-461.238) (-459.671) [-455.387] -- 0:00:25
569000 -- (-453.419) [-454.429] (-453.710) (-453.192) * (-452.884) (-456.038) [-455.718] (-453.073) -- 0:00:25
569500 -- (-455.166) [-455.838] (-457.906) (-453.543) * [-453.953] (-456.039) (-454.957) (-457.465) -- 0:00:25
570000 -- [-454.992] (-455.531) (-456.032) (-452.934) * [-459.602] (-454.190) (-456.506) (-457.084) -- 0:00:25
Average standard deviation of split frequencies: 0.006350
570500 -- (-456.213) [-454.269] (-453.440) (-453.812) * (-460.314) [-455.060] (-453.460) (-454.362) -- 0:00:25
571000 -- (-453.486) (-456.896) (-454.613) [-453.728] * (-454.711) [-457.895] (-454.767) (-457.948) -- 0:00:25
571500 -- [-455.876] (-455.683) (-460.026) (-457.176) * (-455.009) [-458.944] (-453.172) (-454.448) -- 0:00:25
572000 -- [-455.933] (-456.793) (-454.584) (-454.981) * (-455.836) (-457.039) [-452.738] (-455.087) -- 0:00:25
572500 -- (-454.636) (-457.687) [-454.702] (-455.516) * (-457.105) (-456.099) [-455.243] (-453.578) -- 0:00:25
573000 -- (-453.885) (-456.800) [-456.084] (-456.212) * (-454.927) (-454.996) [-455.168] (-453.001) -- 0:00:25
573500 -- (-453.442) [-455.141] (-458.396) (-457.791) * (-456.779) (-454.257) [-453.848] (-457.649) -- 0:00:25
574000 -- (-454.860) [-456.061] (-459.527) (-459.738) * (-453.299) [-453.365] (-455.734) (-458.851) -- 0:00:25
574500 -- [-457.511] (-455.735) (-457.362) (-453.868) * (-454.502) (-453.328) [-454.108] (-458.591) -- 0:00:25
575000 -- [-454.558] (-457.623) (-453.508) (-456.993) * (-455.498) (-453.214) (-455.025) [-457.820] -- 0:00:25
Average standard deviation of split frequencies: 0.006240
575500 -- (-455.418) [-454.439] (-454.617) (-455.715) * (-453.776) [-453.135] (-455.134) (-459.429) -- 0:00:25
576000 -- (-454.584) [-454.148] (-454.455) (-454.938) * (-453.578) (-453.042) [-453.789] (-453.752) -- 0:00:25
576500 -- (-459.099) [-456.337] (-455.011) (-456.522) * (-453.917) (-453.911) [-454.285] (-452.883) -- 0:00:25
577000 -- (-453.935) [-457.027] (-456.817) (-456.629) * (-453.337) (-455.963) [-454.777] (-453.817) -- 0:00:25
577500 -- [-456.281] (-455.330) (-454.595) (-455.542) * [-453.387] (-456.499) (-453.429) (-457.224) -- 0:00:25
578000 -- (-456.639) [-456.202] (-454.146) (-453.014) * (-454.961) (-462.569) [-454.003] (-457.123) -- 0:00:25
578500 -- (-457.849) (-454.668) (-454.969) [-454.281] * (-456.620) [-455.332] (-457.000) (-454.078) -- 0:00:25
579000 -- (-454.933) (-454.947) (-454.825) [-457.807] * [-452.701] (-456.118) (-453.223) (-453.227) -- 0:00:25
579500 -- (-456.056) (-456.738) [-452.866] (-453.268) * (-453.129) [-454.006] (-458.792) (-453.766) -- 0:00:25
580000 -- (-457.179) (-453.675) (-455.885) [-454.404] * (-455.187) (-458.766) [-453.222] (-455.861) -- 0:00:25
Average standard deviation of split frequencies: 0.006089
580500 -- (-456.744) (-453.009) [-457.133] (-454.624) * (-455.750) (-455.971) (-455.204) [-454.931] -- 0:00:25
581000 -- [-455.149] (-453.416) (-454.064) (-453.301) * [-456.498] (-457.208) (-456.625) (-454.305) -- 0:00:25
581500 -- (-457.309) (-453.916) (-453.420) [-453.644] * (-455.424) (-459.721) [-454.034] (-454.585) -- 0:00:25
582000 -- (-456.472) (-455.182) (-456.409) [-456.308] * (-453.856) (-454.879) [-453.680] (-453.550) -- 0:00:25
582500 -- (-454.097) [-453.627] (-457.644) (-455.527) * (-453.774) [-456.878] (-453.128) (-452.941) -- 0:00:25
583000 -- (-453.555) [-456.253] (-459.693) (-454.201) * (-453.456) [-454.326] (-456.202) (-454.545) -- 0:00:25
583500 -- (-456.604) (-453.709) [-453.404] (-453.706) * [-454.538] (-456.258) (-457.705) (-455.589) -- 0:00:24
584000 -- (-456.106) (-456.108) (-453.833) [-457.780] * (-453.882) [-454.398] (-461.435) (-453.810) -- 0:00:24
584500 -- (-454.430) (-456.108) [-452.686] (-454.477) * (-454.430) (-453.008) [-453.618] (-455.400) -- 0:00:24
585000 -- [-454.213] (-455.769) (-457.934) (-453.255) * (-454.953) [-455.362] (-457.311) (-456.511) -- 0:00:24
Average standard deviation of split frequencies: 0.005732
585500 -- (-452.909) (-453.535) [-456.237] (-458.939) * [-454.138] (-453.092) (-453.352) (-453.273) -- 0:00:24
586000 -- (-454.584) [-454.035] (-455.830) (-455.159) * (-455.027) (-452.884) (-453.916) [-453.609] -- 0:00:24
586500 -- [-453.524] (-454.384) (-456.437) (-455.681) * (-457.806) [-454.479] (-455.980) (-452.831) -- 0:00:24
587000 -- (-454.989) [-457.409] (-456.334) (-454.143) * [-454.776] (-454.198) (-457.266) (-456.079) -- 0:00:24
587500 -- [-455.986] (-454.267) (-455.824) (-453.694) * (-455.115) [-454.574] (-455.244) (-454.747) -- 0:00:24
588000 -- (-458.640) [-453.707] (-453.922) (-453.348) * (-455.046) (-453.484) (-453.914) [-457.790] -- 0:00:24
588500 -- [-453.445] (-454.919) (-454.663) (-454.268) * (-455.477) (-458.604) [-454.452] (-456.382) -- 0:00:24
589000 -- [-455.442] (-457.886) (-456.052) (-453.816) * (-454.744) [-453.742] (-456.403) (-457.606) -- 0:00:24
589500 -- (-455.137) (-453.744) (-454.668) [-457.846] * (-453.298) [-454.484] (-452.782) (-458.314) -- 0:00:24
590000 -- (-454.356) [-454.515] (-452.795) (-455.214) * (-454.044) (-457.887) (-455.223) [-454.286] -- 0:00:24
Average standard deviation of split frequencies: 0.005936
590500 -- [-454.551] (-453.840) (-455.348) (-455.211) * (-456.883) (-455.135) [-455.286] (-455.332) -- 0:00:24
591000 -- [-454.118] (-455.961) (-459.961) (-456.883) * (-456.486) (-455.210) (-458.375) [-457.659] -- 0:00:24
591500 -- (-454.533) [-454.487] (-461.094) (-454.088) * [-453.355] (-455.474) (-460.340) (-454.421) -- 0:00:24
592000 -- (-453.849) (-455.124) (-461.079) [-455.606] * (-456.736) (-455.953) (-454.805) [-456.083] -- 0:00:24
592500 -- (-457.611) [-459.843] (-453.779) (-456.694) * (-454.726) [-453.503] (-454.596) (-453.768) -- 0:00:24
593000 -- [-453.638] (-454.846) (-453.949) (-454.125) * [-456.064] (-456.291) (-457.063) (-452.699) -- 0:00:24
593500 -- (-453.625) (-454.878) (-455.589) [-453.097] * (-453.722) (-461.757) [-453.986] (-456.394) -- 0:00:24
594000 -- (-454.601) (-453.196) (-460.425) [-453.909] * (-453.696) (-462.474) (-454.756) [-457.590] -- 0:00:24
594500 -- (-465.493) (-456.965) [-453.621] (-454.076) * (-456.346) (-456.895) (-455.076) [-456.574] -- 0:00:24
595000 -- (-453.550) (-457.440) [-454.965] (-453.240) * (-455.189) (-455.119) (-453.380) [-457.383] -- 0:00:24
Average standard deviation of split frequencies: 0.006700
595500 -- [-454.995] (-453.890) (-456.048) (-453.132) * [-452.748] (-453.563) (-455.678) (-453.271) -- 0:00:24
596000 -- (-456.550) (-454.186) (-454.244) [-452.970] * (-457.549) [-457.332] (-453.605) (-454.105) -- 0:00:24
596500 -- (-454.295) [-457.807] (-454.920) (-453.236) * (-455.859) (-454.560) [-457.234] (-454.610) -- 0:00:24
597000 -- (-455.208) (-455.329) (-455.596) [-455.249] * (-455.882) (-454.901) (-455.654) [-458.773] -- 0:00:24
597500 -- [-453.384] (-453.604) (-454.786) (-454.128) * (-454.005) (-452.978) [-455.112] (-453.718) -- 0:00:24
598000 -- (-455.980) [-453.337] (-455.854) (-457.185) * [-454.145] (-457.327) (-455.480) (-455.512) -- 0:00:24
598500 -- (-458.268) [-456.314] (-460.723) (-452.984) * (-458.254) (-455.547) [-454.324] (-453.366) -- 0:00:24
599000 -- [-453.635] (-456.183) (-459.970) (-459.560) * (-456.742) (-455.079) [-454.601] (-454.477) -- 0:00:24
599500 -- [-455.928] (-455.961) (-454.614) (-460.323) * (-454.489) (-457.055) (-457.345) [-454.457] -- 0:00:24
600000 -- (-456.712) (-456.130) (-461.017) [-456.883] * (-454.896) [-454.791] (-454.376) (-457.144) -- 0:00:24
Average standard deviation of split frequencies: 0.006327
600500 -- [-455.520] (-459.857) (-454.525) (-454.051) * [-453.849] (-455.558) (-455.080) (-454.636) -- 0:00:23
601000 -- (-455.226) (-455.379) (-454.386) [-453.341] * (-454.064) (-453.692) [-454.996] (-455.240) -- 0:00:23
601500 -- (-456.062) (-456.735) (-453.653) [-453.968] * (-459.696) (-453.793) [-455.833] (-456.544) -- 0:00:23
602000 -- (-453.582) [-457.319] (-455.040) (-454.841) * (-455.975) [-453.435] (-455.842) (-454.180) -- 0:00:23
602500 -- [-455.710] (-454.678) (-455.283) (-455.557) * (-457.484) (-455.473) [-459.000] (-454.032) -- 0:00:23
603000 -- (-456.165) (-454.176) (-454.960) [-454.659] * (-454.853) (-458.467) (-456.367) [-454.629] -- 0:00:23
603500 -- (-458.133) [-454.883] (-458.569) (-454.765) * (-454.720) (-455.332) (-454.718) [-454.187] -- 0:00:23
604000 -- [-456.100] (-454.334) (-455.127) (-453.082) * (-454.361) (-454.230) (-456.824) [-453.991] -- 0:00:24
604500 -- (-455.112) [-457.615] (-455.468) (-454.460) * (-454.430) [-454.542] (-455.120) (-453.429) -- 0:00:24
605000 -- [-453.326] (-454.325) (-455.078) (-454.190) * (-458.222) (-454.548) [-457.662] (-454.487) -- 0:00:24
Average standard deviation of split frequencies: 0.006466
605500 -- (-453.326) (-454.679) [-457.013] (-452.786) * [-455.908] (-454.335) (-456.542) (-457.148) -- 0:00:24
606000 -- (-455.553) (-453.239) (-456.684) [-453.543] * (-453.403) (-453.234) [-454.759] (-454.293) -- 0:00:24
606500 -- (-455.663) (-455.309) [-454.549] (-454.700) * (-454.526) (-455.257) [-459.300] (-452.982) -- 0:00:24
607000 -- (-454.637) (-453.368) [-453.918] (-454.101) * [-453.100] (-456.772) (-455.391) (-455.674) -- 0:00:23
607500 -- (-455.033) [-452.787] (-455.618) (-453.966) * (-452.547) (-453.424) (-455.078) [-453.584] -- 0:00:23
608000 -- (-458.336) (-456.696) (-453.697) [-453.607] * [-453.298] (-454.963) (-454.605) (-454.988) -- 0:00:23
608500 -- (-454.848) (-454.801) [-454.075] (-453.129) * (-454.033) (-454.189) [-452.842] (-456.765) -- 0:00:23
609000 -- (-455.558) [-453.151] (-455.338) (-454.135) * (-456.078) (-453.208) (-453.743) [-454.110] -- 0:00:23
609500 -- (-456.732) [-454.361] (-454.330) (-452.892) * (-456.249) (-454.481) [-456.515] (-458.096) -- 0:00:23
610000 -- (-456.602) [-453.033] (-454.870) (-453.260) * (-456.660) (-455.385) [-453.182] (-456.336) -- 0:00:23
Average standard deviation of split frequencies: 0.006417
610500 -- [-457.671] (-452.906) (-452.602) (-453.031) * (-454.623) [-455.619] (-454.876) (-454.004) -- 0:00:23
611000 -- (-456.361) (-453.415) (-452.693) [-455.939] * (-455.807) [-454.026] (-456.328) (-455.029) -- 0:00:23
611500 -- (-453.447) (-455.727) [-453.868] (-453.766) * (-453.538) (-456.803) (-453.750) [-455.158] -- 0:00:23
612000 -- (-452.621) (-454.877) [-454.368] (-453.899) * [-453.149] (-453.068) (-453.078) (-454.984) -- 0:00:23
612500 -- (-457.120) (-456.227) (-455.173) [-453.231] * (-459.042) (-455.205) [-453.280] (-460.323) -- 0:00:23
613000 -- [-454.258] (-458.714) (-459.526) (-456.923) * [-456.891] (-457.724) (-454.973) (-453.339) -- 0:00:23
613500 -- (-455.744) (-456.290) (-454.900) [-454.167] * (-455.103) (-455.000) [-454.406] (-456.153) -- 0:00:23
614000 -- (-454.583) (-453.352) [-456.076] (-456.043) * (-459.231) (-455.664) [-457.295] (-453.435) -- 0:00:23
614500 -- [-455.395] (-455.571) (-457.903) (-457.625) * (-453.463) [-454.876] (-452.558) (-454.921) -- 0:00:23
615000 -- (-458.333) [-454.333] (-454.045) (-455.093) * (-453.734) (-457.748) (-454.647) [-454.159] -- 0:00:23
Average standard deviation of split frequencies: 0.006600
615500 -- (-460.748) (-453.541) [-454.174] (-457.692) * (-455.451) [-453.492] (-452.982) (-455.126) -- 0:00:23
616000 -- (-457.204) [-454.657] (-455.177) (-457.231) * (-457.281) (-454.921) (-455.014) [-455.333] -- 0:00:23
616500 -- (-454.292) [-453.160] (-456.540) (-457.731) * (-454.329) (-453.970) [-453.695] (-456.215) -- 0:00:23
617000 -- [-453.634] (-453.820) (-454.543) (-453.080) * (-454.632) [-453.955] (-454.233) (-455.977) -- 0:00:22
617500 -- (-453.799) [-452.801] (-454.547) (-453.653) * [-454.563] (-453.872) (-454.400) (-452.791) -- 0:00:22
618000 -- (-456.883) [-455.389] (-454.751) (-453.797) * [-453.149] (-456.532) (-454.866) (-452.649) -- 0:00:22
618500 -- (-454.183) [-455.818] (-453.381) (-453.369) * (-453.012) (-456.982) (-452.751) [-453.418] -- 0:00:22
619000 -- (-452.555) [-454.541] (-452.975) (-454.676) * [-455.711] (-456.073) (-456.150) (-455.027) -- 0:00:22
619500 -- [-457.585] (-454.673) (-454.369) (-455.215) * [-454.577] (-455.628) (-456.944) (-455.610) -- 0:00:22
620000 -- (-455.724) [-453.231] (-459.982) (-454.598) * (-454.005) (-456.262) (-455.498) [-455.739] -- 0:00:22
Average standard deviation of split frequencies: 0.006456
620500 -- (-453.159) (-454.306) (-453.112) [-455.820] * (-454.967) (-459.306) [-456.139] (-456.017) -- 0:00:23
621000 -- (-455.549) [-453.344] (-454.934) (-452.981) * (-453.024) (-461.931) (-456.818) [-456.911] -- 0:00:23
621500 -- [-453.412] (-454.624) (-456.768) (-453.507) * (-455.049) (-457.872) [-454.983] (-455.070) -- 0:00:23
622000 -- (-457.755) [-454.233] (-453.781) (-453.599) * (-455.408) [-457.589] (-455.249) (-454.072) -- 0:00:23
622500 -- (-453.120) [-453.776] (-455.798) (-453.626) * (-456.160) [-455.218] (-454.067) (-455.187) -- 0:00:23
623000 -- (-456.293) [-455.168] (-455.075) (-453.968) * (-453.741) (-455.461) (-457.325) [-456.865] -- 0:00:22
623500 -- [-456.566] (-454.888) (-453.319) (-457.280) * (-453.942) [-454.812] (-453.066) (-455.884) -- 0:00:22
624000 -- [-455.161] (-455.636) (-453.640) (-457.197) * (-454.792) (-454.363) (-452.536) [-454.959] -- 0:00:22
624500 -- (-454.339) [-453.535] (-455.126) (-456.358) * (-454.403) [-453.986] (-453.716) (-453.532) -- 0:00:22
625000 -- (-457.089) [-454.397] (-453.516) (-454.717) * (-453.524) (-453.077) [-455.260] (-455.458) -- 0:00:22
Average standard deviation of split frequencies: 0.006213
625500 -- [-454.775] (-454.028) (-456.663) (-457.986) * (-458.124) (-453.469) [-454.920] (-456.873) -- 0:00:22
626000 -- (-454.037) [-454.361] (-460.124) (-457.188) * (-458.099) [-454.269] (-454.123) (-452.909) -- 0:00:22
626500 -- [-455.466] (-453.629) (-458.742) (-459.596) * (-458.451) (-453.528) (-454.869) [-455.520] -- 0:00:22
627000 -- (-456.532) (-453.389) [-455.084] (-456.519) * [-455.017] (-453.324) (-455.776) (-455.720) -- 0:00:22
627500 -- (-453.588) (-457.193) [-453.103] (-455.368) * [-456.423] (-460.158) (-465.214) (-455.165) -- 0:00:22
628000 -- (-453.712) [-453.554] (-455.633) (-454.126) * (-458.794) (-454.793) (-463.228) [-456.737] -- 0:00:22
628500 -- [-455.350] (-455.394) (-454.753) (-454.814) * (-455.787) (-457.667) [-459.492] (-455.351) -- 0:00:22
629000 -- [-454.740] (-456.259) (-454.072) (-454.196) * (-454.964) (-459.748) [-455.554] (-459.724) -- 0:00:22
629500 -- (-455.629) [-459.296] (-454.182) (-453.087) * [-456.432] (-456.077) (-452.915) (-453.799) -- 0:00:22
630000 -- [-462.070] (-458.485) (-456.165) (-454.000) * (-453.686) (-455.973) (-453.745) [-452.878] -- 0:00:22
Average standard deviation of split frequencies: 0.006213
630500 -- (-455.701) [-455.918] (-456.987) (-454.778) * (-456.747) (-454.030) (-456.349) [-455.127] -- 0:00:22
631000 -- (-457.555) (-459.132) (-454.742) [-455.500] * (-454.707) (-458.883) [-454.632] (-454.830) -- 0:00:22
631500 -- (-454.132) (-452.722) [-457.093] (-457.041) * [-454.923] (-455.822) (-457.062) (-456.510) -- 0:00:22
632000 -- (-454.064) (-453.927) (-455.469) [-453.121] * [-455.577] (-455.926) (-455.770) (-459.334) -- 0:00:22
632500 -- (-455.460) (-456.480) (-455.644) [-452.821] * (-454.487) (-454.812) (-453.407) [-453.799] -- 0:00:22
633000 -- (-456.174) [-454.656] (-453.548) (-453.625) * (-454.190) (-461.898) [-454.523] (-454.161) -- 0:00:22
633500 -- (-454.839) (-453.127) [-457.888] (-454.170) * [-457.680] (-456.732) (-456.232) (-455.578) -- 0:00:21
634000 -- (-457.841) (-452.756) (-457.064) [-453.373] * (-453.254) (-455.011) [-459.658] (-455.731) -- 0:00:21
634500 -- [-454.534] (-453.235) (-455.801) (-455.048) * (-457.005) (-455.183) [-457.494] (-453.185) -- 0:00:21
635000 -- [-453.615] (-453.129) (-458.588) (-456.201) * (-456.319) [-452.850] (-455.650) (-453.820) -- 0:00:21
Average standard deviation of split frequencies: 0.006115
635500 -- (-457.198) [-453.582] (-454.782) (-456.466) * (-453.259) (-454.800) (-456.082) [-452.816] -- 0:00:21
636000 -- (-452.537) [-455.142] (-456.983) (-455.816) * (-454.193) [-454.465] (-455.848) (-452.931) -- 0:00:21
636500 -- [-453.389] (-454.811) (-454.590) (-453.406) * (-455.227) (-456.576) (-454.444) [-453.600] -- 0:00:21
637000 -- (-453.872) [-455.400] (-454.198) (-453.010) * (-455.857) (-455.424) [-453.368] (-454.402) -- 0:00:21
637500 -- [-453.529] (-454.149) (-454.454) (-453.332) * (-455.080) (-456.246) [-455.504] (-455.262) -- 0:00:22
638000 -- [-455.734] (-458.188) (-456.270) (-454.078) * (-455.146) (-459.354) (-454.293) [-453.177] -- 0:00:22
638500 -- (-454.780) [-454.883] (-457.826) (-455.074) * (-453.793) (-453.766) (-456.357) [-455.477] -- 0:00:22
639000 -- (-454.065) (-455.284) [-458.180] (-458.707) * [-453.517] (-454.150) (-453.771) (-455.358) -- 0:00:22
639500 -- (-454.384) (-456.219) [-456.038] (-462.706) * [-458.187] (-455.885) (-458.474) (-453.450) -- 0:00:21
640000 -- (-456.000) [-455.139] (-454.264) (-458.804) * (-454.630) [-454.075] (-455.693) (-453.653) -- 0:00:21
Average standard deviation of split frequencies: 0.006760
640500 -- (-455.282) (-456.400) [-457.116] (-454.856) * (-453.365) (-459.003) (-453.887) [-455.082] -- 0:00:21
641000 -- (-460.181) (-454.486) (-453.435) [-454.243] * (-457.217) [-455.442] (-453.106) (-453.531) -- 0:00:21
641500 -- (-456.119) [-454.345] (-457.149) (-456.645) * (-453.347) [-458.117] (-458.749) (-458.602) -- 0:00:21
642000 -- [-454.828] (-456.263) (-454.527) (-456.303) * (-452.724) [-454.918] (-457.515) (-455.319) -- 0:00:21
642500 -- [-453.705] (-456.718) (-460.623) (-457.885) * (-455.166) (-460.952) (-455.242) [-454.321] -- 0:00:21
643000 -- (-453.417) [-455.152] (-456.401) (-453.586) * (-454.253) (-453.683) [-456.379] (-454.136) -- 0:00:21
643500 -- [-452.806] (-454.325) (-454.484) (-456.070) * [-453.848] (-455.806) (-456.706) (-453.951) -- 0:00:21
644000 -- (-453.024) (-455.138) [-452.881] (-455.150) * (-455.018) [-456.630] (-455.072) (-456.195) -- 0:00:21
644500 -- (-454.187) (-454.644) (-454.282) [-454.006] * (-458.051) [-453.624] (-453.264) (-458.047) -- 0:00:21
645000 -- (-454.655) (-453.710) (-454.505) [-455.767] * [-457.300] (-453.728) (-458.841) (-458.471) -- 0:00:21
Average standard deviation of split frequencies: 0.006796
645500 -- (-454.358) (-455.341) (-453.489) [-454.779] * (-457.849) [-455.007] (-455.975) (-457.172) -- 0:00:21
646000 -- (-454.504) (-456.514) (-454.028) [-454.477] * (-456.730) (-456.249) [-452.914] (-456.813) -- 0:00:21
646500 -- (-454.590) [-455.064] (-455.912) (-456.021) * (-455.844) (-457.572) [-454.298] (-455.528) -- 0:00:21
647000 -- (-453.877) [-454.820] (-452.890) (-454.280) * (-455.678) [-461.726] (-457.353) (-454.460) -- 0:00:21
647500 -- (-456.245) [-456.861] (-455.827) (-455.079) * (-454.194) (-456.634) (-458.449) [-453.390] -- 0:00:21
648000 -- (-457.203) [-454.243] (-454.124) (-455.643) * (-454.566) [-453.337] (-454.642) (-454.081) -- 0:00:21
648500 -- (-455.258) (-456.822) [-453.681] (-454.148) * (-455.367) [-455.419] (-457.803) (-456.384) -- 0:00:21
649000 -- (-452.576) [-455.516] (-461.282) (-460.209) * (-454.986) (-456.551) [-454.983] (-453.404) -- 0:00:21
649500 -- (-453.407) [-453.778] (-454.578) (-457.135) * (-455.924) [-454.782] (-455.845) (-459.340) -- 0:00:21
650000 -- [-454.804] (-454.246) (-453.030) (-457.451) * (-456.928) [-453.277] (-457.974) (-461.565) -- 0:00:21
Average standard deviation of split frequencies: 0.006475
650500 -- (-453.098) (-453.825) (-453.583) [-453.579] * (-456.665) (-458.462) [-453.747] (-454.011) -- 0:00:20
651000 -- (-454.424) (-454.568) [-456.911] (-455.106) * (-460.558) (-453.009) [-456.808] (-455.312) -- 0:00:20
651500 -- [-454.792] (-454.766) (-455.356) (-455.642) * (-456.202) (-453.749) (-459.190) [-453.418] -- 0:00:20
652000 -- (-459.037) (-454.389) (-455.480) [-455.547] * (-457.485) (-457.469) [-454.016] (-454.665) -- 0:00:20
652500 -- [-454.033] (-455.537) (-453.851) (-454.754) * (-455.900) [-455.741] (-454.372) (-454.176) -- 0:00:20
653000 -- (-454.159) (-454.889) [-454.393] (-454.067) * (-455.908) (-453.008) (-455.560) [-455.874] -- 0:00:20
653500 -- [-452.791] (-455.745) (-457.482) (-454.628) * (-456.602) (-456.512) [-453.197] (-456.199) -- 0:00:20
654000 -- [-456.986] (-455.076) (-453.211) (-454.772) * (-457.414) (-455.856) (-454.858) [-454.479] -- 0:00:21
654500 -- (-460.607) (-455.673) (-455.702) [-453.682] * (-457.295) [-453.819] (-453.173) (-455.375) -- 0:00:21
655000 -- (-452.935) (-453.559) [-454.461] (-454.273) * (-455.982) (-453.110) (-459.759) [-454.365] -- 0:00:21
Average standard deviation of split frequencies: 0.006737
655500 -- (-454.094) (-455.374) (-453.178) [-457.544] * (-452.982) [-452.987] (-454.428) (-454.827) -- 0:00:21
656000 -- (-456.937) (-456.454) [-453.159] (-458.339) * (-453.168) (-455.348) (-457.004) [-457.303] -- 0:00:20
656500 -- (-456.383) (-453.367) (-457.655) [-456.181] * (-454.323) (-454.190) (-454.675) [-453.728] -- 0:00:20
657000 -- (-458.156) [-454.470] (-454.217) (-454.264) * (-455.384) [-453.313] (-455.405) (-454.472) -- 0:00:20
657500 -- (-454.061) [-454.278] (-454.985) (-454.918) * [-453.603] (-457.167) (-457.240) (-457.906) -- 0:00:20
658000 -- (-457.665) (-456.927) (-454.191) [-454.528] * [-459.203] (-454.173) (-453.254) (-454.746) -- 0:00:20
658500 -- (-452.994) (-456.323) [-455.095] (-457.344) * [-452.701] (-454.515) (-453.656) (-459.050) -- 0:00:20
659000 -- (-454.215) (-453.532) [-453.132] (-454.259) * (-454.944) (-454.792) (-460.241) [-454.252] -- 0:00:20
659500 -- [-453.683] (-453.662) (-453.071) (-455.282) * (-454.796) [-455.283] (-461.135) (-455.960) -- 0:00:20
660000 -- (-456.056) [-453.743] (-453.495) (-455.104) * (-454.704) (-455.284) (-462.037) [-459.847] -- 0:00:20
Average standard deviation of split frequencies: 0.007001
660500 -- [-455.948] (-453.092) (-455.189) (-454.126) * (-453.696) (-458.440) (-456.405) [-463.472] -- 0:00:20
661000 -- [-456.289] (-453.436) (-455.625) (-458.858) * [-455.246] (-455.948) (-459.306) (-454.706) -- 0:00:20
661500 -- (-455.479) (-455.324) [-454.331] (-455.667) * (-455.078) (-453.293) [-455.426] (-454.671) -- 0:00:20
662000 -- (-457.858) (-456.180) [-452.883] (-456.104) * (-454.231) [-455.141] (-454.663) (-453.761) -- 0:00:20
662500 -- (-453.750) (-455.479) (-454.130) [-453.294] * [-453.604] (-454.107) (-455.240) (-453.498) -- 0:00:20
663000 -- (-453.419) [-454.114] (-454.431) (-453.898) * (-453.667) (-454.335) [-454.031] (-455.127) -- 0:00:20
663500 -- (-458.750) (-457.654) (-454.856) [-455.416] * (-455.391) (-456.843) (-456.839) [-459.549] -- 0:00:20
664000 -- [-454.118] (-456.427) (-457.636) (-454.584) * [-455.584] (-456.985) (-454.397) (-459.816) -- 0:00:20
664500 -- [-455.803] (-456.636) (-463.424) (-455.503) * [-453.753] (-461.013) (-452.903) (-458.737) -- 0:00:20
665000 -- (-456.012) (-457.238) (-459.026) [-457.552] * [-455.929] (-456.127) (-455.412) (-462.050) -- 0:00:20
Average standard deviation of split frequencies: 0.007344
665500 -- (-452.919) (-453.318) [-456.071] (-455.521) * (-459.306) [-454.371] (-456.242) (-454.378) -- 0:00:20
666000 -- [-453.649] (-453.578) (-454.573) (-452.996) * [-456.637] (-454.096) (-454.608) (-456.874) -- 0:00:20
666500 -- (-457.753) (-455.589) [-454.568] (-457.343) * (-456.381) [-457.365] (-454.225) (-454.522) -- 0:00:20
667000 -- (-453.725) [-455.987] (-454.140) (-454.806) * (-453.798) (-455.370) [-454.747] (-454.562) -- 0:00:19
667500 -- [-456.877] (-456.740) (-454.444) (-454.562) * [-456.866] (-454.576) (-454.449) (-454.052) -- 0:00:19
668000 -- (-458.218) [-453.880] (-457.605) (-454.043) * (-456.356) [-457.011] (-457.596) (-455.372) -- 0:00:19
668500 -- [-455.917] (-453.364) (-454.088) (-455.340) * (-454.980) (-456.654) (-454.390) [-455.240] -- 0:00:19
669000 -- (-453.722) [-455.216] (-452.969) (-455.336) * (-459.647) [-455.383] (-456.071) (-455.281) -- 0:00:19
669500 -- (-454.109) [-456.166] (-454.392) (-453.656) * (-457.505) (-453.954) (-453.471) [-454.010] -- 0:00:20
670000 -- (-452.857) [-454.818] (-453.552) (-455.351) * (-456.998) [-453.607] (-458.779) (-455.447) -- 0:00:20
Average standard deviation of split frequencies: 0.007249
670500 -- (-454.131) (-455.356) [-456.411] (-453.031) * (-456.516) [-454.373] (-455.264) (-453.671) -- 0:00:20
671000 -- (-454.269) (-455.441) [-457.109] (-454.218) * (-460.607) (-457.256) (-455.019) [-454.820] -- 0:00:20
671500 -- (-453.986) (-454.785) [-456.917] (-457.409) * (-453.960) [-452.831] (-455.479) (-455.481) -- 0:00:20
672000 -- (-456.322) [-452.970] (-456.647) (-457.448) * (-453.671) (-455.275) [-453.571] (-454.728) -- 0:00:20
672500 -- (-455.035) (-455.246) (-452.930) [-454.435] * (-455.652) (-458.662) [-454.827] (-456.983) -- 0:00:19
673000 -- (-454.513) (-455.729) (-455.406) [-453.530] * [-457.404] (-456.172) (-454.003) (-452.915) -- 0:00:19
673500 -- (-456.800) [-455.605] (-457.045) (-453.541) * [-454.162] (-459.111) (-455.544) (-453.552) -- 0:00:19
674000 -- (-452.822) [-453.808] (-456.190) (-454.620) * (-455.628) (-455.010) (-453.804) [-453.022] -- 0:00:19
674500 -- [-453.499] (-453.609) (-454.549) (-452.795) * [-454.285] (-456.876) (-461.838) (-454.393) -- 0:00:19
675000 -- [-460.423] (-453.644) (-453.239) (-454.961) * (-457.285) [-453.857] (-454.762) (-454.269) -- 0:00:19
Average standard deviation of split frequencies: 0.007148
675500 -- (-455.286) (-456.993) (-455.818) [-453.889] * (-455.581) [-453.804] (-454.020) (-461.451) -- 0:00:19
676000 -- [-453.829] (-454.591) (-456.976) (-453.607) * (-454.127) [-453.308] (-458.349) (-456.095) -- 0:00:19
676500 -- (-456.557) (-453.967) [-454.316] (-455.216) * (-455.647) (-453.894) (-455.962) [-452.985] -- 0:00:19
677000 -- (-454.028) [-453.864] (-452.714) (-454.441) * (-453.615) (-456.353) (-456.400) [-453.686] -- 0:00:19
677500 -- [-455.846] (-452.627) (-452.939) (-455.458) * [-452.833] (-454.101) (-455.184) (-454.017) -- 0:00:19
678000 -- (-455.850) [-455.332] (-454.707) (-453.956) * [-456.460] (-455.101) (-453.663) (-455.594) -- 0:00:19
678500 -- [-454.787] (-452.851) (-455.121) (-457.614) * (-457.618) [-453.705] (-452.443) (-458.050) -- 0:00:19
679000 -- [-455.313] (-453.341) (-453.631) (-454.588) * (-458.050) [-453.965] (-454.131) (-457.021) -- 0:00:19
679500 -- (-454.039) (-453.207) (-453.871) [-454.643] * (-452.844) (-453.822) (-454.274) [-453.808] -- 0:00:19
680000 -- [-454.641] (-452.863) (-453.916) (-457.265) * (-456.342) (-454.710) (-455.053) [-454.182] -- 0:00:19
Average standard deviation of split frequencies: 0.007055
680500 -- (-454.553) [-453.017] (-453.920) (-453.983) * (-455.418) [-453.902] (-453.949) (-455.126) -- 0:00:19
681000 -- (-454.450) [-453.191] (-455.368) (-453.784) * [-454.909] (-455.748) (-454.233) (-454.922) -- 0:00:19
681500 -- [-454.153] (-454.501) (-454.638) (-455.703) * (-455.731) [-457.457] (-455.361) (-455.495) -- 0:00:19
682000 -- (-462.103) [-452.553] (-453.336) (-457.451) * [-454.795] (-454.695) (-453.995) (-454.798) -- 0:00:19
682500 -- [-454.585] (-453.954) (-455.184) (-457.511) * (-455.323) (-453.988) (-452.983) [-453.372] -- 0:00:19
683000 -- (-453.425) (-460.768) [-453.670] (-453.650) * (-456.774) (-455.077) (-456.247) [-455.659] -- 0:00:19
683500 -- (-453.475) (-454.290) (-457.915) [-454.823] * [-457.409] (-453.920) (-453.412) (-455.552) -- 0:00:18
684000 -- (-453.151) [-454.768] (-455.944) (-458.235) * (-457.477) (-453.046) [-454.339] (-454.189) -- 0:00:18
684500 -- (-455.377) (-455.025) [-453.042] (-456.637) * (-454.391) [-454.589] (-455.291) (-453.965) -- 0:00:18
685000 -- (-453.544) [-455.675] (-454.150) (-458.266) * (-454.418) [-454.094] (-452.706) (-454.318) -- 0:00:18
Average standard deviation of split frequencies: 0.007215
685500 -- (-455.147) [-454.822] (-456.708) (-456.870) * [-453.753] (-454.712) (-453.752) (-457.545) -- 0:00:18
686000 -- (-456.476) (-454.919) [-453.284] (-455.857) * (-453.834) [-454.808] (-454.247) (-455.274) -- 0:00:18
686500 -- (-456.770) [-454.176] (-454.583) (-455.989) * (-453.029) (-454.693) [-454.495] (-456.348) -- 0:00:19
687000 -- (-455.051) (-454.553) (-454.702) [-452.754] * (-453.485) (-455.070) [-455.304] (-456.503) -- 0:00:19
687500 -- (-453.839) [-453.052] (-453.189) (-456.068) * (-453.270) (-455.605) [-457.985] (-454.407) -- 0:00:19
688000 -- (-456.343) [-454.645] (-454.610) (-456.473) * (-453.856) (-455.756) (-461.759) [-453.008] -- 0:00:19
688500 -- (-456.337) (-453.389) [-457.886] (-456.104) * (-453.699) (-466.342) (-453.005) [-454.632] -- 0:00:19
689000 -- (-458.289) (-453.638) (-457.500) [-455.370] * [-453.836] (-455.109) (-453.483) (-455.791) -- 0:00:18
689500 -- (-456.412) (-455.628) (-454.978) [-454.052] * (-455.320) (-453.525) (-455.878) [-453.418] -- 0:00:18
690000 -- (-452.993) (-457.780) (-455.995) [-454.622] * (-455.408) (-454.540) (-456.380) [-454.554] -- 0:00:18
Average standard deviation of split frequencies: 0.007721
690500 -- (-459.012) (-454.648) [-453.673] (-454.493) * (-454.638) (-455.534) (-453.973) [-454.024] -- 0:00:18
691000 -- (-454.290) (-455.232) [-456.204] (-454.629) * (-454.170) (-455.077) [-455.057] (-453.211) -- 0:00:18
691500 -- (-453.420) (-454.677) (-453.714) [-453.187] * [-453.249] (-454.159) (-454.010) (-454.977) -- 0:00:18
692000 -- (-453.528) [-455.446] (-454.176) (-457.933) * (-455.554) (-455.207) (-453.891) [-455.500] -- 0:00:18
692500 -- [-455.517] (-455.881) (-453.899) (-468.002) * (-453.605) (-455.264) (-453.348) [-458.737] -- 0:00:18
693000 -- [-455.635] (-452.883) (-458.258) (-456.692) * [-453.855] (-453.697) (-455.276) (-456.215) -- 0:00:18
693500 -- (-456.511) (-454.169) [-455.301] (-454.331) * (-453.514) [-453.659] (-456.542) (-460.988) -- 0:00:18
694000 -- (-454.587) [-454.408] (-457.233) (-453.871) * (-453.575) (-456.468) (-455.412) [-456.211] -- 0:00:18
694500 -- (-455.497) (-455.339) (-453.962) [-454.472] * (-459.404) (-456.448) (-455.864) [-455.755] -- 0:00:18
695000 -- (-454.361) [-456.436] (-456.985) (-455.700) * [-454.140] (-455.557) (-454.054) (-454.330) -- 0:00:18
Average standard deviation of split frequencies: 0.007154
695500 -- [-455.703] (-454.968) (-458.222) (-452.922) * (-454.982) (-458.238) [-453.016] (-453.210) -- 0:00:18
696000 -- (-453.047) [-454.286] (-459.713) (-456.002) * (-457.704) [-457.762] (-454.629) (-454.713) -- 0:00:18
696500 -- (-453.125) (-454.607) (-457.545) [-456.577] * (-457.526) [-457.786] (-454.358) (-453.292) -- 0:00:18
697000 -- [-456.263] (-454.430) (-458.914) (-454.682) * (-453.998) [-456.416] (-456.155) (-454.280) -- 0:00:18
697500 -- (-455.141) [-453.203] (-457.061) (-453.823) * [-455.835] (-459.616) (-461.572) (-454.486) -- 0:00:18
698000 -- [-453.694] (-453.618) (-454.033) (-453.275) * (-454.786) [-455.451] (-454.962) (-455.420) -- 0:00:18
698500 -- [-452.893] (-456.111) (-454.080) (-458.417) * [-455.467] (-458.357) (-458.751) (-455.120) -- 0:00:18
699000 -- [-456.653] (-457.802) (-454.602) (-453.964) * (-459.386) [-454.067] (-454.915) (-454.867) -- 0:00:18
699500 -- (-455.750) (-457.511) [-453.291] (-453.266) * [-458.808] (-458.233) (-453.181) (-454.376) -- 0:00:18
700000 -- [-455.782] (-462.054) (-456.192) (-453.011) * (-456.850) (-455.141) (-456.551) [-453.106] -- 0:00:18
Average standard deviation of split frequencies: 0.007148
700500 -- (-455.519) (-461.485) (-453.825) [-453.304] * (-460.406) (-455.202) (-454.179) [-453.118] -- 0:00:17
701000 -- [-453.860] (-454.946) (-454.750) (-455.059) * [-455.276] (-454.166) (-457.482) (-454.190) -- 0:00:17
701500 -- (-455.094) [-456.794] (-453.952) (-460.272) * (-456.400) [-454.318] (-458.956) (-458.366) -- 0:00:17
702000 -- [-458.411] (-458.663) (-453.936) (-459.769) * [-452.941] (-453.211) (-454.929) (-454.883) -- 0:00:17
702500 -- (-455.168) (-456.863) (-455.492) [-458.040] * [-453.374] (-456.665) (-453.378) (-457.985) -- 0:00:17
703000 -- [-458.678] (-453.105) (-457.320) (-455.588) * (-457.223) (-453.978) (-453.994) [-455.057] -- 0:00:17
703500 -- [-455.059] (-455.639) (-452.907) (-454.612) * (-455.110) [-452.821] (-454.567) (-454.322) -- 0:00:18
704000 -- (-453.427) [-456.435] (-454.577) (-453.270) * (-453.312) [-455.250] (-455.558) (-453.362) -- 0:00:18
704500 -- (-453.386) (-457.488) (-453.697) [-458.705] * [-454.160] (-454.874) (-453.944) (-458.520) -- 0:00:18
705000 -- (-454.035) (-455.175) [-453.716] (-457.523) * [-453.811] (-453.948) (-454.035) (-454.256) -- 0:00:17
Average standard deviation of split frequencies: 0.007679
705500 -- (-454.152) (-455.082) [-455.308] (-455.586) * (-454.176) [-453.198] (-455.316) (-454.539) -- 0:00:17
706000 -- (-454.005) (-454.634) (-452.546) [-453.852] * (-454.544) [-456.220] (-453.645) (-456.275) -- 0:00:17
706500 -- (-453.686) [-455.078] (-452.865) (-455.420) * (-455.531) (-460.278) (-455.067) [-455.752] -- 0:00:17
707000 -- (-454.254) (-454.756) [-455.557] (-454.089) * [-455.962] (-454.726) (-453.754) (-454.017) -- 0:00:17
707500 -- (-454.096) (-455.890) [-455.680] (-454.204) * (-457.115) [-455.430] (-453.040) (-455.707) -- 0:00:17
708000 -- [-453.272] (-453.550) (-456.995) (-459.278) * (-453.444) (-458.255) (-454.653) [-456.965] -- 0:00:17
708500 -- (-454.493) (-453.732) [-457.660] (-458.378) * (-454.052) [-455.178] (-455.103) (-457.206) -- 0:00:17
709000 -- (-453.340) (-461.551) (-453.656) [-453.864] * (-454.816) (-456.523) (-454.731) [-455.014] -- 0:00:17
709500 -- [-453.062] (-456.315) (-457.242) (-454.142) * (-457.182) [-454.878] (-455.518) (-460.257) -- 0:00:17
710000 -- (-455.747) (-455.130) [-454.821] (-455.071) * [-453.912] (-453.660) (-453.556) (-457.643) -- 0:00:17
Average standard deviation of split frequencies: 0.007877
710500 -- (-454.691) [-454.075] (-454.066) (-454.181) * (-454.048) (-454.376) [-456.209] (-456.821) -- 0:00:17
711000 -- [-454.141] (-454.323) (-453.274) (-453.241) * [-453.203] (-454.195) (-456.447) (-458.031) -- 0:00:17
711500 -- (-454.728) (-454.266) (-453.143) [-455.397] * (-453.166) (-456.249) [-455.425] (-454.567) -- 0:00:17
712000 -- (-455.509) [-455.515] (-459.181) (-458.310) * (-459.274) (-456.726) (-457.329) [-454.292] -- 0:00:17
712500 -- (-455.557) [-455.609] (-458.251) (-456.927) * (-454.221) (-455.081) (-454.531) [-453.811] -- 0:00:17
713000 -- (-453.896) (-454.011) (-455.689) [-456.995] * (-452.872) [-456.727] (-453.581) (-457.318) -- 0:00:17
713500 -- [-456.284] (-454.408) (-453.527) (-454.334) * (-458.563) (-458.400) (-452.772) [-454.606] -- 0:00:17
714000 -- (-456.934) (-460.491) [-455.739] (-454.688) * (-453.720) [-453.446] (-453.721) (-454.414) -- 0:00:17
714500 -- (-462.197) (-458.613) [-455.447] (-454.656) * [-453.485] (-453.576) (-454.689) (-457.326) -- 0:00:17
715000 -- (-455.079) (-455.614) (-454.998) [-455.536] * (-453.487) [-453.855] (-454.976) (-457.855) -- 0:00:17
Average standard deviation of split frequencies: 0.008024
715500 -- (-454.687) (-452.719) [-458.190] (-456.618) * (-454.338) [-456.437] (-452.527) (-457.891) -- 0:00:17
716000 -- (-453.992) [-453.496] (-459.336) (-455.272) * (-454.492) (-455.789) [-453.966] (-454.928) -- 0:00:17
716500 -- (-453.417) (-453.910) [-454.920] (-457.250) * (-456.477) (-453.535) (-453.967) [-454.987] -- 0:00:17
717000 -- [-454.091] (-454.016) (-455.386) (-455.073) * [-457.168] (-454.739) (-459.437) (-457.650) -- 0:00:16
717500 -- (-454.347) [-452.969] (-453.912) (-453.850) * [-455.494] (-455.425) (-456.035) (-454.259) -- 0:00:16
718000 -- (-453.159) [-454.060] (-454.394) (-453.808) * (-458.617) (-457.081) [-454.582] (-455.895) -- 0:00:16
718500 -- [-453.152] (-456.181) (-457.475) (-456.187) * [-454.589] (-456.541) (-454.777) (-453.342) -- 0:00:16
719000 -- [-454.354] (-457.820) (-459.480) (-453.750) * [-457.435] (-454.347) (-458.069) (-461.318) -- 0:00:16
719500 -- [-454.943] (-454.140) (-456.827) (-452.999) * (-454.277) [-454.723] (-458.226) (-458.963) -- 0:00:16
720000 -- (-455.098) (-453.613) [-455.849] (-456.651) * [-454.619] (-455.210) (-453.149) (-458.811) -- 0:00:16
Average standard deviation of split frequencies: 0.007359
720500 -- (-456.884) (-453.492) (-455.686) [-453.374] * (-456.495) (-455.268) [-454.795] (-453.990) -- 0:00:17
721000 -- (-454.809) [-458.878] (-454.394) (-453.240) * (-453.600) (-453.624) (-455.430) [-456.473] -- 0:00:17
721500 -- (-453.338) (-457.197) [-454.739] (-457.865) * (-455.883) (-458.044) [-456.690] (-454.133) -- 0:00:16
722000 -- [-453.835] (-454.619) (-455.852) (-455.081) * (-454.918) [-453.839] (-456.209) (-456.128) -- 0:00:16
722500 -- (-453.910) [-454.494] (-455.338) (-458.544) * (-452.941) [-454.736] (-458.754) (-458.386) -- 0:00:16
723000 -- [-455.268] (-458.900) (-456.673) (-456.732) * (-452.915) (-457.334) (-455.708) [-455.701] -- 0:00:16
723500 -- (-454.295) [-456.260] (-454.184) (-460.352) * (-454.201) (-453.403) [-455.587] (-454.447) -- 0:00:16
724000 -- (-453.225) [-454.195] (-453.965) (-453.663) * [-454.278] (-452.969) (-453.226) (-454.336) -- 0:00:16
724500 -- (-454.357) (-454.776) [-456.344] (-453.310) * (-453.996) (-452.942) [-454.707] (-453.542) -- 0:00:16
725000 -- [-457.096] (-456.491) (-453.572) (-457.789) * (-454.574) (-453.436) [-454.318] (-458.829) -- 0:00:16
Average standard deviation of split frequencies: 0.007670
725500 -- (-454.412) (-453.417) [-454.276] (-455.760) * (-454.399) [-453.210] (-454.876) (-461.572) -- 0:00:16
726000 -- [-454.662] (-458.651) (-453.525) (-453.475) * [-454.743] (-455.265) (-455.232) (-456.018) -- 0:00:16
726500 -- [-454.871] (-456.278) (-453.193) (-454.909) * (-453.020) (-454.696) [-455.787] (-453.422) -- 0:00:16
727000 -- [-453.358] (-453.186) (-454.695) (-454.491) * (-457.565) (-453.724) (-455.362) [-453.101] -- 0:00:16
727500 -- (-453.419) [-458.780] (-452.771) (-455.009) * (-454.153) (-453.744) (-455.592) [-453.356] -- 0:00:16
728000 -- (-455.875) [-457.621] (-453.171) (-454.739) * (-453.965) (-457.628) [-454.834] (-457.407) -- 0:00:16
728500 -- [-453.604] (-454.913) (-455.708) (-454.710) * (-453.089) (-456.945) [-454.629] (-453.317) -- 0:00:16
729000 -- (-454.191) (-454.871) (-455.590) [-454.710] * (-458.560) [-453.481] (-452.845) (-453.696) -- 0:00:16
729500 -- (-453.654) (-457.980) (-455.485) [-455.935] * [-454.318] (-453.005) (-459.795) (-452.921) -- 0:00:16
730000 -- [-454.383] (-455.395) (-454.677) (-457.730) * (-454.674) [-452.916] (-456.520) (-453.200) -- 0:00:16
Average standard deviation of split frequencies: 0.008024
730500 -- (-454.795) (-455.988) [-453.858] (-453.452) * (-453.392) (-454.968) [-452.818] (-452.364) -- 0:00:16
731000 -- (-454.446) (-456.282) [-454.957] (-455.713) * (-452.903) [-454.185] (-453.837) (-452.725) -- 0:00:16
731500 -- [-457.392] (-455.304) (-454.386) (-455.415) * [-453.022] (-455.639) (-455.065) (-454.219) -- 0:00:16
732000 -- (-457.723) (-454.498) [-454.423] (-454.325) * (-454.429) [-457.989] (-453.181) (-454.657) -- 0:00:16
732500 -- (-456.298) (-455.074) [-455.916] (-454.129) * (-453.715) [-453.401] (-455.059) (-457.918) -- 0:00:16
733000 -- (-453.587) (-455.760) (-453.806) [-453.588] * (-454.999) (-452.851) (-454.298) [-455.162] -- 0:00:16
733500 -- [-461.560] (-457.353) (-456.146) (-456.544) * (-455.074) [-454.249] (-455.090) (-454.597) -- 0:00:15
734000 -- [-455.577] (-454.895) (-453.948) (-457.905) * (-453.328) [-455.361] (-455.282) (-455.107) -- 0:00:15
734500 -- [-455.377] (-453.264) (-455.427) (-454.425) * (-459.060) (-456.268) (-454.392) [-453.919] -- 0:00:15
735000 -- (-457.496) (-455.192) (-456.998) [-453.934] * (-453.010) (-454.486) [-456.244] (-453.927) -- 0:00:15
Average standard deviation of split frequencies: 0.007766
735500 -- (-455.059) [-454.518] (-455.635) (-454.112) * [-454.298] (-453.092) (-453.645) (-454.985) -- 0:00:15
736000 -- (-455.564) (-454.685) [-455.351] (-453.806) * [-457.002] (-456.444) (-455.389) (-456.096) -- 0:00:15
736500 -- (-454.882) (-453.715) [-456.286] (-453.847) * (-461.472) (-457.154) [-454.292] (-455.343) -- 0:00:15
737000 -- (-453.662) (-457.967) (-452.583) [-457.054] * (-454.320) (-454.262) (-454.328) [-455.470] -- 0:00:15
737500 -- [-455.038] (-455.294) (-453.852) (-454.774) * (-455.163) (-453.085) [-455.083] (-454.701) -- 0:00:15
738000 -- [-455.570] (-453.539) (-453.547) (-456.131) * (-456.195) [-454.011] (-460.114) (-454.994) -- 0:00:15
738500 -- (-457.614) (-455.696) (-454.186) [-453.988] * (-455.903) (-453.168) (-455.695) [-454.950] -- 0:00:15
739000 -- (-454.640) (-455.612) [-454.372] (-456.655) * (-454.827) [-454.189] (-454.230) (-455.317) -- 0:00:15
739500 -- (-453.910) (-455.665) [-456.071] (-457.429) * (-456.824) (-458.654) (-454.000) [-459.377] -- 0:00:15
740000 -- (-454.816) (-454.243) [-453.565] (-455.072) * (-455.117) (-454.553) [-453.667] (-456.588) -- 0:00:15
Average standard deviation of split frequencies: 0.007757
740500 -- [-462.333] (-455.363) (-454.531) (-454.895) * (-456.464) (-455.846) [-453.269] (-456.241) -- 0:00:15
741000 -- (-454.111) (-454.041) [-453.097] (-454.831) * [-459.003] (-457.119) (-453.473) (-457.408) -- 0:00:15
741500 -- (-458.571) [-454.622] (-453.461) (-455.451) * (-458.398) (-460.568) [-455.908] (-456.215) -- 0:00:15
742000 -- [-457.897] (-458.218) (-452.992) (-458.911) * (-453.159) (-453.503) [-453.338] (-454.485) -- 0:00:15
742500 -- (-455.924) (-456.429) (-453.253) [-455.862] * (-453.925) [-452.888] (-453.818) (-455.211) -- 0:00:15
743000 -- (-455.724) (-455.149) (-454.020) [-453.439] * (-454.911) (-452.995) (-453.068) [-455.177] -- 0:00:15
743500 -- (-453.071) [-453.696] (-456.753) (-454.135) * (-457.359) [-453.564] (-454.823) (-456.544) -- 0:00:15
744000 -- [-452.948] (-455.291) (-454.998) (-456.917) * [-455.723] (-454.788) (-453.466) (-456.844) -- 0:00:15
744500 -- (-455.463) [-454.097] (-455.445) (-458.370) * (-459.565) (-453.568) (-455.231) [-456.325] -- 0:00:15
745000 -- (-459.236) (-455.036) [-455.240] (-453.355) * (-463.132) (-455.459) (-455.124) [-453.725] -- 0:00:15
Average standard deviation of split frequencies: 0.007622
745500 -- (-452.595) (-454.722) [-455.584] (-452.804) * [-458.422] (-455.154) (-456.077) (-457.093) -- 0:00:15
746000 -- (-456.462) (-453.050) (-456.680) [-452.486] * (-458.538) (-456.316) [-453.551] (-456.849) -- 0:00:15
746500 -- (-455.959) [-453.868] (-454.088) (-452.937) * (-455.948) (-460.021) (-453.692) [-461.486] -- 0:00:15
747000 -- (-455.929) [-456.006] (-453.975) (-457.769) * (-452.527) (-454.918) [-453.725] (-456.282) -- 0:00:15
747500 -- (-458.004) [-454.015] (-455.615) (-456.420) * (-453.365) (-455.859) (-455.324) [-455.182] -- 0:00:15
748000 -- (-456.960) [-453.093] (-454.717) (-457.208) * (-455.150) (-453.301) (-458.601) [-453.621] -- 0:00:15
748500 -- (-455.974) [-453.315] (-455.187) (-456.234) * [-453.711] (-455.129) (-453.692) (-453.367) -- 0:00:15
749000 -- (-457.575) (-455.616) [-452.785] (-453.540) * (-457.266) [-453.395] (-457.275) (-453.862) -- 0:00:15
749500 -- [-454.125] (-452.996) (-453.015) (-456.412) * (-455.949) (-456.056) [-457.555] (-453.776) -- 0:00:15
750000 -- [-453.115] (-454.164) (-457.239) (-457.597) * (-463.715) (-457.187) (-456.329) [-455.322] -- 0:00:15
Average standard deviation of split frequencies: 0.007732
750500 -- (-454.536) (-452.955) [-456.964] (-455.479) * (-454.236) (-455.260) [-454.022] (-454.579) -- 0:00:14
751000 -- (-453.477) (-456.657) [-454.715] (-455.394) * [-453.682] (-460.413) (-455.659) (-453.884) -- 0:00:14
751500 -- (-454.144) [-452.955] (-459.157) (-454.749) * [-454.974] (-454.509) (-454.845) (-458.636) -- 0:00:14
752000 -- (-454.894) [-454.242] (-455.893) (-454.649) * (-453.346) [-454.762] (-459.417) (-453.493) -- 0:00:14
752500 -- (-456.724) [-454.462] (-453.801) (-458.456) * (-454.758) [-453.516] (-458.045) (-453.084) -- 0:00:14
753000 -- [-453.870] (-454.419) (-455.350) (-457.349) * [-452.911] (-454.090) (-455.839) (-452.983) -- 0:00:14
753500 -- (-453.658) (-455.460) [-455.243] (-453.680) * [-454.284] (-453.126) (-457.394) (-456.492) -- 0:00:14
754000 -- (-454.457) (-454.808) (-454.228) [-453.248] * [-454.165] (-453.005) (-457.758) (-454.417) -- 0:00:14
754500 -- (-456.944) (-457.235) (-453.065) [-455.841] * (-454.022) (-454.946) [-454.466] (-453.196) -- 0:00:14
755000 -- [-457.817] (-454.732) (-453.610) (-454.356) * (-455.339) (-452.616) [-453.847] (-457.901) -- 0:00:14
Average standard deviation of split frequencies: 0.007444
755500 -- [-456.362] (-454.407) (-452.997) (-453.268) * [-454.463] (-452.659) (-453.652) (-456.197) -- 0:00:14
756000 -- [-454.050] (-459.169) (-455.400) (-454.763) * (-454.924) (-456.380) [-453.381] (-455.695) -- 0:00:14
756500 -- (-458.101) (-455.904) (-459.120) [-454.008] * (-456.191) [-453.423] (-454.008) (-457.796) -- 0:00:14
757000 -- (-454.222) [-454.391] (-459.552) (-457.847) * (-456.844) [-453.290] (-455.778) (-453.722) -- 0:00:14
757500 -- (-455.757) (-454.464) (-455.305) [-455.440] * (-458.277) (-452.927) [-454.177] (-459.444) -- 0:00:14
758000 -- (-455.326) (-455.848) [-453.804] (-452.896) * (-456.588) (-456.564) [-453.658] (-455.813) -- 0:00:14
758500 -- (-456.168) (-453.079) (-454.321) [-460.668] * (-452.772) (-455.237) [-455.002] (-455.566) -- 0:00:14
759000 -- (-455.101) [-453.843] (-461.716) (-457.329) * (-453.873) (-454.821) (-454.541) [-455.003] -- 0:00:14
759500 -- [-454.521] (-457.036) (-456.412) (-453.996) * [-453.532] (-452.808) (-458.300) (-455.121) -- 0:00:14
760000 -- (-454.096) (-455.369) (-454.170) [-454.137] * (-456.248) (-453.767) [-453.879] (-456.809) -- 0:00:14
Average standard deviation of split frequencies: 0.007049
760500 -- (-462.115) (-455.185) (-457.109) [-455.619] * (-454.861) (-457.167) (-453.645) [-453.581] -- 0:00:14
761000 -- [-454.289] (-455.406) (-455.433) (-454.611) * (-455.244) (-454.576) (-455.878) [-454.446] -- 0:00:14
761500 -- [-454.539] (-456.150) (-453.756) (-455.493) * (-456.331) (-454.064) [-454.309] (-457.247) -- 0:00:14
762000 -- (-455.922) [-453.488] (-456.874) (-455.010) * (-453.504) [-457.266] (-453.588) (-456.740) -- 0:00:14
762500 -- (-455.826) (-461.104) [-453.886] (-454.508) * (-453.772) (-455.387) [-458.716] (-455.421) -- 0:00:14
763000 -- (-454.839) (-459.291) (-453.822) [-452.509] * (-453.604) (-454.505) (-453.516) [-453.199] -- 0:00:14
763500 -- (-456.003) (-460.855) (-453.250) [-453.794] * [-453.100] (-452.582) (-454.619) (-454.155) -- 0:00:14
764000 -- (-460.976) (-457.215) [-457.806] (-454.716) * (-453.917) (-453.109) [-454.454] (-454.363) -- 0:00:14
764500 -- (-453.571) (-456.003) [-455.656] (-455.038) * (-453.217) [-456.739] (-456.468) (-457.440) -- 0:00:14
765000 -- (-454.592) (-456.108) [-454.368] (-454.939) * (-454.968) [-456.130] (-454.101) (-458.140) -- 0:00:14
Average standard deviation of split frequencies: 0.006846
765500 -- (-453.262) (-453.787) [-454.715] (-461.702) * (-454.538) [-455.881] (-457.444) (-454.135) -- 0:00:14
766000 -- (-454.866) (-455.530) (-453.605) [-456.373] * (-453.894) [-457.835] (-459.717) (-455.070) -- 0:00:14
766500 -- (-457.460) [-455.176] (-455.322) (-457.769) * (-453.747) (-456.694) [-453.508] (-454.927) -- 0:00:14
767000 -- [-454.169] (-452.726) (-456.360) (-453.426) * (-457.845) (-456.752) [-452.918] (-459.088) -- 0:00:13
767500 -- (-456.165) [-453.449] (-453.421) (-454.522) * (-456.819) (-455.620) [-454.348] (-454.063) -- 0:00:13
768000 -- (-455.861) (-454.362) [-457.127] (-459.536) * [-456.787] (-456.670) (-452.921) (-454.209) -- 0:00:13
768500 -- (-456.382) (-454.819) [-453.636] (-453.667) * (-455.744) (-453.093) (-455.253) [-454.125] -- 0:00:13
769000 -- (-456.174) (-455.058) [-452.779] (-453.698) * [-456.061] (-455.367) (-457.851) (-454.201) -- 0:00:13
769500 -- (-455.614) (-453.394) [-452.801] (-454.165) * (-456.728) [-454.639] (-455.087) (-453.711) -- 0:00:13
770000 -- (-453.882) (-453.661) (-455.179) [-453.160] * [-455.075] (-459.230) (-458.032) (-453.481) -- 0:00:13
Average standard deviation of split frequencies: 0.006537
770500 -- [-455.863] (-454.982) (-460.565) (-454.697) * (-453.380) (-454.494) [-454.368] (-458.880) -- 0:00:13
771000 -- (-457.571) (-453.862) [-455.426] (-456.619) * [-456.621] (-456.959) (-457.388) (-454.360) -- 0:00:13
771500 -- [-457.345] (-454.806) (-453.404) (-452.942) * (-454.480) (-457.858) (-459.461) [-453.750] -- 0:00:13
772000 -- (-453.254) (-455.769) [-455.471] (-456.475) * (-456.517) (-454.357) (-457.845) [-454.361] -- 0:00:13
772500 -- (-453.224) (-458.219) (-454.010) [-453.181] * (-455.164) (-452.595) [-457.164] (-457.251) -- 0:00:13
773000 -- [-452.663] (-453.066) (-455.808) (-453.445) * (-453.903) [-457.282] (-454.328) (-453.536) -- 0:00:13
773500 -- (-452.670) (-455.772) (-453.553) [-453.614] * (-454.401) (-453.658) (-454.604) [-455.126] -- 0:00:13
774000 -- (-454.457) (-452.609) [-453.982] (-453.310) * [-453.349] (-455.772) (-454.606) (-455.586) -- 0:00:13
774500 -- (-454.265) (-457.686) [-453.657] (-454.252) * (-452.926) (-455.086) (-456.047) [-454.707] -- 0:00:13
775000 -- (-454.536) [-454.169] (-454.445) (-453.494) * (-454.607) [-456.554] (-457.734) (-455.645) -- 0:00:13
Average standard deviation of split frequencies: 0.006948
775500 -- (-453.582) (-458.380) (-455.809) [-456.654] * [-453.843] (-456.238) (-452.777) (-453.918) -- 0:00:13
776000 -- (-455.025) (-459.041) [-454.028] (-454.913) * [-458.223] (-454.811) (-457.189) (-456.894) -- 0:00:13
776500 -- (-453.405) (-453.012) (-455.439) [-453.249] * (-453.477) [-455.510] (-454.929) (-456.763) -- 0:00:13
777000 -- (-454.129) [-456.253] (-454.900) (-454.538) * (-454.089) (-453.784) (-459.286) [-455.059] -- 0:00:13
777500 -- [-454.716] (-453.963) (-453.980) (-452.761) * (-453.817) (-455.273) [-453.910] (-455.675) -- 0:00:13
778000 -- (-452.524) [-454.009] (-453.837) (-457.475) * [-453.841] (-453.818) (-452.754) (-453.340) -- 0:00:13
778500 -- [-456.286] (-455.908) (-455.498) (-453.768) * [-452.868] (-454.604) (-453.756) (-455.290) -- 0:00:13
779000 -- (-453.456) (-453.518) (-456.588) [-454.121] * (-457.534) [-457.352] (-455.779) (-457.778) -- 0:00:13
779500 -- (-453.833) [-454.144] (-453.176) (-455.803) * (-454.609) (-453.612) [-455.632] (-453.608) -- 0:00:13
780000 -- (-457.466) [-453.922] (-460.410) (-457.593) * (-456.086) [-454.697] (-457.224) (-452.938) -- 0:00:13
Average standard deviation of split frequencies: 0.006642
780500 -- (-452.869) [-454.610] (-458.930) (-454.084) * (-453.140) (-453.939) (-454.533) [-455.307] -- 0:00:13
781000 -- (-455.257) (-454.452) (-457.845) [-455.548] * (-453.357) (-453.262) [-456.847] (-453.148) -- 0:00:13
781500 -- (-454.509) (-458.395) [-457.735] (-455.055) * (-456.420) [-452.775] (-456.039) (-454.031) -- 0:00:13
782000 -- [-453.912] (-454.071) (-454.461) (-455.314) * (-456.934) [-455.145] (-456.176) (-456.484) -- 0:00:13
782500 -- (-455.055) (-456.315) [-453.868] (-453.527) * (-456.446) [-454.369] (-455.468) (-455.133) -- 0:00:13
783000 -- (-454.194) [-453.294] (-453.261) (-454.348) * (-454.275) (-453.272) (-457.092) [-454.796] -- 0:00:13
783500 -- (-453.331) (-455.073) (-456.375) [-457.343] * (-461.456) (-453.852) (-454.957) [-458.343] -- 0:00:12
784000 -- (-452.945) [-454.322] (-456.139) (-456.217) * (-454.796) (-455.134) (-456.765) [-453.520] -- 0:00:12
784500 -- (-453.161) [-454.495] (-454.293) (-453.978) * (-454.148) (-458.754) (-461.081) [-455.815] -- 0:00:12
785000 -- (-453.394) [-456.239] (-458.485) (-453.941) * (-456.853) [-453.474] (-459.321) (-454.365) -- 0:00:12
Average standard deviation of split frequencies: 0.006560
785500 -- [-452.755] (-455.070) (-459.063) (-456.164) * (-453.895) (-454.844) [-455.056] (-456.237) -- 0:00:12
786000 -- (-456.388) [-454.808] (-454.244) (-458.244) * (-453.248) (-455.838) [-453.516] (-454.346) -- 0:00:12
786500 -- [-453.313] (-459.063) (-455.521) (-455.740) * (-454.728) (-455.271) [-455.239] (-455.957) -- 0:00:12
787000 -- (-455.851) (-455.244) (-455.339) [-457.798] * (-457.396) (-454.013) [-459.321] (-454.421) -- 0:00:12
787500 -- [-454.653] (-455.468) (-455.341) (-453.520) * (-457.257) (-455.410) (-456.336) [-455.498] -- 0:00:12
788000 -- (-459.345) (-457.749) (-453.562) [-453.823] * [-455.748] (-456.458) (-454.169) (-455.593) -- 0:00:12
788500 -- (-456.150) (-453.930) [-454.905] (-454.414) * (-454.717) (-455.765) (-456.822) [-454.672] -- 0:00:12
789000 -- (-454.692) (-457.861) (-455.959) [-456.483] * (-454.656) (-456.127) [-456.254] (-453.752) -- 0:00:12
789500 -- (-453.691) [-452.640] (-454.852) (-453.463) * (-455.079) [-453.874] (-452.766) (-453.021) -- 0:00:12
790000 -- [-453.953] (-456.624) (-453.285) (-456.759) * (-454.958) (-454.534) (-455.628) [-456.739] -- 0:00:12
Average standard deviation of split frequencies: 0.006372
790500 -- (-454.904) (-455.177) [-453.280] (-452.538) * (-453.410) [-454.450] (-455.282) (-454.047) -- 0:00:12
791000 -- [-452.773] (-453.480) (-457.140) (-454.502) * [-455.497] (-455.072) (-457.138) (-453.118) -- 0:00:12
791500 -- (-454.760) [-452.711] (-455.647) (-453.993) * (-454.081) (-453.699) (-455.356) [-453.002] -- 0:00:12
792000 -- (-453.049) [-456.035] (-457.833) (-457.806) * (-454.812) (-453.063) (-455.905) [-453.144] -- 0:00:12
792500 -- (-452.778) [-456.778] (-459.062) (-455.683) * (-454.231) [-453.224] (-453.787) (-456.761) -- 0:00:12
793000 -- (-457.699) [-456.830] (-453.898) (-454.923) * (-456.368) (-456.159) (-455.369) [-456.529] -- 0:00:12
793500 -- [-455.813] (-454.678) (-453.535) (-453.236) * (-454.726) [-454.591] (-455.459) (-455.511) -- 0:00:12
794000 -- (-454.538) [-457.648] (-455.008) (-457.872) * (-453.273) (-452.924) [-452.835] (-454.789) -- 0:00:12
794500 -- (-453.878) (-457.873) [-454.543] (-454.109) * (-454.058) (-452.626) (-457.042) [-459.641] -- 0:00:12
795000 -- [-454.328] (-455.288) (-455.248) (-453.665) * (-459.783) (-452.636) [-453.958] (-454.652) -- 0:00:12
Average standard deviation of split frequencies: 0.006181
795500 -- (-459.759) (-457.573) (-455.666) [-457.693] * (-457.327) [-455.111] (-454.837) (-455.743) -- 0:00:12
796000 -- (-456.460) (-454.040) [-455.310] (-453.916) * [-455.681] (-455.031) (-453.501) (-455.316) -- 0:00:12
796500 -- (-454.200) [-454.290] (-453.667) (-455.896) * (-455.165) [-453.904] (-456.422) (-455.800) -- 0:00:12
797000 -- (-454.355) [-455.394] (-454.002) (-453.553) * (-456.838) [-454.840] (-453.667) (-456.915) -- 0:00:12
797500 -- [-454.775] (-455.578) (-453.087) (-453.347) * (-453.981) (-454.416) (-456.846) [-454.312] -- 0:00:12
798000 -- (-452.949) (-453.999) (-459.419) [-455.151] * (-457.869) (-452.551) [-456.570] (-455.979) -- 0:00:12
798500 -- (-453.542) [-454.568] (-454.970) (-453.796) * (-455.509) (-457.434) (-457.276) [-453.174] -- 0:00:12
799000 -- (-454.957) (-453.146) [-454.968] (-454.269) * (-455.599) (-455.383) (-459.275) [-453.124] -- 0:00:12
799500 -- (-458.230) [-455.240] (-454.395) (-453.460) * (-456.155) (-456.596) (-455.635) [-453.785] -- 0:00:12
800000 -- (-458.125) [-454.748] (-454.959) (-453.336) * (-456.803) (-455.433) [-454.910] (-453.235) -- 0:00:12
Average standard deviation of split frequencies: 0.006476
800500 -- (-459.637) (-458.727) [-453.219] (-457.448) * (-456.495) (-457.573) (-455.758) [-454.485] -- 0:00:11
801000 -- (-456.925) (-459.345) (-453.998) [-454.115] * (-457.278) [-458.998] (-453.086) (-453.936) -- 0:00:11
801500 -- (-456.984) (-457.000) [-453.922] (-454.283) * (-455.355) (-456.223) (-454.855) [-454.861] -- 0:00:11
802000 -- (-455.904) (-455.352) [-453.486] (-453.349) * [-455.594] (-455.020) (-454.312) (-455.901) -- 0:00:11
802500 -- (-454.850) [-454.410] (-455.618) (-452.965) * [-453.941] (-455.808) (-455.259) (-453.465) -- 0:00:11
803000 -- (-456.583) (-454.589) (-455.860) [-453.620] * (-456.234) (-454.999) (-455.663) [-452.810] -- 0:00:11
803500 -- (-452.413) (-456.798) (-453.499) [-453.416] * (-452.932) (-456.329) [-455.096] (-456.306) -- 0:00:11
804000 -- (-454.391) [-457.992] (-455.190) (-453.158) * [-453.715] (-455.246) (-458.110) (-456.728) -- 0:00:11
804500 -- (-460.801) (-456.153) [-454.078] (-455.365) * (-454.165) (-455.854) [-456.325] (-455.981) -- 0:00:11
805000 -- (-454.109) (-453.653) (-456.230) [-457.560] * (-455.081) [-453.319] (-453.824) (-456.895) -- 0:00:11
Average standard deviation of split frequencies: 0.006031
805500 -- (-454.251) [-457.081] (-456.915) (-457.485) * [-456.753] (-456.780) (-458.066) (-454.367) -- 0:00:11
806000 -- (-453.897) [-455.367] (-455.768) (-453.766) * (-465.955) [-456.909] (-455.787) (-456.140) -- 0:00:11
806500 -- (-453.478) (-456.901) (-455.151) [-454.433] * (-455.086) (-457.569) (-456.385) [-455.723] -- 0:00:11
807000 -- (-455.193) (-453.459) (-454.095) [-454.473] * (-453.953) (-457.351) [-455.169] (-453.844) -- 0:00:11
807500 -- [-453.316] (-453.382) (-454.015) (-453.811) * (-454.293) (-461.657) [-454.815] (-456.259) -- 0:00:11
808000 -- [-454.152] (-454.133) (-454.902) (-454.661) * (-457.198) (-455.558) (-456.958) [-454.978] -- 0:00:11
808500 -- (-458.376) [-456.807] (-455.464) (-455.907) * [-453.488] (-453.194) (-453.603) (-454.343) -- 0:00:11
809000 -- (-455.838) (-457.624) [-453.410] (-453.557) * (-455.065) (-452.908) (-453.993) [-452.964] -- 0:00:11
809500 -- (-454.537) [-454.894] (-456.189) (-456.993) * (-455.334) (-452.820) [-453.156] (-455.729) -- 0:00:11
810000 -- (-458.814) (-455.532) (-460.346) [-458.020] * (-457.009) (-453.994) (-453.241) [-454.377] -- 0:00:11
Average standard deviation of split frequencies: 0.006069
810500 -- (-455.668) [-454.463] (-455.013) (-458.489) * (-454.547) (-457.621) (-453.045) [-453.706] -- 0:00:11
811000 -- [-456.532] (-454.206) (-456.817) (-454.859) * (-453.746) [-454.107] (-453.007) (-455.495) -- 0:00:11
811500 -- (-455.349) (-460.739) [-457.624] (-454.506) * (-453.985) (-457.049) [-452.924] (-454.742) -- 0:00:11
812000 -- (-457.897) (-457.004) (-454.603) [-453.819] * (-454.341) (-456.500) (-453.477) [-452.886] -- 0:00:11
812500 -- (-455.315) (-459.670) (-453.449) [-453.106] * (-454.561) (-454.886) (-453.088) [-452.838] -- 0:00:11
813000 -- (-457.045) [-455.335] (-453.691) (-460.255) * (-456.849) [-454.843] (-454.762) (-454.944) -- 0:00:11
813500 -- (-455.134) (-455.878) [-457.541] (-454.043) * (-455.329) [-454.771] (-454.727) (-453.615) -- 0:00:11
814000 -- (-455.208) (-453.360) [-454.473] (-454.127) * (-452.998) (-453.654) (-454.431) [-455.016] -- 0:00:11
814500 -- [-453.642] (-453.527) (-452.947) (-453.315) * (-454.716) (-455.945) [-457.165] (-457.105) -- 0:00:11
815000 -- (-455.306) (-453.369) [-454.498] (-453.043) * (-454.756) (-460.021) [-453.361] (-455.747) -- 0:00:11
Average standard deviation of split frequencies: 0.006102
815500 -- (-456.170) (-461.281) [-453.423] (-455.116) * (-456.953) (-456.346) (-454.615) [-455.809] -- 0:00:11
816000 -- (-453.396) (-456.974) [-453.497] (-454.792) * (-455.080) (-453.832) [-456.048] (-455.275) -- 0:00:11
816500 -- (-453.603) (-454.068) (-454.210) [-454.516] * (-455.115) (-455.661) [-453.882] (-456.843) -- 0:00:11
817000 -- (-456.638) (-455.351) (-455.855) [-455.432] * (-458.389) (-452.874) [-454.795] (-453.953) -- 0:00:10
817500 -- (-453.801) (-454.664) [-453.432] (-452.703) * [-454.318] (-454.570) (-457.963) (-453.247) -- 0:00:10
818000 -- (-454.469) (-454.354) [-452.871] (-453.165) * (-454.289) (-453.197) [-453.259] (-453.988) -- 0:00:10
818500 -- (-453.637) [-453.744] (-457.415) (-455.068) * (-456.117) [-454.541] (-453.594) (-455.916) -- 0:00:10
819000 -- (-454.006) (-453.993) (-453.965) [-455.857] * (-456.471) (-455.475) [-453.473] (-453.449) -- 0:00:10
819500 -- (-456.072) [-455.499] (-453.690) (-452.648) * [-456.135] (-453.363) (-454.523) (-456.509) -- 0:00:10
820000 -- (-454.865) (-455.251) (-454.394) [-453.313] * (-460.430) (-452.860) (-454.293) [-453.006] -- 0:00:10
Average standard deviation of split frequencies: 0.006031
820500 -- (-455.398) (-456.799) [-456.028] (-454.780) * (-454.274) (-453.784) (-455.149) [-455.073] -- 0:00:10
821000 -- (-453.900) [-459.954] (-455.906) (-453.594) * (-457.009) [-455.790] (-458.934) (-455.791) -- 0:00:10
821500 -- (-455.235) (-455.301) (-455.632) [-452.965] * (-454.971) [-453.461] (-453.555) (-454.251) -- 0:00:10
822000 -- [-453.587] (-457.122) (-456.787) (-455.304) * [-453.343] (-459.026) (-453.607) (-454.414) -- 0:00:10
822500 -- (-453.366) (-455.663) (-454.776) [-454.756] * (-457.777) (-454.726) (-454.937) [-452.707] -- 0:00:10
823000 -- [-455.667] (-456.450) (-454.283) (-456.738) * [-456.362] (-454.591) (-457.490) (-453.975) -- 0:00:10
823500 -- (-453.530) (-454.791) [-455.216] (-453.533) * [-457.558] (-454.135) (-455.122) (-455.757) -- 0:00:10
824000 -- (-453.280) (-458.862) (-454.999) [-455.143] * (-457.799) (-453.994) [-456.309] (-454.301) -- 0:00:10
824500 -- [-453.899] (-457.312) (-457.271) (-455.033) * (-463.985) [-455.792] (-454.939) (-454.925) -- 0:00:10
825000 -- [-454.140] (-457.019) (-454.331) (-455.458) * (-453.914) [-454.021] (-454.574) (-454.564) -- 0:00:10
Average standard deviation of split frequencies: 0.006313
825500 -- (-454.250) [-455.217] (-456.980) (-454.815) * [-455.775] (-452.933) (-453.135) (-454.349) -- 0:00:10
826000 -- (-453.409) (-455.046) [-453.309] (-454.232) * (-454.550) [-454.651] (-452.794) (-453.012) -- 0:00:10
826500 -- (-453.382) (-455.471) [-454.950] (-454.113) * (-455.993) (-453.816) [-455.796] (-457.174) -- 0:00:10
827000 -- [-456.541] (-455.294) (-458.574) (-454.645) * (-453.470) (-453.493) [-454.216] (-453.930) -- 0:00:10
827500 -- (-452.803) (-453.454) [-454.274] (-454.996) * (-455.506) (-457.526) [-457.499] (-458.979) -- 0:00:10
828000 -- (-454.330) (-453.888) (-455.683) [-454.282] * (-453.645) [-453.840] (-456.837) (-454.204) -- 0:00:10
828500 -- (-454.637) (-455.496) (-456.398) [-453.235] * (-453.170) (-457.058) (-456.081) [-455.818] -- 0:00:10
829000 -- (-455.355) (-455.735) [-452.774] (-454.811) * [-453.023] (-454.779) (-454.710) (-455.540) -- 0:00:10
829500 -- (-456.675) [-454.590] (-453.644) (-460.323) * (-453.214) [-454.485] (-456.253) (-455.270) -- 0:00:10
830000 -- [-454.818] (-455.503) (-453.754) (-457.744) * (-453.575) (-455.609) [-454.279] (-454.959) -- 0:00:10
Average standard deviation of split frequencies: 0.006491
830500 -- (-455.845) [-456.461] (-453.745) (-454.387) * (-455.945) [-453.079] (-454.118) (-455.186) -- 0:00:10
831000 -- (-456.945) [-457.924] (-455.486) (-454.409) * (-455.537) (-456.217) [-456.930] (-453.076) -- 0:00:10
831500 -- (-454.626) (-454.078) [-453.254] (-452.898) * (-453.489) [-452.907] (-453.388) (-454.923) -- 0:00:10
832000 -- (-454.149) (-455.301) [-453.262] (-453.407) * (-456.405) (-455.116) [-454.767] (-455.288) -- 0:00:10
832500 -- (-454.304) [-454.058] (-454.929) (-455.236) * (-457.043) (-454.267) [-454.071] (-456.457) -- 0:00:10
833000 -- (-454.984) [-455.206] (-454.943) (-455.099) * (-457.898) [-454.712] (-453.487) (-453.904) -- 0:00:10
833500 -- [-453.514] (-453.801) (-456.436) (-453.988) * (-458.374) (-456.159) [-454.413] (-455.490) -- 0:00:09
834000 -- (-456.679) (-453.472) [-453.500] (-455.944) * (-453.328) (-458.479) [-453.829] (-457.501) -- 0:00:09
834500 -- (-453.501) (-453.258) (-459.358) [-454.242] * [-453.973] (-454.641) (-453.362) (-455.787) -- 0:00:09
835000 -- (-453.305) [-455.695] (-459.105) (-453.474) * (-454.602) (-456.508) (-458.102) [-456.236] -- 0:00:09
Average standard deviation of split frequencies: 0.006344
835500 -- [-455.967] (-455.609) (-455.603) (-457.206) * (-455.262) (-455.292) (-457.290) [-453.364] -- 0:00:09
836000 -- (-456.917) (-454.449) [-458.034] (-453.572) * (-454.591) (-454.129) [-454.714] (-452.824) -- 0:00:09
836500 -- [-456.370] (-452.816) (-455.905) (-453.878) * (-455.305) (-455.583) (-455.951) [-452.780] -- 0:00:09
837000 -- [-454.938] (-453.909) (-457.800) (-454.403) * (-453.079) (-456.992) (-454.246) [-456.125] -- 0:00:09
837500 -- (-455.753) (-458.662) [-454.894] (-454.376) * [-453.191] (-455.031) (-460.759) (-457.076) -- 0:00:09
838000 -- [-453.406] (-455.377) (-455.676) (-458.793) * (-455.738) [-456.005] (-455.105) (-454.145) -- 0:00:09
838500 -- (-454.952) (-455.991) (-454.609) [-456.504] * [-455.215] (-455.976) (-454.059) (-455.455) -- 0:00:09
839000 -- (-454.639) [-454.814] (-453.445) (-458.087) * (-454.256) (-455.731) [-455.502] (-455.605) -- 0:00:09
839500 -- (-461.395) (-454.456) [-454.400] (-453.442) * (-456.289) (-458.179) (-455.743) [-454.746] -- 0:00:09
840000 -- (-459.571) (-456.004) [-461.374] (-453.612) * (-454.545) (-456.165) (-459.070) [-455.709] -- 0:00:09
Average standard deviation of split frequencies: 0.006203
840500 -- (-460.037) (-453.004) [-453.034] (-456.260) * (-455.165) [-454.378] (-458.732) (-456.667) -- 0:00:09
841000 -- (-460.566) (-453.134) [-453.700] (-457.131) * (-456.262) (-456.943) (-458.980) [-455.785] -- 0:00:09
841500 -- (-452.767) (-454.455) (-461.043) [-453.385] * (-457.322) [-453.319] (-453.638) (-452.968) -- 0:00:09
842000 -- (-454.194) (-454.442) (-456.856) [-453.923] * [-453.269] (-456.517) (-456.139) (-452.688) -- 0:00:09
842500 -- (-453.868) (-453.402) (-458.265) [-455.450] * (-453.481) (-456.977) (-454.711) [-454.694] -- 0:00:09
843000 -- (-453.901) [-455.006] (-456.652) (-454.907) * (-454.990) (-455.413) (-454.374) [-454.444] -- 0:00:09
843500 -- (-453.799) [-454.080] (-454.826) (-453.616) * [-453.435] (-454.092) (-454.741) (-456.568) -- 0:00:09
844000 -- (-455.518) (-453.551) (-457.373) [-454.727] * (-454.913) (-456.190) [-454.688] (-456.216) -- 0:00:09
844500 -- (-456.455) (-454.168) [-454.200] (-456.130) * (-457.191) [-454.701] (-456.731) (-454.059) -- 0:00:09
845000 -- [-453.711] (-453.381) (-455.384) (-456.964) * (-457.832) (-453.627) (-454.305) [-453.543] -- 0:00:09
Average standard deviation of split frequencies: 0.006025
845500 -- [-454.798] (-454.336) (-453.749) (-454.004) * (-459.193) (-454.096) (-456.794) [-456.607] -- 0:00:09
846000 -- (-453.601) (-455.341) (-456.609) [-456.894] * [-455.701] (-456.042) (-456.411) (-453.850) -- 0:00:09
846500 -- (-453.473) (-453.043) [-456.722] (-454.160) * (-452.966) (-456.075) [-454.711] (-456.502) -- 0:00:09
847000 -- (-454.294) [-458.341] (-457.019) (-454.138) * (-454.385) [-456.337] (-455.261) (-456.644) -- 0:00:09
847500 -- (-455.211) (-458.258) (-454.709) [-455.053] * (-453.464) [-454.296] (-454.656) (-453.565) -- 0:00:09
848000 -- (-458.035) (-453.104) (-458.216) [-455.063] * (-455.419) [-458.508] (-454.226) (-455.435) -- 0:00:09
848500 -- [-456.490] (-456.266) (-453.919) (-456.356) * (-454.983) (-461.564) [-454.547] (-456.150) -- 0:00:09
849000 -- (-454.027) (-452.643) (-454.568) [-456.760] * (-456.042) (-457.556) (-456.872) [-454.996] -- 0:00:09
849500 -- (-455.153) (-453.012) [-453.890] (-458.209) * (-458.752) (-455.959) (-453.717) [-454.145] -- 0:00:09
850000 -- (-454.681) (-458.874) [-456.027] (-455.173) * (-453.445) [-454.070] (-455.052) (-453.463) -- 0:00:09
Average standard deviation of split frequencies: 0.006096
850500 -- (-454.629) (-454.378) (-456.236) [-455.197] * (-455.186) [-456.582] (-454.414) (-454.307) -- 0:00:08
851000 -- (-456.578) (-457.087) (-454.307) [-455.481] * (-453.792) (-454.470) [-455.335] (-456.796) -- 0:00:08
851500 -- (-455.922) [-454.093] (-457.271) (-453.922) * (-455.288) (-455.438) (-455.349) [-455.850] -- 0:00:08
852000 -- (-453.428) [-454.904] (-455.843) (-455.791) * [-455.067] (-454.424) (-454.555) (-454.225) -- 0:00:08
852500 -- [-452.878] (-454.598) (-458.288) (-456.015) * (-455.004) (-454.487) (-453.443) [-454.857] -- 0:00:08
853000 -- [-453.636] (-454.238) (-454.950) (-454.605) * (-454.427) [-453.287] (-456.957) (-459.975) -- 0:00:08
853500 -- (-453.290) [-454.359] (-456.946) (-454.868) * (-454.371) [-455.571] (-454.987) (-459.054) -- 0:00:08
854000 -- [-456.564] (-453.212) (-455.223) (-454.633) * (-453.987) (-454.178) (-453.876) [-454.479] -- 0:00:08
854500 -- (-456.961) [-454.557] (-457.026) (-454.440) * (-453.129) (-452.891) [-454.917] (-455.354) -- 0:00:08
855000 -- (-453.079) (-453.277) (-457.608) [-455.272] * (-452.760) (-454.723) [-458.144] (-457.824) -- 0:00:08
Average standard deviation of split frequencies: 0.006058
855500 -- (-453.272) (-455.480) [-452.989] (-456.820) * (-456.752) [-455.235] (-458.517) (-455.989) -- 0:00:08
856000 -- [-452.920] (-456.586) (-453.414) (-458.234) * (-455.055) (-455.071) (-455.982) [-456.132] -- 0:00:08
856500 -- [-452.919] (-455.767) (-454.014) (-454.779) * (-454.831) (-453.285) (-452.739) [-455.041] -- 0:00:08
857000 -- (-456.037) (-455.683) (-455.592) [-453.133] * (-454.566) [-454.932] (-454.184) (-454.592) -- 0:00:08
857500 -- (-453.949) [-453.959] (-453.191) (-458.259) * (-452.888) [-455.263] (-454.133) (-455.189) -- 0:00:08
858000 -- (-455.377) [-457.075] (-453.858) (-456.950) * (-456.333) (-454.191) (-459.360) [-453.819] -- 0:00:08
858500 -- (-454.073) [-452.897] (-457.828) (-458.901) * (-453.073) (-454.685) [-453.670] (-455.593) -- 0:00:08
859000 -- [-453.455] (-457.450) (-455.300) (-456.250) * [-452.918] (-455.832) (-455.084) (-455.412) -- 0:00:08
859500 -- (-459.596) [-454.594] (-453.957) (-453.578) * (-453.277) [-453.122] (-457.081) (-454.598) -- 0:00:08
860000 -- (-454.441) [-453.787] (-454.345) (-453.642) * (-454.533) (-454.620) [-452.836] (-453.421) -- 0:00:08
Average standard deviation of split frequencies: 0.006607
860500 -- (-454.993) (-453.829) [-454.587] (-456.088) * (-454.007) (-454.625) (-455.724) [-452.870] -- 0:00:08
861000 -- (-453.876) (-455.488) [-454.510] (-458.636) * (-454.144) (-454.020) (-457.767) [-453.228] -- 0:00:08
861500 -- (-455.853) (-454.725) (-456.337) [-453.808] * (-454.441) (-454.001) (-453.688) [-453.231] -- 0:00:08
862000 -- (-453.715) (-454.759) (-456.000) [-452.389] * (-454.396) [-459.482] (-453.829) (-452.922) -- 0:00:08
862500 -- (-454.886) [-453.546] (-456.545) (-455.942) * (-453.638) (-457.133) (-455.083) [-455.936] -- 0:00:08
863000 -- (-455.731) (-456.110) (-456.413) [-455.028] * (-456.863) [-455.933] (-460.186) (-453.557) -- 0:00:08
863500 -- [-454.363] (-454.190) (-460.041) (-454.388) * (-453.958) [-459.416] (-461.644) (-453.805) -- 0:00:08
864000 -- (-454.132) (-456.236) [-453.310] (-458.275) * (-457.887) (-456.403) [-457.121] (-453.276) -- 0:00:08
864500 -- (-457.017) [-453.270] (-453.101) (-456.534) * (-454.774) (-456.090) (-455.485) [-453.933] -- 0:00:08
865000 -- (-455.920) [-453.297] (-455.553) (-454.818) * (-452.860) (-456.783) [-453.693] (-453.931) -- 0:00:08
Average standard deviation of split frequencies: 0.006260
865500 -- [-455.137] (-453.682) (-454.424) (-457.212) * [-453.834] (-454.641) (-458.036) (-455.870) -- 0:00:08
866000 -- (-454.465) [-457.618] (-457.396) (-453.977) * [-454.136] (-454.991) (-454.721) (-455.995) -- 0:00:08
866500 -- (-456.023) (-461.336) (-453.864) [-453.459] * (-455.663) [-454.429] (-453.208) (-458.652) -- 0:00:08
867000 -- (-454.355) (-457.050) (-455.288) [-454.313] * (-455.086) (-455.253) [-454.644] (-454.647) -- 0:00:07
867500 -- [-453.749] (-459.488) (-455.138) (-452.758) * (-456.047) (-453.110) [-454.452] (-457.248) -- 0:00:07
868000 -- (-459.699) (-454.177) [-454.837] (-454.929) * (-454.810) (-454.086) [-453.233] (-457.644) -- 0:00:07
868500 -- (-454.486) [-454.510] (-453.495) (-456.314) * (-456.009) (-455.693) [-455.853] (-456.006) -- 0:00:07
869000 -- (-454.063) (-453.523) [-453.305] (-453.340) * [-453.729] (-457.339) (-454.866) (-454.795) -- 0:00:07
869500 -- (-454.822) [-453.645] (-453.738) (-454.962) * (-457.301) (-453.127) (-455.697) [-452.585] -- 0:00:07
870000 -- (-454.163) (-454.326) (-452.725) [-453.460] * (-455.861) [-454.893] (-458.363) (-456.856) -- 0:00:07
Average standard deviation of split frequencies: 0.006193
870500 -- [-454.323] (-454.950) (-453.587) (-457.003) * (-455.969) (-457.220) (-454.525) [-456.709] -- 0:00:07
871000 -- (-455.928) [-457.543] (-455.461) (-454.298) * (-459.878) [-455.973] (-453.437) (-454.930) -- 0:00:07
871500 -- (-456.098) (-458.188) (-453.482) [-460.516] * (-454.222) [-455.359] (-456.824) (-456.039) -- 0:00:07
872000 -- (-456.928) [-455.736] (-453.314) (-460.705) * (-454.825) [-456.775] (-453.287) (-453.675) -- 0:00:07
872500 -- (-455.255) (-455.595) [-453.701] (-455.658) * [-453.894] (-456.842) (-454.015) (-455.142) -- 0:00:07
873000 -- (-455.838) (-453.833) [-454.464] (-454.118) * (-453.766) [-455.714] (-453.560) (-456.315) -- 0:00:07
873500 -- (-453.236) (-457.119) (-456.830) [-452.916] * (-453.437) (-455.867) (-453.207) [-455.144] -- 0:00:07
874000 -- (-455.526) (-457.273) (-454.270) [-453.058] * (-454.112) (-455.677) [-454.414] (-454.127) -- 0:00:07
874500 -- (-459.975) (-459.311) [-455.502] (-453.494) * (-454.285) [-453.820] (-454.852) (-454.893) -- 0:00:07
875000 -- [-455.555] (-457.536) (-455.753) (-454.500) * [-453.001] (-454.504) (-453.229) (-453.173) -- 0:00:07
Average standard deviation of split frequencies: 0.005987
875500 -- [-459.322] (-455.248) (-456.366) (-454.340) * (-455.184) [-454.233] (-457.935) (-459.436) -- 0:00:07
876000 -- (-455.760) (-454.639) (-455.441) [-454.998] * [-455.693] (-453.932) (-456.575) (-465.332) -- 0:00:07
876500 -- (-452.955) (-454.016) (-454.439) [-454.889] * (-454.390) (-454.549) (-454.702) [-456.589] -- 0:00:07
877000 -- [-454.300] (-455.101) (-456.067) (-454.626) * (-454.258) (-453.764) [-456.004] (-456.927) -- 0:00:07
877500 -- (-457.653) (-454.608) [-453.655] (-454.447) * (-453.545) [-457.723] (-454.784) (-460.424) -- 0:00:07
878000 -- (-454.946) [-456.358] (-454.014) (-455.510) * [-456.274] (-455.063) (-455.934) (-458.144) -- 0:00:07
878500 -- (-454.976) (-455.774) [-453.454] (-454.330) * (-457.400) (-454.770) (-454.167) [-453.063] -- 0:00:07
879000 -- [-454.998] (-456.088) (-456.858) (-453.949) * (-457.903) [-452.748] (-454.828) (-454.019) -- 0:00:07
879500 -- (-454.506) (-456.781) [-454.196] (-458.078) * (-458.040) (-453.537) [-456.877] (-456.034) -- 0:00:07
880000 -- [-453.031] (-453.367) (-453.609) (-456.989) * (-455.895) (-455.100) [-456.041] (-456.032) -- 0:00:07
Average standard deviation of split frequencies: 0.005988
880500 -- (-453.022) [-452.670] (-453.097) (-458.433) * (-456.660) [-453.735] (-454.335) (-454.600) -- 0:00:07
881000 -- (-457.075) (-454.819) [-452.908] (-455.614) * (-454.274) (-453.723) (-456.084) [-458.677] -- 0:00:07
881500 -- (-455.836) [-456.727] (-454.809) (-457.477) * [-456.036] (-456.142) (-454.988) (-457.273) -- 0:00:07
882000 -- [-456.163] (-455.220) (-454.191) (-459.445) * (-456.310) (-455.435) (-454.299) [-457.570] -- 0:00:07
882500 -- [-453.554] (-454.199) (-461.496) (-458.819) * [-456.166] (-455.143) (-457.085) (-455.162) -- 0:00:07
883000 -- (-456.946) [-453.662] (-454.936) (-461.541) * (-454.048) (-455.611) (-455.888) [-454.904] -- 0:00:07
883500 -- (-456.510) (-457.062) (-455.308) [-455.230] * [-455.808] (-456.269) (-453.939) (-454.872) -- 0:00:06
884000 -- [-456.116] (-455.658) (-455.506) (-453.402) * (-454.906) (-456.507) (-464.956) [-455.248] -- 0:00:06
884500 -- (-458.104) (-455.916) (-453.406) [-456.662] * (-454.270) (-459.346) [-453.998] (-454.930) -- 0:00:06
885000 -- (-455.377) (-453.001) [-454.544] (-454.012) * (-462.001) (-457.330) [-454.841] (-456.049) -- 0:00:06
Average standard deviation of split frequencies: 0.005853
885500 -- (-454.468) (-452.479) (-456.805) [-452.866] * [-459.571] (-453.859) (-454.506) (-455.544) -- 0:00:06
886000 -- [-454.358] (-458.736) (-457.945) (-454.128) * (-456.445) (-454.198) [-454.829] (-455.386) -- 0:00:06
886500 -- [-454.221] (-456.957) (-454.115) (-453.360) * (-456.207) (-454.427) (-453.486) [-458.037] -- 0:00:06
887000 -- [-453.890] (-455.927) (-453.365) (-455.871) * [-454.470] (-452.986) (-454.183) (-455.273) -- 0:00:06
887500 -- [-454.087] (-456.623) (-454.804) (-456.748) * [-454.866] (-456.418) (-454.461) (-453.790) -- 0:00:06
888000 -- [-455.483] (-454.121) (-456.154) (-454.070) * [-454.425] (-456.592) (-458.658) (-453.868) -- 0:00:06
888500 -- (-457.098) (-454.134) [-453.815] (-453.661) * (-454.459) [-455.606] (-454.020) (-455.013) -- 0:00:06
889000 -- (-457.903) (-453.946) (-453.931) [-452.934] * [-453.472] (-456.718) (-453.536) (-454.012) -- 0:00:06
889500 -- (-456.881) (-455.936) (-456.765) [-452.764] * (-453.509) (-456.167) [-453.915] (-455.748) -- 0:00:06
890000 -- (-453.376) [-454.151] (-455.557) (-456.889) * (-454.241) (-460.150) (-460.676) [-454.994] -- 0:00:06
Average standard deviation of split frequencies: 0.005756
890500 -- (-452.926) [-453.225] (-455.819) (-454.871) * (-453.419) (-457.788) (-456.718) [-456.083] -- 0:00:06
891000 -- [-452.889] (-453.925) (-455.719) (-453.728) * (-453.436) [-454.697] (-457.052) (-453.678) -- 0:00:06
891500 -- (-455.171) [-455.236] (-453.482) (-454.860) * (-454.120) (-456.911) [-456.974] (-455.645) -- 0:00:06
892000 -- (-453.384) [-454.226] (-458.792) (-456.372) * (-452.948) [-454.082] (-457.584) (-456.621) -- 0:00:06
892500 -- (-459.256) [-453.315] (-454.091) (-454.218) * [-453.196] (-453.110) (-457.856) (-455.156) -- 0:00:06
893000 -- (-454.844) (-454.719) (-454.834) [-454.033] * [-456.090] (-454.687) (-457.865) (-455.333) -- 0:00:06
893500 -- (-453.851) (-454.980) [-456.155] (-453.433) * (-455.278) [-454.054] (-454.072) (-453.620) -- 0:00:06
894000 -- [-457.037] (-455.669) (-453.730) (-452.861) * (-454.854) (-457.192) (-456.225) [-460.867] -- 0:00:06
894500 -- (-454.731) (-458.200) [-455.405] (-455.832) * (-456.313) (-457.087) (-459.760) [-453.731] -- 0:00:06
895000 -- (-455.250) (-454.827) [-452.862] (-453.835) * (-455.620) (-454.309) [-454.140] (-453.278) -- 0:00:06
Average standard deviation of split frequencies: 0.006215
895500 -- (-453.987) [-455.724] (-454.434) (-455.163) * (-453.521) (-454.688) (-456.608) [-453.584] -- 0:00:06
896000 -- [-458.410] (-454.060) (-455.256) (-454.519) * (-457.887) (-453.966) [-455.312] (-460.078) -- 0:00:06
896500 -- (-457.785) (-454.631) (-455.688) [-453.074] * [-456.411] (-456.840) (-456.547) (-458.224) -- 0:00:06
897000 -- (-459.645) (-453.435) (-455.369) [-455.265] * (-457.507) (-455.270) (-456.254) [-456.871] -- 0:00:06
897500 -- (-457.360) (-456.373) [-456.590] (-456.409) * (-456.506) (-456.578) [-453.894] (-454.583) -- 0:00:06
898000 -- (-457.726) (-454.828) (-453.004) [-453.550] * (-454.403) (-455.799) (-453.961) [-455.129] -- 0:00:06
898500 -- (-456.510) [-454.972] (-453.508) (-453.380) * (-454.391) (-457.730) [-453.370] (-455.553) -- 0:00:06
899000 -- (-455.239) (-453.246) (-453.901) [-454.492] * [-453.676] (-456.737) (-455.778) (-453.895) -- 0:00:06
899500 -- (-455.100) (-454.003) (-455.412) [-456.851] * (-454.233) (-456.600) (-454.325) [-454.254] -- 0:00:06
900000 -- (-453.995) (-458.257) (-453.829) [-453.608] * (-454.805) (-457.028) (-455.038) [-452.990] -- 0:00:06
Average standard deviation of split frequencies: 0.006084
900500 -- (-455.395) (-454.115) (-453.953) [-453.454] * (-453.614) (-457.103) (-454.108) [-453.692] -- 0:00:05
901000 -- (-459.751) [-454.701] (-457.799) (-455.619) * (-453.792) (-455.921) (-454.723) [-453.420] -- 0:00:05
901500 -- [-455.232] (-456.007) (-456.162) (-455.438) * [-454.073] (-455.280) (-456.865) (-456.115) -- 0:00:05
902000 -- (-459.400) (-457.510) [-454.532] (-455.194) * (-454.269) (-457.021) (-455.339) [-458.936] -- 0:00:05
902500 -- (-454.963) (-454.853) (-454.001) [-455.189] * (-453.300) [-453.001] (-454.536) (-454.792) -- 0:00:05
903000 -- [-458.686] (-457.049) (-453.906) (-454.417) * (-455.445) (-453.273) [-455.853] (-454.050) -- 0:00:05
903500 -- (-454.442) (-454.159) [-454.202] (-456.159) * (-454.994) [-456.598] (-454.480) (-453.669) -- 0:00:05
904000 -- (-455.171) (-455.185) [-454.560] (-453.969) * (-456.086) [-453.696] (-457.985) (-455.231) -- 0:00:05
904500 -- (-456.705) (-456.595) (-458.853) [-452.796] * (-458.384) (-454.822) [-460.417] (-455.918) -- 0:00:05
905000 -- (-454.380) [-456.055] (-456.943) (-453.216) * (-457.533) [-456.778] (-456.276) (-456.567) -- 0:00:05
Average standard deviation of split frequencies: 0.006114
905500 -- (-456.831) (-462.581) [-460.095] (-457.310) * [-453.358] (-457.307) (-459.072) (-457.729) -- 0:00:05
906000 -- [-455.546] (-453.251) (-453.552) (-452.850) * (-454.463) (-459.760) [-454.055] (-456.164) -- 0:00:05
906500 -- (-455.242) (-453.523) (-456.855) [-455.006] * (-454.234) (-455.886) (-454.474) [-455.347] -- 0:00:05
907000 -- (-456.367) [-456.615] (-455.290) (-457.371) * (-455.692) [-454.158] (-455.425) (-457.156) -- 0:00:05
907500 -- (-455.517) [-452.895] (-455.100) (-454.013) * (-455.526) (-453.361) [-455.994] (-456.575) -- 0:00:05
908000 -- (-455.985) (-457.195) [-455.919] (-454.741) * (-453.860) (-454.768) (-456.498) [-454.059] -- 0:00:05
908500 -- (-455.322) (-453.704) [-455.022] (-453.106) * (-457.172) [-454.285] (-455.983) (-455.060) -- 0:00:05
909000 -- [-453.968] (-457.191) (-457.010) (-456.899) * [-455.785] (-454.442) (-452.903) (-457.051) -- 0:00:05
909500 -- (-453.920) (-454.235) [-457.010] (-455.856) * (-456.834) (-454.254) [-454.240] (-454.851) -- 0:00:05
910000 -- (-452.750) (-456.965) [-454.662] (-456.346) * (-454.972) (-457.321) [-453.894] (-455.362) -- 0:00:05
Average standard deviation of split frequencies: 0.006018
910500 -- [-452.730] (-453.016) (-454.589) (-462.089) * [-455.522] (-457.787) (-454.092) (-457.265) -- 0:00:05
911000 -- (-455.104) (-454.862) (-457.868) [-459.790] * [-453.615] (-455.158) (-454.818) (-462.119) -- 0:00:05
911500 -- (-453.454) (-455.809) [-455.919] (-454.088) * [-454.832] (-452.924) (-453.787) (-458.144) -- 0:00:05
912000 -- [-454.904] (-455.743) (-458.427) (-454.523) * (-457.279) [-453.297] (-455.022) (-454.750) -- 0:00:05
912500 -- (-455.213) (-461.627) (-458.854) [-454.660] * (-457.040) (-454.272) [-456.877] (-460.604) -- 0:00:05
913000 -- (-456.726) (-454.816) [-453.644] (-454.615) * [-456.419] (-455.863) (-456.035) (-455.791) -- 0:00:05
913500 -- (-456.780) (-453.316) (-454.525) [-454.044] * (-454.399) (-453.216) [-454.093] (-453.918) -- 0:00:05
914000 -- (-455.134) [-453.316] (-453.201) (-453.523) * (-454.366) (-452.946) [-454.144] (-454.440) -- 0:00:05
914500 -- (-453.153) (-453.606) [-453.310] (-453.880) * [-454.976] (-456.281) (-456.635) (-456.291) -- 0:00:05
915000 -- (-454.389) [-453.798] (-454.067) (-456.591) * (-455.056) [-454.345] (-454.471) (-455.289) -- 0:00:05
Average standard deviation of split frequencies: 0.005725
915500 -- [-453.466] (-456.400) (-459.884) (-452.996) * (-458.009) (-456.180) [-454.594] (-455.560) -- 0:00:05
916000 -- (-452.819) (-453.495) [-458.619] (-458.201) * (-455.369) (-455.712) (-455.239) [-455.675] -- 0:00:05
916500 -- [-457.205] (-461.223) (-455.448) (-456.812) * (-453.319) [-454.939] (-455.749) (-454.854) -- 0:00:05
917000 -- (-452.622) [-454.674] (-455.361) (-461.254) * [-454.107] (-463.115) (-454.115) (-454.909) -- 0:00:04
917500 -- [-455.880] (-456.142) (-454.086) (-457.571) * (-459.015) (-456.162) [-456.232] (-455.248) -- 0:00:04
918000 -- (-453.124) (-454.936) (-454.008) [-454.643] * (-457.431) (-462.375) (-453.835) [-454.047] -- 0:00:04
918500 -- [-455.089] (-453.314) (-455.615) (-456.124) * (-455.468) (-454.087) (-454.777) [-454.809] -- 0:00:04
919000 -- (-454.135) [-455.004] (-458.904) (-459.537) * (-456.597) (-454.650) (-455.227) [-454.060] -- 0:00:04
919500 -- (-452.934) [-453.602] (-456.614) (-460.412) * (-454.514) (-456.772) (-453.502) [-453.170] -- 0:00:04
920000 -- (-455.160) [-453.820] (-459.132) (-457.705) * (-454.145) (-456.978) (-453.752) [-453.838] -- 0:00:04
Average standard deviation of split frequencies: 0.005856
920500 -- [-456.249] (-453.370) (-455.570) (-453.079) * (-453.990) (-458.242) [-453.934] (-455.615) -- 0:00:04
921000 -- (-454.280) [-454.158] (-456.125) (-455.614) * [-460.016] (-454.326) (-456.159) (-456.869) -- 0:00:04
921500 -- [-454.253] (-455.216) (-455.470) (-456.972) * (-454.456) [-456.199] (-453.357) (-456.787) -- 0:00:04
922000 -- [-453.419] (-461.046) (-459.838) (-456.301) * (-457.712) [-453.458] (-455.943) (-456.177) -- 0:00:04
922500 -- (-453.528) (-453.465) (-455.349) [-456.196] * [-455.552] (-455.810) (-457.302) (-453.796) -- 0:00:04
923000 -- (-455.660) (-454.082) (-456.433) [-455.896] * (-457.945) (-455.159) [-453.926] (-453.154) -- 0:00:04
923500 -- (-453.027) [-454.687] (-453.984) (-456.269) * (-453.024) (-453.662) [-453.524] (-453.131) -- 0:00:04
924000 -- [-452.665] (-455.330) (-453.352) (-456.988) * (-452.794) [-455.601] (-453.675) (-453.131) -- 0:00:04
924500 -- (-453.621) [-454.415] (-453.660) (-455.284) * (-453.952) [-455.091] (-454.107) (-454.549) -- 0:00:04
925000 -- [-453.682] (-453.279) (-456.165) (-456.230) * (-455.327) (-455.041) (-454.454) [-455.265] -- 0:00:04
Average standard deviation of split frequencies: 0.005918
925500 -- [-454.294] (-452.955) (-458.611) (-454.594) * [-453.740] (-454.073) (-455.523) (-455.957) -- 0:00:04
926000 -- (-457.137) (-457.220) [-458.260] (-456.433) * (-453.020) [-456.104] (-453.974) (-455.678) -- 0:00:04
926500 -- [-456.393] (-453.656) (-458.509) (-453.869) * (-454.098) (-453.834) (-453.959) [-454.934] -- 0:00:04
927000 -- (-455.073) (-453.790) [-455.276] (-453.267) * (-452.705) (-453.797) (-457.607) [-455.839] -- 0:00:04
927500 -- [-455.748] (-455.629) (-454.490) (-452.668) * (-458.571) (-458.044) [-454.577] (-452.969) -- 0:00:04
928000 -- [-454.272] (-453.607) (-457.765) (-454.464) * (-455.245) (-454.729) (-456.172) [-453.338] -- 0:00:04
928500 -- (-453.907) (-452.741) [-453.489] (-456.772) * [-452.783] (-453.366) (-454.701) (-453.409) -- 0:00:04
929000 -- [-455.891] (-458.172) (-457.520) (-458.111) * [-457.324] (-458.166) (-454.267) (-452.999) -- 0:00:04
929500 -- (-455.192) [-454.098] (-455.452) (-456.914) * (-454.446) (-456.478) (-453.873) [-454.955] -- 0:00:04
930000 -- [-454.928] (-456.060) (-454.004) (-455.308) * [-456.686] (-453.789) (-453.534) (-457.610) -- 0:00:04
Average standard deviation of split frequencies: 0.005730
930500 -- (-454.257) (-453.067) (-455.817) [-454.279] * (-456.691) (-455.878) [-453.292] (-456.912) -- 0:00:04
931000 -- (-454.040) [-456.777] (-453.795) (-453.697) * (-457.577) [-456.603] (-453.354) (-456.705) -- 0:00:04
931500 -- [-454.131] (-460.392) (-456.712) (-453.686) * (-455.895) (-455.846) [-454.268] (-456.490) -- 0:00:04
932000 -- (-455.347) (-453.680) (-456.781) [-454.823] * [-453.110] (-455.236) (-455.374) (-454.779) -- 0:00:04
932500 -- (-455.376) (-455.260) [-454.760] (-457.244) * (-453.936) (-454.890) (-455.697) [-456.826] -- 0:00:04
933000 -- (-453.737) (-455.166) (-454.278) [-455.450] * (-456.667) (-457.281) [-454.892] (-454.831) -- 0:00:04
933500 -- (-455.474) (-454.844) [-454.640] (-453.109) * (-458.048) (-454.516) [-453.534] (-458.429) -- 0:00:03
934000 -- (-453.095) [-457.162] (-457.485) (-454.026) * (-454.875) [-454.765] (-456.289) (-458.317) -- 0:00:03
934500 -- (-453.060) [-459.353] (-453.647) (-453.161) * (-454.200) (-453.373) [-452.703] (-457.111) -- 0:00:03
935000 -- (-454.236) (-454.639) (-453.727) [-454.246] * [-455.556] (-454.860) (-455.672) (-454.429) -- 0:00:03
Average standard deviation of split frequencies: 0.005603
935500 -- (-455.957) (-459.881) [-453.313] (-455.887) * (-458.017) (-453.546) [-455.919] (-457.169) -- 0:00:03
936000 -- [-453.743] (-456.511) (-455.092) (-454.687) * (-455.199) [-454.174] (-460.226) (-454.578) -- 0:00:03
936500 -- [-455.470] (-455.058) (-458.875) (-455.328) * (-456.136) (-454.712) [-453.349] (-456.418) -- 0:00:03
937000 -- [-452.812] (-456.245) (-453.666) (-455.288) * (-454.396) [-456.578] (-454.763) (-453.745) -- 0:00:03
937500 -- (-452.956) (-456.606) (-454.045) [-455.505] * (-457.441) [-454.446] (-455.350) (-452.742) -- 0:00:03
938000 -- [-453.299] (-452.575) (-452.790) (-455.854) * (-455.304) (-455.759) [-457.463] (-453.118) -- 0:00:03
938500 -- (-458.016) (-453.930) [-453.700] (-454.526) * (-457.252) [-459.189] (-456.387) (-453.363) -- 0:00:03
939000 -- (-462.598) (-452.631) [-455.369] (-455.810) * [-456.480] (-462.279) (-454.516) (-454.810) -- 0:00:03
939500 -- [-457.298] (-452.729) (-455.125) (-453.551) * (-454.417) [-454.042] (-454.980) (-456.661) -- 0:00:03
940000 -- (-454.247) [-453.506] (-456.690) (-453.873) * [-455.811] (-453.499) (-454.455) (-455.841) -- 0:00:03
Average standard deviation of split frequencies: 0.005481
940500 -- (-453.412) [-458.618] (-454.728) (-454.536) * [-454.560] (-454.654) (-453.939) (-454.044) -- 0:00:03
941000 -- (-453.385) (-457.153) [-456.535] (-453.953) * (-456.113) [-453.354] (-456.223) (-455.703) -- 0:00:03
941500 -- (-455.053) [-453.071] (-454.602) (-453.243) * (-456.690) [-454.164] (-458.976) (-454.565) -- 0:00:03
942000 -- [-453.992] (-453.391) (-454.913) (-454.783) * (-456.866) [-455.644] (-454.773) (-453.857) -- 0:00:03
942500 -- (-454.294) (-457.965) [-455.744] (-455.945) * (-453.729) (-456.572) [-455.798] (-455.353) -- 0:00:03
943000 -- (-455.620) (-454.163) (-454.579) [-456.320] * (-453.957) (-453.827) [-454.782] (-457.233) -- 0:00:03
943500 -- (-456.438) [-455.283] (-456.083) (-453.914) * [-453.665] (-456.133) (-456.646) (-455.195) -- 0:00:03
944000 -- (-453.127) [-454.891] (-455.258) (-455.925) * [-453.362] (-456.526) (-452.884) (-454.636) -- 0:00:03
944500 -- [-453.988] (-454.216) (-455.512) (-460.821) * (-454.854) [-455.585] (-453.387) (-455.081) -- 0:00:03
945000 -- (-455.188) (-453.377) (-455.684) [-454.248] * (-455.643) (-454.348) [-452.975] (-456.112) -- 0:00:03
Average standard deviation of split frequencies: 0.005544
945500 -- (-454.970) [-453.397] (-453.583) (-454.545) * (-454.029) (-457.315) (-453.904) [-457.780] -- 0:00:03
946000 -- (-453.745) (-457.360) [-452.898] (-453.965) * (-454.331) [-458.573] (-454.011) (-459.309) -- 0:00:03
946500 -- (-453.639) (-454.855) [-453.672] (-455.795) * [-455.216] (-455.431) (-453.277) (-455.825) -- 0:00:03
947000 -- (-455.550) [-456.937] (-454.597) (-456.184) * (-454.349) [-454.829] (-454.829) (-455.746) -- 0:00:03
947500 -- (-458.033) [-454.000] (-453.926) (-454.932) * (-454.282) (-458.439) (-454.169) [-454.592] -- 0:00:03
948000 -- [-454.615] (-454.545) (-453.737) (-454.213) * [-453.971] (-453.174) (-459.914) (-453.900) -- 0:00:03
948500 -- (-454.009) [-456.391] (-455.180) (-455.378) * (-452.981) [-458.773] (-453.083) (-453.900) -- 0:00:03
949000 -- [-456.821] (-454.097) (-453.925) (-457.737) * (-453.447) (-456.106) (-455.836) [-453.269] -- 0:00:03
949500 -- [-453.927] (-454.274) (-454.696) (-454.371) * [-456.237] (-458.671) (-455.582) (-459.495) -- 0:00:03
950000 -- [-453.161] (-459.067) (-460.277) (-455.082) * (-459.399) (-456.286) (-456.570) [-454.610] -- 0:00:03
Average standard deviation of split frequencies: 0.005207
950500 -- (-454.437) (-454.867) (-454.920) [-455.044] * (-455.437) [-453.209] (-454.403) (-468.177) -- 0:00:02
951000 -- (-454.853) (-454.236) [-453.623] (-454.653) * (-454.693) (-454.653) (-455.776) [-454.483] -- 0:00:02
951500 -- (-454.123) [-453.403] (-457.208) (-455.367) * [-454.808] (-456.655) (-456.804) (-454.149) -- 0:00:02
952000 -- (-453.054) [-453.587] (-458.903) (-453.265) * (-457.535) (-456.898) (-453.815) [-454.020] -- 0:00:02
952500 -- (-453.305) [-455.121] (-456.096) (-453.619) * (-454.126) (-456.310) (-453.971) [-454.990] -- 0:00:02
953000 -- [-453.382] (-454.923) (-455.780) (-455.535) * (-454.371) (-455.161) [-455.678] (-457.486) -- 0:00:02
953500 -- (-453.611) [-454.048] (-457.869) (-452.515) * [-453.552] (-456.198) (-457.884) (-460.066) -- 0:00:02
954000 -- [-453.399] (-459.498) (-454.122) (-456.108) * (-454.688) [-456.128] (-456.069) (-457.010) -- 0:00:02
954500 -- [-456.698] (-455.661) (-454.418) (-453.829) * (-455.685) (-458.610) [-455.812] (-453.571) -- 0:00:02
955000 -- (-455.117) (-455.281) [-453.609] (-455.442) * (-452.998) [-456.001] (-454.572) (-454.431) -- 0:00:02
Average standard deviation of split frequencies: 0.005486
955500 -- [-453.615] (-458.547) (-454.717) (-453.921) * [-453.310] (-456.714) (-456.472) (-453.496) -- 0:00:02
956000 -- (-453.352) (-454.471) (-455.620) [-453.428] * (-455.388) (-453.453) (-458.990) [-454.162] -- 0:00:02
956500 -- (-453.979) (-454.426) (-454.240) [-453.438] * (-453.804) (-453.409) (-457.600) [-459.175] -- 0:00:02
957000 -- (-454.714) (-456.844) (-455.640) [-456.779] * (-456.936) (-454.378) (-461.939) [-454.140] -- 0:00:02
957500 -- (-452.790) (-456.516) [-454.201] (-459.083) * (-454.852) [-456.601] (-457.928) (-456.285) -- 0:00:02
958000 -- (-454.521) (-457.549) (-457.341) [-454.518] * (-454.148) [-456.233] (-454.661) (-456.160) -- 0:00:02
958500 -- [-454.692] (-456.484) (-464.158) (-455.300) * (-452.644) [-455.209] (-455.075) (-455.912) -- 0:00:02
959000 -- (-454.204) (-457.156) (-458.640) [-458.991] * (-456.955) (-456.876) (-453.802) [-454.298] -- 0:00:02
959500 -- (-458.926) [-455.728] (-461.348) (-454.915) * (-455.206) [-455.016] (-455.720) (-454.113) -- 0:00:02
960000 -- (-453.103) [-453.961] (-456.794) (-456.886) * [-455.951] (-454.848) (-452.528) (-455.502) -- 0:00:02
Average standard deviation of split frequencies: 0.005244
960500 -- (-458.371) [-453.911] (-454.085) (-457.814) * (-454.342) (-455.603) (-452.927) [-456.247] -- 0:00:02
961000 -- (-453.993) (-452.828) [-452.611] (-454.846) * (-458.577) (-457.858) [-452.741] (-462.321) -- 0:00:02
961500 -- (-457.124) [-453.986] (-455.670) (-455.815) * (-453.954) [-454.917] (-453.565) (-454.586) -- 0:00:02
962000 -- [-454.786] (-454.018) (-457.433) (-455.199) * (-454.361) [-454.589] (-455.997) (-454.279) -- 0:00:02
962500 -- [-457.314] (-453.714) (-456.363) (-456.286) * [-455.144] (-458.178) (-455.499) (-455.741) -- 0:00:02
963000 -- [-454.726] (-453.758) (-453.477) (-453.520) * (-455.718) (-458.251) (-455.532) [-457.045] -- 0:00:02
963500 -- (-455.953) (-456.540) [-453.776] (-452.718) * (-455.329) (-454.398) (-454.273) [-454.899] -- 0:00:02
964000 -- (-457.574) (-456.130) (-457.500) [-453.060] * (-456.190) (-457.635) [-453.440] (-456.730) -- 0:00:02
964500 -- [-453.414] (-456.591) (-458.379) (-452.705) * (-460.764) [-455.045] (-458.326) (-454.364) -- 0:00:02
965000 -- (-453.710) (-452.987) (-454.493) [-455.194] * (-455.708) [-455.695] (-458.939) (-455.544) -- 0:00:02
Average standard deviation of split frequencies: 0.005276
965500 -- (-454.181) [-452.821] (-454.369) (-456.022) * [-455.090] (-455.512) (-457.234) (-459.021) -- 0:00:02
966000 -- (-454.304) (-454.047) (-455.713) [-454.934] * (-452.859) (-453.166) (-455.798) [-461.376] -- 0:00:02
966500 -- (-456.640) [-455.265] (-454.880) (-456.612) * (-453.108) (-455.041) (-457.363) [-454.778] -- 0:00:02
967000 -- [-453.467] (-456.201) (-454.066) (-457.171) * [-453.762] (-455.104) (-453.052) (-454.779) -- 0:00:01
967500 -- (-456.355) (-455.407) [-452.997] (-454.359) * (-454.785) (-456.313) (-452.954) [-453.795] -- 0:00:01
968000 -- (-452.769) [-455.399] (-455.020) (-457.122) * [-456.636] (-454.463) (-461.464) (-453.815) -- 0:00:01
968500 -- (-453.220) [-455.639] (-454.548) (-453.286) * (-453.092) (-454.462) (-459.688) [-452.989] -- 0:00:01
969000 -- (-456.019) (-458.071) (-453.532) [-453.870] * [-453.747] (-454.580) (-458.424) (-454.172) -- 0:00:01
969500 -- (-456.300) (-458.139) (-453.982) [-453.895] * [-452.838] (-455.538) (-454.404) (-453.736) -- 0:00:01
970000 -- (-453.260) (-455.930) (-455.313) [-454.499] * (-455.257) [-453.743] (-459.290) (-454.577) -- 0:00:01
Average standard deviation of split frequencies: 0.004999
970500 -- (-455.611) [-460.826] (-454.681) (-456.935) * (-454.646) (-454.110) (-453.975) [-453.909] -- 0:00:01
971000 -- [-455.888] (-454.955) (-454.672) (-457.067) * (-455.128) (-453.146) (-458.414) [-457.269] -- 0:00:01
971500 -- [-454.907] (-454.959) (-453.484) (-457.825) * [-454.095] (-454.507) (-456.390) (-458.615) -- 0:00:01
972000 -- [-455.258] (-459.874) (-453.549) (-457.354) * [-456.294] (-454.273) (-453.432) (-455.771) -- 0:00:01
972500 -- (-455.105) (-458.964) [-455.368] (-454.967) * (-455.583) (-453.133) (-453.004) [-454.961] -- 0:00:01
973000 -- (-456.298) (-454.503) (-458.218) [-454.157] * (-455.048) (-455.135) (-453.452) [-455.386] -- 0:00:01
973500 -- (-459.097) (-454.270) (-462.042) [-458.155] * (-454.225) (-455.474) [-453.674] (-454.387) -- 0:00:01
974000 -- (-455.213) (-453.651) [-457.796] (-456.235) * (-459.985) [-453.916] (-453.878) (-454.908) -- 0:00:01
974500 -- [-453.288] (-453.348) (-456.212) (-453.348) * (-455.641) [-455.362] (-454.291) (-457.549) -- 0:00:01
975000 -- (-453.298) (-452.940) (-455.432) [-453.742] * (-457.039) [-454.106] (-456.605) (-455.040) -- 0:00:01
Average standard deviation of split frequencies: 0.004887
975500 -- [-455.215] (-452.973) (-456.992) (-454.355) * (-463.584) (-452.760) (-459.416) [-454.986] -- 0:00:01
976000 -- (-455.851) (-453.170) [-454.687] (-456.705) * (-456.924) (-452.781) [-462.704] (-454.135) -- 0:00:01
976500 -- [-455.576] (-455.341) (-453.179) (-453.374) * [-455.247] (-455.642) (-454.674) (-454.349) -- 0:00:01
977000 -- [-455.995] (-454.695) (-453.983) (-453.276) * (-454.145) (-456.600) (-453.372) [-455.490] -- 0:00:01
977500 -- (-456.742) [-454.402] (-454.531) (-453.178) * (-453.641) [-453.872] (-460.288) (-454.434) -- 0:00:01
978000 -- (-452.834) (-454.498) (-457.723) [-454.096] * [-454.391] (-454.994) (-458.043) (-454.870) -- 0:00:01
978500 -- (-455.737) (-456.608) (-457.158) [-456.512] * (-453.729) [-458.145] (-453.703) (-455.513) -- 0:00:01
979000 -- (-454.412) (-453.682) [-457.301] (-453.855) * (-454.956) (-458.445) [-454.375] (-456.138) -- 0:00:01
979500 -- (-455.397) (-454.553) (-457.246) [-455.282] * [-455.850] (-457.520) (-453.484) (-454.168) -- 0:00:01
980000 -- (-454.189) (-456.822) [-455.990] (-454.183) * (-453.208) (-455.232) [-453.419] (-453.659) -- 0:00:01
Average standard deviation of split frequencies: 0.005168
980500 -- (-453.030) (-453.835) (-456.604) [-454.931] * (-453.467) (-455.635) (-453.254) [-456.339] -- 0:00:01
981000 -- (-457.458) (-454.585) (-456.414) [-456.047] * [-455.293] (-454.332) (-455.934) (-453.222) -- 0:00:01
981500 -- (-454.450) (-455.167) [-455.449] (-454.550) * [-454.798] (-454.437) (-455.888) (-453.593) -- 0:00:01
982000 -- [-455.992] (-458.093) (-455.483) (-455.386) * [-453.791] (-456.349) (-455.326) (-457.327) -- 0:00:01
982500 -- (-454.463) (-454.700) [-454.342] (-452.462) * (-453.195) (-454.581) (-457.914) [-453.311] -- 0:00:01
983000 -- (-452.923) (-456.165) (-455.827) [-452.610] * (-453.600) [-456.036] (-456.603) (-453.756) -- 0:00:01
983500 -- (-453.020) (-453.666) (-453.873) [-454.217] * [-455.850] (-455.744) (-455.809) (-455.017) -- 0:00:00
984000 -- [-453.926] (-453.272) (-454.169) (-458.849) * (-456.304) (-455.172) [-455.111] (-455.842) -- 0:00:00
984500 -- (-452.761) (-454.917) [-455.589] (-457.031) * [-452.679] (-454.438) (-453.460) (-457.027) -- 0:00:00
985000 -- [-453.817] (-453.813) (-456.982) (-456.482) * [-454.209] (-454.046) (-456.711) (-460.923) -- 0:00:00
Average standard deviation of split frequencies: 0.005229
985500 -- (-455.642) (-456.511) [-455.605] (-453.282) * (-454.397) [-454.605] (-454.013) (-465.246) -- 0:00:00
986000 -- (-455.702) [-455.403] (-453.444) (-457.843) * (-453.917) (-454.807) (-459.478) [-457.091] -- 0:00:00
986500 -- (-454.969) (-455.150) [-454.543] (-453.036) * (-455.065) [-455.601] (-454.668) (-454.182) -- 0:00:00
987000 -- (-453.682) (-452.576) (-454.807) [-455.463] * (-454.379) [-455.768] (-458.140) (-456.257) -- 0:00:00
987500 -- (-454.567) (-452.939) (-456.212) [-453.542] * (-454.783) [-454.786] (-454.478) (-454.634) -- 0:00:00
988000 -- (-455.818) [-457.898] (-452.981) (-459.428) * (-456.669) [-454.318] (-455.379) (-457.252) -- 0:00:00
988500 -- (-457.588) [-456.749] (-454.220) (-453.951) * (-454.569) [-453.679] (-454.037) (-457.104) -- 0:00:00
989000 -- (-456.812) [-456.560] (-455.215) (-454.210) * (-453.855) [-453.530] (-455.881) (-457.208) -- 0:00:00
989500 -- (-456.757) (-455.519) (-458.047) [-456.168] * (-454.164) (-454.420) (-455.941) [-453.250] -- 0:00:00
990000 -- (-455.124) (-454.911) (-455.288) [-454.140] * (-453.716) (-454.583) (-455.666) [-454.482] -- 0:00:00
Average standard deviation of split frequencies: 0.005175
990500 -- [-453.479] (-454.260) (-455.093) (-453.221) * (-453.150) (-455.410) [-457.084] (-457.354) -- 0:00:00
991000 -- [-453.733] (-453.398) (-455.230) (-458.027) * (-453.746) [-455.845] (-456.508) (-455.304) -- 0:00:00
991500 -- (-453.353) (-456.509) [-453.203] (-456.226) * (-454.123) (-454.249) [-456.429] (-455.091) -- 0:00:00
992000 -- [-453.439] (-456.031) (-454.760) (-455.181) * [-454.252] (-455.960) (-454.685) (-454.691) -- 0:00:00
992500 -- (-457.684) (-453.944) [-454.299] (-454.901) * (-454.167) (-454.635) [-454.625] (-458.753) -- 0:00:00
993000 -- (-455.130) (-454.097) [-453.776] (-456.815) * [-456.000] (-460.850) (-456.481) (-455.048) -- 0:00:00
993500 -- (-454.198) (-457.041) [-455.374] (-460.621) * (-452.835) [-454.119] (-457.058) (-453.565) -- 0:00:00
994000 -- (-454.429) (-459.804) (-456.773) [-457.261] * (-453.529) [-456.890] (-455.127) (-456.395) -- 0:00:00
994500 -- (-456.223) (-454.614) (-454.224) [-458.030] * (-456.638) (-454.615) (-453.357) [-454.964] -- 0:00:00
995000 -- [-454.067] (-455.536) (-455.750) (-459.788) * [-455.380] (-455.684) (-453.447) (-453.392) -- 0:00:00
Average standard deviation of split frequencies: 0.005177
995500 -- (-454.404) (-458.963) [-455.165] (-461.576) * (-453.777) (-453.062) (-453.749) [-452.889] -- 0:00:00
996000 -- [-453.869] (-453.678) (-455.470) (-455.914) * [-453.604] (-453.959) (-453.950) (-456.328) -- 0:00:00
996500 -- [-455.519] (-452.783) (-454.119) (-459.120) * (-454.272) [-454.393] (-454.794) (-454.665) -- 0:00:00
997000 -- (-454.803) [-455.858] (-453.665) (-455.649) * (-453.460) (-452.696) [-454.261] (-452.569) -- 0:00:00
997500 -- [-455.831] (-452.938) (-455.130) (-455.674) * (-453.675) (-452.889) (-453.956) [-452.535] -- 0:00:00
998000 -- (-454.324) (-454.878) (-455.890) [-453.885] * [-458.244] (-453.040) (-457.159) (-452.536) -- 0:00:00
998500 -- (-455.815) (-456.915) [-455.270] (-454.165) * (-459.886) (-453.291) (-455.636) [-453.130] -- 0:00:00
999000 -- (-454.917) [-456.700] (-453.161) (-458.536) * (-459.589) [-459.454] (-456.139) (-454.120) -- 0:00:00
999500 -- (-458.411) [-454.978] (-453.651) (-454.677) * [-454.075] (-454.367) (-456.306) (-454.045) -- 0:00:00
1000000 -- (-456.362) [-455.233] (-455.746) (-453.177) * [-452.922] (-453.768) (-455.040) (-453.942) -- 0:00:00
Average standard deviation of split frequencies: 0.005182
Analysis completed in 60 seconds
Analysis used 58.70 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -452.38
Likelihood of best state for "cold" chain of run 2 was -452.38
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 78 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.6 % ( 35 %) Dirichlet(Pi{all})
37.6 % ( 24 %) Slider(Pi{all})
78.0 % ( 53 %) Multiplier(Alpha{1,2})
77.0 % ( 51 %) Multiplier(Alpha{3})
25.8 % ( 23 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 32 %) Multiplier(V{all})
97.4 % ( 93 %) Nodeslider(V{all})
30.8 % ( 31 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.1 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
37.7 % ( 26 %) Dirichlet(Pi{all})
36.2 % ( 33 %) Slider(Pi{all})
78.6 % ( 60 %) Multiplier(Alpha{1,2})
77.7 % ( 60 %) Multiplier(Alpha{3})
25.9 % ( 18 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.6 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166825 0.82 0.67
3 | 166391 166578 0.84
4 | 166755 166815 166636
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166726 0.82 0.67
3 | 166176 166328 0.84
4 | 166903 166412 167455
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -454.21
| 2 1 |
| 2 1 1 |
| 2 22 2 2 * 2 1 |
| 2 1 2 1 2 2 1 |
|2 1 2 2 21 1 1 1 21 1 1 |
| * 2 1121 2 21 1 2 2 2 1 2|
| 1 2121 21 1 1* 1 1 1 1 12 2 2 |
| 21 2 1 1 2 1 11 2 2 1 2 |
| 1 2 2 2 * 2 2 1 211 |
| 1 1 1 1 1 2 1 2 1|
| 2 2 2 2 2 1 |
| 2 2 1 2 2 |
| 1 2 1 |
| 1 |
|1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -455.71
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -454.12 -457.17
2 -454.12 -457.58
--------------------------------------
TOTAL -454.12 -457.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904228 0.090900 0.383146 1.522487 0.868954 1372.99 1436.99 1.000
r(A<->C){all} 0.175587 0.021612 0.000112 0.472429 0.135603 161.57 214.69 1.000
r(A<->G){all} 0.163768 0.019740 0.000079 0.445035 0.126381 228.74 317.27 1.000
r(A<->T){all} 0.175010 0.021252 0.000122 0.464779 0.135511 218.51 221.70 1.002
r(C<->G){all} 0.160719 0.018957 0.000097 0.433414 0.125021 231.20 246.34 1.001
r(C<->T){all} 0.153467 0.016551 0.000114 0.415632 0.119684 231.26 238.59 1.001
r(G<->T){all} 0.171449 0.021724 0.000002 0.465562 0.129309 130.54 147.42 1.008
pi(A){all} 0.194257 0.000458 0.152742 0.236984 0.193655 1348.57 1352.05 1.000
pi(C){all} 0.262369 0.000541 0.214440 0.305420 0.261892 1057.80 1082.97 1.000
pi(G){all} 0.361054 0.000683 0.313022 0.416574 0.361167 1193.92 1269.64 1.000
pi(T){all} 0.182320 0.000424 0.145003 0.223687 0.181878 1002.92 1119.31 1.000
alpha{1,2} 0.407288 0.210734 0.000105 1.350321 0.244646 1099.26 1156.82 1.000
alpha{3} 0.452887 0.229311 0.000148 1.368754 0.298860 1213.04 1267.90 1.000
pinvar{all} 0.994992 0.000037 0.983474 0.999998 0.996902 1281.53 1381.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ..*..*
9 -- .*.*..
10 -- .**...
11 -- ...**.
12 -- .***.*
13 -- ..*.*.
14 -- ..****
15 -- .*...*
16 -- ....**
17 -- .****.
18 -- .*.***
19 -- .**.**
20 -- ...*.*
21 -- .*..*.
22 -- ..*.**
23 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.003769 0.147901 0.153231 2
8 447 0.148901 0.011777 0.140573 0.157229 2
9 446 0.148568 0.002827 0.146569 0.150566 2
10 445 0.148235 0.002355 0.146569 0.149900 2
11 440 0.146569 0.007537 0.141239 0.151899 2
12 435 0.144903 0.005182 0.141239 0.148568 2
13 427 0.142239 0.000471 0.141905 0.142572 2
14 422 0.140573 0.009422 0.133911 0.147235 2
15 421 0.140240 0.004240 0.137242 0.143238 2
16 421 0.140240 0.010835 0.132578 0.147901 2
17 419 0.139574 0.006124 0.135243 0.143904 2
18 408 0.135909 0.001884 0.134577 0.137242 2
19 404 0.134577 0.004711 0.131246 0.137908 2
20 401 0.133578 0.000471 0.133245 0.133911 2
21 400 0.133245 0.001884 0.131912 0.134577 2
22 291 0.096935 0.008009 0.091272 0.102598 2
23 288 0.095936 0.006595 0.091272 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.102579 0.010811 0.000001 0.309907 0.069494 1.000 2
length{all}[2] 0.097304 0.009032 0.000084 0.286752 0.069024 1.000 2
length{all}[3] 0.097081 0.009742 0.000013 0.293448 0.065712 1.000 2
length{all}[4] 0.101934 0.010699 0.000020 0.316234 0.067792 1.000 2
length{all}[5] 0.100810 0.010373 0.000020 0.299291 0.070092 1.000 2
length{all}[6] 0.098178 0.008923 0.000022 0.283890 0.069351 1.000 2
length{all}[7] 0.096500 0.008348 0.000048 0.268913 0.071666 0.999 2
length{all}[8] 0.096265 0.008203 0.000457 0.256146 0.068753 0.998 2
length{all}[9] 0.102287 0.011348 0.000013 0.322583 0.066357 1.002 2
length{all}[10] 0.102766 0.011150 0.000010 0.304220 0.068325 0.998 2
length{all}[11] 0.106187 0.009364 0.000389 0.304368 0.079022 0.998 2
length{all}[12] 0.108975 0.012257 0.000245 0.338092 0.073377 0.998 2
length{all}[13] 0.100128 0.010273 0.000182 0.290894 0.069220 0.998 2
length{all}[14] 0.091439 0.007806 0.000343 0.274382 0.064471 0.999 2
length{all}[15] 0.103070 0.009403 0.000057 0.305142 0.070892 1.001 2
length{all}[16] 0.091157 0.008448 0.000206 0.285519 0.060710 1.003 2
length{all}[17] 0.107262 0.010961 0.000530 0.317312 0.078587 0.998 2
length{all}[18] 0.105603 0.010893 0.000025 0.305118 0.078094 0.998 2
length{all}[19] 0.105878 0.012029 0.000265 0.350211 0.073020 1.003 2
length{all}[20] 0.108155 0.010864 0.000002 0.304057 0.077034 0.998 2
length{all}[21] 0.099068 0.008702 0.000005 0.284427 0.072795 0.999 2
length{all}[22] 0.103794 0.009273 0.000105 0.286894 0.072446 1.007 2
length{all}[23] 0.096154 0.008030 0.000711 0.266851 0.069551 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005182
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 336
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 44 patterns at 112 / 112 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 44 patterns at 112 / 112 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053777 0.043463 0.077684 0.102456 0.045770 0.033188 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -478.417742
Iterating by ming2
Initial: fx= 478.417742
x= 0.05378 0.04346 0.07768 0.10246 0.04577 0.03319 0.30000 1.30000
1 h-m-p 0.0000 0.0003 270.2075 +++ 456.492662 m 0.0003 14 | 1/8
2 h-m-p 0.0160 8.0000 25.9166 -------------.. | 1/8
3 h-m-p 0.0000 0.0001 247.9142 ++ 450.779153 m 0.0001 47 | 2/8
4 h-m-p 0.0160 8.0000 24.2272 -------------.. | 2/8
5 h-m-p 0.0000 0.0000 221.9404 ++ 449.751244 m 0.0000 80 | 3/8
6 h-m-p 0.0160 8.0000 19.8231 -------------.. | 3/8
7 h-m-p 0.0000 0.0001 192.0043 ++ 447.076222 m 0.0001 113 | 4/8
8 h-m-p 0.0160 8.0000 14.8719 -------------.. | 4/8
9 h-m-p 0.0000 0.0002 156.6523 +++ 441.728242 m 0.0002 147 | 5/8
10 h-m-p 0.0160 8.0000 10.3149 -------------.. | 5/8
11 h-m-p 0.0000 0.0002 111.0013 +++ 438.932984 m 0.0002 181 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 438.932984 m 8.0000 192 | 6/8
13 h-m-p 0.1923 8.0000 0.0001 ---Y 438.932984 0 0.0008 208 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 438.932984 m 8.0000 248 | 6/8
16 h-m-p 0.0160 8.0000 1.6888 +++++ 438.932924 m 8.0000 264 | 6/8
17 h-m-p 1.6000 8.0000 0.4187 ++ 438.932922 m 8.0000 275 | 6/8
18 h-m-p 0.2706 8.0000 12.3793 +++ 438.932912 m 8.0000 289 | 6/8
19 h-m-p 1.6000 8.0000 8.4739 ++ 438.932911 m 8.0000 300 | 6/8
20 h-m-p 1.6000 8.0000 6.5786 ++ 438.932911 m 8.0000 311 | 6/8
21 h-m-p 1.5851 7.9255 29.8646 -------------Y 438.932911 0 0.0000 335 | 6/8
22 h-m-p 0.3986 8.0000 0.0000 ---C 438.932911 0 0.0016 349 | 6/8
23 h-m-p 1.4419 8.0000 0.0000 C 438.932911 0 1.4419 362
Out..
lnL = -438.932911
363 lfun, 363 eigenQcodon, 2178 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106905 0.056645 0.020833 0.101344 0.066062 0.077448 188.625562 0.862794 0.388141
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.135262
np = 9
lnL0 = -484.939531
Iterating by ming2
Initial: fx= 484.939531
x= 0.10691 0.05664 0.02083 0.10134 0.06606 0.07745 188.62556 0.86279 0.38814
1 h-m-p 0.0000 0.0002 256.0274 +++ 472.117447 m 0.0002 15 | 1/9
2 h-m-p 0.0003 0.0015 129.5481 ++ 452.401695 m 0.0015 27 | 2/9
3 h-m-p 0.0000 0.0000 85034.5749 ++ 448.346149 m 0.0000 39 | 3/9
4 h-m-p 0.0002 0.0009 176.4569 ++ 443.964196 m 0.0009 51 | 4/9
5 h-m-p 0.0000 0.0000 40970.2967 ++ 441.468379 m 0.0000 63 | 5/9
6 h-m-p 0.0109 0.0625 8.1514 -------------.. | 5/9
7 h-m-p 0.0000 0.0001 154.2455 ++ 439.408176 m 0.0001 98 | 6/9
8 h-m-p 0.0058 0.3590 1.6233 ------------.. | 6/9
9 h-m-p 0.0000 0.0000 110.2158 ++ 438.932964 m 0.0000 132 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 Y 438.932964 0 1.6000 144 | 6/9
11 h-m-p 0.0000 0.0000 0.2327
h-m-p: 1.00441333e-16 5.02206663e-16 2.32727775e-01 438.932964
.. | 6/9
12 h-m-p 0.0160 8.0000 0.0001 +++++ 438.932964 m 8.0000 173 | 6/9
13 h-m-p 0.0036 1.8012 0.3190 +++++ 438.932945 m 1.8012 191 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 -Y 438.932945 0 0.1000 207 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 ---Y 438.932945 0 0.0008 224
Out..
lnL = -438.932945
225 lfun, 675 eigenQcodon, 2700 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031853 0.052695 0.106619 0.016465 0.037884 0.109388 188.625601 1.102397 0.239349 0.235133 164.138224
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.003987
np = 11
lnL0 = -457.133223
Iterating by ming2
Initial: fx= 457.133223
x= 0.03185 0.05269 0.10662 0.01646 0.03788 0.10939 188.62560 1.10240 0.23935 0.23513 164.13822
1 h-m-p 0.0000 0.0006 57.7351 +++ 454.635873 m 0.0006 17 | 1/11
2 h-m-p 0.0028 0.0606 11.7844 +++ 446.826338 m 0.0606 32 | 2/11
3 h-m-p 0.0000 0.0000 11414.0497 ++ 446.767882 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0022 73.9796 +++ 443.698923 m 0.0022 61 | 4/11
5 h-m-p 0.0000 0.0001 4400.9305 ++ 441.285477 m 0.0001 75 | 5/11
6 h-m-p 0.0001 0.0004 1022.1669 ++ 438.932915 m 0.0004 89 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ++ 438.932915 m 8.0000 103 | 6/11
8 h-m-p 0.0160 8.0000 0.0020 ---------Y 438.932915 0 0.0000 131 | 6/11
9 h-m-p 0.0160 8.0000 0.0120 +++++ 438.932915 m 8.0000 153 | 6/11
10 h-m-p 0.0851 8.0000 1.1238 ++++ 438.932911 m 8.0000 174 | 6/11
11 h-m-p 1.6000 8.0000 0.0706 ++ 438.932911 m 8.0000 188 | 6/11
12 h-m-p 1.5937 8.0000 0.3542 ++ 438.932911 m 8.0000 207 | 6/11
13 h-m-p 0.2566 1.2828 2.0661 ++ 438.932911 m 1.2828 226 | 6/11
14 h-m-p 0.4778 2.8479 5.5468 -------Y 438.932911 0 0.0000 247 | 6/11
15 h-m-p 0.0249 8.0000 0.0016 C 438.932911 0 0.0062 261 | 6/11
16 h-m-p 1.6000 8.0000 0.0000 ----C 438.932911 0 0.0016 284
Out..
lnL = -438.932911
285 lfun, 1140 eigenQcodon, 5130 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -438.930356 S = -438.930316 -0.000015
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:03
did 20 / 44 patterns 0:03
did 30 / 44 patterns 0:03
did 40 / 44 patterns 0:03
did 44 / 44 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095237 0.049464 0.015540 0.044306 0.079411 0.035578 188.670507 0.942622 1.161663
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.138856
np = 9
lnL0 = -473.109709
Iterating by ming2
Initial: fx= 473.109709
x= 0.09524 0.04946 0.01554 0.04431 0.07941 0.03558 188.67051 0.94262 1.16166
1 h-m-p 0.0000 0.0001 254.9138 ++ 463.527096 m 0.0001 14 | 1/9
2 h-m-p 0.0028 0.0770 12.2744 ------------.. | 1/9
3 h-m-p 0.0000 0.0002 235.8586 +++ 452.905225 m 0.0002 49 | 2/9
4 h-m-p 0.0056 0.1377 7.0695 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 214.7361 ++ 449.114856 m 0.0001 83 | 3/9
6 h-m-p 0.0040 0.2953 3.7648 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 186.7370 ++ 447.425408 m 0.0000 117 | 4/9
8 h-m-p 0.0028 0.4766 2.6600 ------------.. | 4/9
9 h-m-p 0.0000 0.0003 152.0316 +++ 440.756909 m 0.0003 152 | 5/9
10 h-m-p 0.0195 1.5172 1.5640 -------------.. | 5/9
11 h-m-p 0.0000 0.0002 109.5575 ++ 438.932966 m 0.0002 187 | 6/9
12 h-m-p 0.5869 8.0000 0.0000 ++ 438.932966 m 8.0000 199 | 6/9
13 h-m-p 0.1835 8.0000 0.0001 +++ 438.932966 m 8.0000 215 | 6/9
14 h-m-p 0.0160 8.0000 0.4188 +++++ 438.932964 m 8.0000 233 | 6/9
15 h-m-p 1.6000 8.0000 0.3235 ++ 438.932963 m 8.0000 248 | 6/9
16 h-m-p 1.3984 8.0000 1.8504 ++ 438.932963 m 8.0000 263 | 6/9
17 h-m-p 1.6000 8.0000 4.6688 ++ 438.932963 m 8.0000 275 | 6/9
18 h-m-p 1.1500 5.7501 13.7756 ++ 438.932963 m 5.7501 287 | 7/9
19 h-m-p 0.0073 0.0365 47.3169 -------------.. | 7/9
20 h-m-p 0.0160 8.0000 0.0000 ---------N 438.932963 0 0.0000 331 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 ---------N 438.932963 0 0.0000 354
Out..
lnL = -438.932963
355 lfun, 3905 eigenQcodon, 21300 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101907 0.014390 0.025542 0.083744 0.055268 0.019015 188.544378 0.900000 0.866119 1.165456 144.052779
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.008344
np = 11
lnL0 = -450.774780
Iterating by ming2
Initial: fx= 450.774780
x= 0.10191 0.01439 0.02554 0.08374 0.05527 0.01902 188.54438 0.90000 0.86612 1.16546 144.05278
1 h-m-p 0.0000 0.0008 73.4781 ++++ 446.691508 m 0.0008 18 | 1/11
2 h-m-p 0.0000 0.0001 78.5830 ++ 446.227395 m 0.0001 32 | 2/11
3 h-m-p 0.0006 0.0098 13.4389 ++ 443.421014 m 0.0098 46 | 3/11
4 h-m-p 0.0000 0.0002 43.2137 ++ 443.348622 m 0.0002 60 | 4/11
5 h-m-p 0.0004 0.0021 13.6405 ++ 442.538892 m 0.0021 74 | 5/11
6 h-m-p 0.0020 0.0202 5.8455 ++ 438.932964 m 0.0202 88 | 6/11
7 h-m-p 1.6000 8.0000 0.0007 ++ 438.932963 m 8.0000 102 | 6/11
8 h-m-p 0.0642 8.0000 0.0889 ++++ 438.932921 m 8.0000 123 | 6/11
9 h-m-p 1.6000 8.0000 0.0319 ++ 438.932919 m 8.0000 142 | 6/11
10 h-m-p 0.6073 3.0366 0.3922 +
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+ 438.932915 m 3.0366 161
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53653, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53627, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
11 h-m-p 0.0000 0.0000 0.3601
h-m-p: 4.21428337e-18 2.10714168e-17 3.60099310e-01 438.932915
..
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53653, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53627, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
12 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+ 438.932915 m 8.0000 199
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53653, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53627, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
13 h-m-p 0.0160 8.0000 0.0377
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+ 438.932911 m 8.0000 221
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53653, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53627, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
14 h-m-p 1.6000 8.0000 0.0128
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+ 438.932911 m 8.0000 239
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53653, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53627, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
15 h-m-p 0.6128 3.1773 0.1666
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
+ 438.932911 m 3.1773 257
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53653, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53627, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
16 h-m-p 0.9250 8.0000 0.0003
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
+ 438.932911 m 8.0000 275
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53652, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53626, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
17 h-m-p 0.0397 8.0000 0.0608
QuantileBeta(0.85, 2.53640, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
Y 438.932911 0 0.0000 303
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53652, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53626, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
18 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
Y 438.932911 0 0.0000 327
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53652, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53626, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
19 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
Y 438.932911 0 0.0000 349
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -438.932911
350 lfun, 4200 eigenQcodon, 23100 P(t)
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -438.930375 S = -438.930317 -0.000025
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:15
did 20 / 44 patterns 0:15
did 30 / 44 patterns 0:15
did 40 / 44 patterns 0:15
did 44 / 44 patterns 0:15
QuantileBeta(0.85, 2.53639, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=112
NC_011896_1_WP_010907618_1_240_MLBR_RS01180 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
NC_002677_1_NP_301294_1_166_lsr2 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ
**************************************************
NC_011896_1_WP_010907618_1_240_MLBR_RS01180 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
NC_002677_1_NP_301294_1_166_lsr2 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285 WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
**************************************************
NC_011896_1_WP_010907618_1_240_MLBR_RS01180 PADVIDAFHAAT
NC_002677_1_NP_301294_1_166_lsr2 PADVIDAFHAAT
NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750 PADVIDAFHAAT
NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655 PADVIDAFHAAT
NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240 PADVIDAFHAAT
NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285 PADVIDAFHAAT
************
>NC_011896_1_WP_010907618_1_240_MLBR_RS01180 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT >NC_002677_1_NP_301294_1_166_lsr2 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT >NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT >NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT >NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT >NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285 ATGGCGAAGAAAGTGACCGTCACCTTGGTCGATGATTTCGATGGTGCGGG CGCCGCCGATGAAACGGTCGAATTCGGGCTTGACGGGGTGACCTACGAGA TCGACCTTACGAACAAGAATGCCGCGAAACTGCGTGGCGATCTGAGGCAA TGGGTGTCCGCCGGACGGCGCGTCGGCGGTCGGCGGCGAGGGCGTTCCAA TTCTGGACGCGGCCGTGGGGCGATCGATCGCGAACAGAGCGCGGCGATCC GGGAATGGGCTCGTCGGAACGGACATAATGTGTCGACTCGTGGTCGTATT CCGGCCGACGTCATTGACGCATTCCACGCGGCGACT
>NC_011896_1_WP_010907618_1_240_MLBR_RS01180 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI PADVIDAFHAAT >NC_002677_1_NP_301294_1_166_lsr2 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI PADVIDAFHAAT >NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI PADVIDAFHAAT >NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI PADVIDAFHAAT >NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI PADVIDAFHAAT >NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285 MAKKVTVTLVDDFDGAGAADETVEFGLDGVTYEIDLTNKNAAKLRGDLRQ WVSAGRRVGGRRRGRSNSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI PADVIDAFHAAT
#NEXUS
[ID: 0001615192]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907618_1_240_MLBR_RS01180
NC_002677_1_NP_301294_1_166_lsr2
NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750
NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655
NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240
NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907618_1_240_MLBR_RS01180,
2 NC_002677_1_NP_301294_1_166_lsr2,
3 NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750,
4 NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655,
5 NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240,
6 NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06949405,2:0.06902353,3:0.06571228,4:0.06779232,5:0.07009151,6:0.06935136);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06949405,2:0.06902353,3:0.06571228,4:0.06779232,5:0.07009151,6:0.06935136);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -454.12 -457.17
2 -454.12 -457.58
--------------------------------------
TOTAL -454.12 -457.40
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lsr2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.904228 0.090900 0.383146 1.522487 0.868954 1372.99 1436.99 1.000
r(A<->C){all} 0.175587 0.021612 0.000112 0.472429 0.135603 161.57 214.69 1.000
r(A<->G){all} 0.163768 0.019740 0.000079 0.445035 0.126381 228.74 317.27 1.000
r(A<->T){all} 0.175010 0.021252 0.000122 0.464779 0.135511 218.51 221.70 1.002
r(C<->G){all} 0.160719 0.018957 0.000097 0.433414 0.125021 231.20 246.34 1.001
r(C<->T){all} 0.153467 0.016551 0.000114 0.415632 0.119684 231.26 238.59 1.001
r(G<->T){all} 0.171449 0.021724 0.000002 0.465562 0.129309 130.54 147.42 1.008
pi(A){all} 0.194257 0.000458 0.152742 0.236984 0.193655 1348.57 1352.05 1.000
pi(C){all} 0.262369 0.000541 0.214440 0.305420 0.261892 1057.80 1082.97 1.000
pi(G){all} 0.361054 0.000683 0.313022 0.416574 0.361167 1193.92 1269.64 1.000
pi(T){all} 0.182320 0.000424 0.145003 0.223687 0.181878 1002.92 1119.31 1.000
alpha{1,2} 0.407288 0.210734 0.000105 1.350321 0.244646 1099.26 1156.82 1.000
alpha{3} 0.452887 0.229311 0.000148 1.368754 0.298860 1213.04 1267.90 1.000
pinvar{all} 0.994992 0.000037 0.983474 0.999998 0.996902 1281.53 1381.79 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/lsr2/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 112
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 6 6 6 6 6 6
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 3 3 3 3 3 3
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 6 6 | Gly GGT 3 3 3 3 3 3
GTC 5 5 5 5 5 5 | GCC 5 5 5 5 5 5 | GAC 4 4 4 4 4 4 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3
GTG 4 4 4 4 4 4 | GCG 8 8 8 8 8 8 | GAG 1 1 1 1 1 1 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907618_1_240_MLBR_RS01180
position 1: T:0.09821 C:0.21429 A:0.21429 G:0.47321
position 2: T:0.20536 C:0.24107 A:0.25893 G:0.29464
position 3: T:0.24107 C:0.33036 A:0.10714 G:0.32143
Average T:0.18155 C:0.26190 A:0.19345 G:0.36310
#2: NC_002677_1_NP_301294_1_166_lsr2
position 1: T:0.09821 C:0.21429 A:0.21429 G:0.47321
position 2: T:0.20536 C:0.24107 A:0.25893 G:0.29464
position 3: T:0.24107 C:0.33036 A:0.10714 G:0.32143
Average T:0.18155 C:0.26190 A:0.19345 G:0.36310
#3: NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750
position 1: T:0.09821 C:0.21429 A:0.21429 G:0.47321
position 2: T:0.20536 C:0.24107 A:0.25893 G:0.29464
position 3: T:0.24107 C:0.33036 A:0.10714 G:0.32143
Average T:0.18155 C:0.26190 A:0.19345 G:0.36310
#4: NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655
position 1: T:0.09821 C:0.21429 A:0.21429 G:0.47321
position 2: T:0.20536 C:0.24107 A:0.25893 G:0.29464
position 3: T:0.24107 C:0.33036 A:0.10714 G:0.32143
Average T:0.18155 C:0.26190 A:0.19345 G:0.36310
#5: NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240
position 1: T:0.09821 C:0.21429 A:0.21429 G:0.47321
position 2: T:0.20536 C:0.24107 A:0.25893 G:0.29464
position 3: T:0.24107 C:0.33036 A:0.10714 G:0.32143
Average T:0.18155 C:0.26190 A:0.19345 G:0.36310
#6: NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285
position 1: T:0.09821 C:0.21429 A:0.21429 G:0.47321
position 2: T:0.20536 C:0.24107 A:0.25893 G:0.29464
position 3: T:0.24107 C:0.33036 A:0.10714 G:0.32143
Average T:0.18155 C:0.26190 A:0.19345 G:0.36310
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 12 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 6 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 36
CTC 0 | CCC 0 | CAC 6 | CGC 18
CTA 0 | CCA 0 | Gln Q CAA 6 | CGA 6
CTG 12 | CCG 6 | CAG 6 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 0
ATC 18 | ACC 18 | AAC 12 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 6 | ACG 12 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 6 | Asp D GAT 36 | Gly G GGT 18
GTC 30 | GCC 30 | GAC 24 | GGC 24
GTA 0 | GCA 6 | Glu E GAA 24 | GGA 18
GTG 24 | GCG 48 | GAG 6 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09821 C:0.21429 A:0.21429 G:0.47321
position 2: T:0.20536 C:0.24107 A:0.25893 G:0.29464
position 3: T:0.24107 C:0.33036 A:0.10714 G:0.32143
Average T:0.18155 C:0.26190 A:0.19345 G:0.36310
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -438.932911 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 188.625562 144.052779
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907618_1_240_MLBR_RS01180: 0.000004, NC_002677_1_NP_301294_1_166_lsr2: 0.000004, NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750: 0.000004, NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655: 0.000004, NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240: 0.000004, NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 188.62556
omega (dN/dS) = 144.05278
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.8 107.2 144.0528 0.0000 0.0000 0.0 0.0
7..2 0.000 228.8 107.2 144.0528 0.0000 0.0000 0.0 0.0
7..3 0.000 228.8 107.2 144.0528 0.0000 0.0000 0.0 0.0
7..4 0.000 228.8 107.2 144.0528 0.0000 0.0000 0.0 0.0
7..5 0.000 228.8 107.2 144.0528 0.0000 0.0000 0.0 0.0
7..6 0.000 228.8 107.2 144.0528 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -438.932945 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 188.625601 0.000010 0.261909
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907618_1_240_MLBR_RS01180: 0.000004, NC_002677_1_NP_301294_1_166_lsr2: 0.000004, NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750: 0.000004, NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655: 0.000004, NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240: 0.000004, NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 188.62560
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.26191 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.8 107.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 228.8 107.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 228.8 107.2 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 228.8 107.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 228.8 107.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 228.8 107.2 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -438.932911 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 188.670507 0.000009 0.020888 0.999997 164.267494
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907618_1_240_MLBR_RS01180: 0.000004, NC_002677_1_NP_301294_1_166_lsr2: 0.000004, NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750: 0.000004, NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655: 0.000004, NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240: 0.000004, NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 188.67051
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00001 0.02089 0.97910
w: 1.00000 1.00000 164.26749
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.8 107.2 160.8558 0.0000 0.0000 0.0 0.0
7..2 0.000 228.8 107.2 160.8558 0.0000 0.0000 0.0 0.0
7..3 0.000 228.8 107.2 160.8558 0.0000 0.0000 0.0 0.0
7..4 0.000 228.8 107.2 160.8558 0.0000 0.0000 0.0 0.0
7..5 0.000 228.8 107.2 160.8558 0.0000 0.0000 0.0 0.0
7..6 0.000 228.8 107.2 160.8558 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907618_1_240_MLBR_RS01180)
Pr(w>1) post mean +- SE for w
1 M 0.979* 160.856
2 A 0.979* 160.856
3 K 0.979* 160.856
4 K 0.979* 160.856
5 V 0.979* 160.856
6 T 0.979* 160.856
7 V 0.979* 160.856
8 T 0.979* 160.856
9 L 0.979* 160.856
10 V 0.979* 160.856
11 D 0.979* 160.856
12 D 0.979* 160.856
13 F 0.979* 160.856
14 D 0.979* 160.856
15 G 0.979* 160.856
16 A 0.979* 160.856
17 G 0.979* 160.856
18 A 0.979* 160.856
19 A 0.979* 160.856
20 D 0.979* 160.856
21 E 0.979* 160.856
22 T 0.979* 160.856
23 V 0.979* 160.856
24 E 0.979* 160.856
25 F 0.979* 160.856
26 G 0.979* 160.856
27 L 0.979* 160.856
28 D 0.979* 160.856
29 G 0.979* 160.856
30 V 0.979* 160.856
31 T 0.979* 160.856
32 Y 0.979* 160.856
33 E 0.979* 160.856
34 I 0.979* 160.856
35 D 0.979* 160.856
36 L 0.979* 160.856
37 T 0.979* 160.856
38 N 0.979* 160.856
39 K 0.979* 160.856
40 N 0.979* 160.856
41 A 0.979* 160.856
42 A 0.979* 160.856
43 K 0.979* 160.856
44 L 0.979* 160.856
45 R 0.979* 160.856
46 G 0.979* 160.856
47 D 0.979* 160.856
48 L 0.979* 160.856
49 R 0.979* 160.856
50 Q 0.979* 160.856
51 W 0.979* 160.856
52 V 0.979* 160.856
53 S 0.979* 160.856
54 A 0.979* 160.856
55 G 0.979* 160.856
56 R 0.979* 160.856
57 R 0.979* 160.856
58 V 0.979* 160.856
59 G 0.979* 160.856
60 G 0.979* 160.856
61 R 0.979* 160.856
62 R 0.979* 160.856
63 R 0.979* 160.856
64 G 0.979* 160.856
65 R 0.979* 160.856
66 S 0.979* 160.856
67 N 0.979* 160.856
68 S 0.979* 160.856
69 G 0.979* 160.856
70 R 0.979* 160.856
71 G 0.979* 160.856
72 R 0.979* 160.856
73 G 0.979* 160.856
74 A 0.979* 160.856
75 I 0.979* 160.856
76 D 0.979* 160.856
77 R 0.979* 160.856
78 E 0.979* 160.856
79 Q 0.979* 160.856
80 S 0.979* 160.856
81 A 0.979* 160.856
82 A 0.979* 160.856
83 I 0.979* 160.856
84 R 0.979* 160.856
85 E 0.979* 160.856
86 W 0.979* 160.856
87 A 0.979* 160.856
88 R 0.979* 160.856
89 R 0.979* 160.856
90 N 0.979* 160.856
91 G 0.979* 160.856
92 H 0.979* 160.856
93 N 0.979* 160.856
94 V 0.979* 160.856
95 S 0.979* 160.856
96 T 0.979* 160.856
97 R 0.979* 160.856
98 G 0.979* 160.856
99 R 0.979* 160.856
100 I 0.979* 160.856
101 P 0.979* 160.856
102 A 0.979* 160.856
103 D 0.979* 160.856
104 V 0.979* 160.856
105 I 0.979* 160.856
106 D 0.979* 160.856
107 A 0.979* 160.856
108 F 0.979* 160.856
109 H 0.979* 160.856
110 A 0.979* 160.856
111 A 0.979* 160.856
112 T 0.979* 160.856
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907618_1_240_MLBR_RS01180)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -438.932963 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 188.544378 99.000000 97.272286
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907618_1_240_MLBR_RS01180: 0.000004, NC_002677_1_NP_301294_1_166_lsr2: 0.000004, NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750: 0.000004, NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655: 0.000004, NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240: 0.000004, NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 188.54438
Parameters in M7 (beta):
p = 99.00000 q = 97.27229
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.44580 0.46742 0.48032 0.49065 0.49993 0.50891 0.51818 0.52850 0.54138 0.56295
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.8 107.2 0.5044 0.0000 0.0000 0.0 0.0
7..2 0.000 228.8 107.2 0.5044 0.0000 0.0000 0.0 0.0
7..3 0.000 228.8 107.2 0.5044 0.0000 0.0000 0.0 0.0
7..4 0.000 228.8 107.2 0.5044 0.0000 0.0000 0.0 0.0
7..5 0.000 228.8 107.2 0.5044 0.0000 0.0000 0.0 0.0
7..6 0.000 228.8 107.2 0.5044 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -438.932911 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 188.544411 0.000010 2.536392 0.005000 144.021442
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907618_1_240_MLBR_RS01180: 0.000004, NC_002677_1_NP_301294_1_166_lsr2: 0.000004, NZ_LVXE01000009_1_WP_010907618_1_2865_A3216_RS04750: 0.000004, NZ_LYPH01000016_1_WP_010907618_1_564_A8144_RS02655: 0.000004, NZ_CP029543_1_WP_010907618_1_240_DIJ64_RS01240: 0.000004, NZ_AP014567_1_WP_010907618_1_249_JK2ML_RS01285: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 188.54441
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 2.53639 q = 0.00500
(p1 = 0.99999) w = 144.02144
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 144.02144
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 228.8 107.2 144.0200 0.0000 0.0000 0.0 0.0
7..2 0.000 228.8 107.2 144.0200 0.0000 0.0000 0.0 0.0
7..3 0.000 228.8 107.2 144.0200 0.0000 0.0000 0.0 0.0
7..4 0.000 228.8 107.2 144.0200 0.0000 0.0000 0.0 0.0
7..5 0.000 228.8 107.2 144.0200 0.0000 0.0000 0.0 0.0
7..6 0.000 228.8 107.2 144.0200 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907618_1_240_MLBR_RS01180)
Pr(w>1) post mean +- SE for w
1 M 1.000** 144.020
2 A 1.000** 144.020
3 K 1.000** 144.020
4 K 1.000** 144.020
5 V 1.000** 144.020
6 T 1.000** 144.020
7 V 1.000** 144.020
8 T 1.000** 144.020
9 L 1.000** 144.020
10 V 1.000** 144.020
11 D 1.000** 144.020
12 D 1.000** 144.020
13 F 1.000** 144.020
14 D 1.000** 144.020
15 G 1.000** 144.020
16 A 1.000** 144.020
17 G 1.000** 144.020
18 A 1.000** 144.020
19 A 1.000** 144.020
20 D 1.000** 144.020
21 E 1.000** 144.020
22 T 1.000** 144.020
23 V 1.000** 144.020
24 E 1.000** 144.020
25 F 1.000** 144.020
26 G 1.000** 144.020
27 L 1.000** 144.020
28 D 1.000** 144.020
29 G 1.000** 144.020
30 V 1.000** 144.020
31 T 1.000** 144.020
32 Y 1.000** 144.020
33 E 1.000** 144.020
34 I 1.000** 144.020
35 D 1.000** 144.020
36 L 1.000** 144.020
37 T 1.000** 144.020
38 N 1.000** 144.020
39 K 1.000** 144.020
40 N 1.000** 144.020
41 A 1.000** 144.020
42 A 1.000** 144.020
43 K 1.000** 144.020
44 L 1.000** 144.020
45 R 1.000** 144.020
46 G 1.000** 144.020
47 D 1.000** 144.020
48 L 1.000** 144.020
49 R 1.000** 144.020
50 Q 1.000** 144.020
51 W 1.000** 144.020
52 V 1.000** 144.020
53 S 1.000** 144.020
54 A 1.000** 144.020
55 G 1.000** 144.020
56 R 1.000** 144.020
57 R 1.000** 144.020
58 V 1.000** 144.020
59 G 1.000** 144.020
60 G 1.000** 144.020
61 R 1.000** 144.020
62 R 1.000** 144.020
63 R 1.000** 144.020
64 G 1.000** 144.020
65 R 1.000** 144.020
66 S 1.000** 144.020
67 N 1.000** 144.020
68 S 1.000** 144.020
69 G 1.000** 144.020
70 R 1.000** 144.020
71 G 1.000** 144.020
72 R 1.000** 144.020
73 G 1.000** 144.020
74 A 1.000** 144.020
75 I 1.000** 144.020
76 D 1.000** 144.020
77 R 1.000** 144.020
78 E 1.000** 144.020
79 Q 1.000** 144.020
80 S 1.000** 144.020
81 A 1.000** 144.020
82 A 1.000** 144.020
83 I 1.000** 144.020
84 R 1.000** 144.020
85 E 1.000** 144.020
86 W 1.000** 144.020
87 A 1.000** 144.020
88 R 1.000** 144.020
89 R 1.000** 144.020
90 N 1.000** 144.020
91 G 1.000** 144.020
92 H 1.000** 144.020
93 N 1.000** 144.020
94 V 1.000** 144.020
95 S 1.000** 144.020
96 T 1.000** 144.020
97 R 1.000** 144.020
98 G 1.000** 144.020
99 R 1.000** 144.020
100 I 1.000** 144.020
101 P 1.000** 144.020
102 A 1.000** 144.020
103 D 1.000** 144.020
104 V 1.000** 144.020
105 I 1.000** 144.020
106 D 1.000** 144.020
107 A 1.000** 144.020
108 F 1.000** 144.020
109 H 1.000** 144.020
110 A 1.000** 144.020
111 A 1.000** 144.020
112 T 1.000** 144.020
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907618_1_240_MLBR_RS01180)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15
Model 1: NearlyNeutral -438.932945 Model 2: PositiveSelection -438.932911 Model 0: one-ratio -438.932911 Model 7: beta -438.932963 Model 8: beta&w>1 -438.932911 Model 0 vs 1 6.800000005569018E-5 Model 2 vs 1 6.800000005569018E-5 Model 8 vs 7 1.0399999996479892E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
