--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 15:18:10 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/3res/menE/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1551.17 -1554.67 2 -1551.15 -1554.80 -------------------------------------- TOTAL -1551.16 -1554.74 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896580 0.085222 0.359988 1.475400 0.871924 1501.00 1501.00 1.000 r(A<->C){all} 0.162990 0.018020 0.000011 0.430811 0.129171 130.94 279.84 1.000 r(A<->G){all} 0.161926 0.020011 0.000048 0.451731 0.122468 214.37 274.52 1.000 r(A<->T){all} 0.167200 0.019086 0.000111 0.448513 0.132264 76.73 207.76 1.000 r(C<->G){all} 0.172542 0.021507 0.000129 0.468694 0.137481 178.41 196.96 1.000 r(C<->T){all} 0.160829 0.017870 0.000024 0.423398 0.124518 219.17 233.98 1.005 r(G<->T){all} 0.174514 0.021301 0.000048 0.477858 0.136594 239.99 288.09 1.011 pi(A){all} 0.160788 0.000121 0.138065 0.180721 0.160527 1300.48 1400.74 1.000 pi(C){all} 0.307015 0.000179 0.281555 0.334522 0.306708 1270.40 1294.03 1.000 pi(G){all} 0.330788 0.000189 0.302632 0.355233 0.331053 1319.31 1410.15 1.000 pi(T){all} 0.201409 0.000136 0.180089 0.225397 0.201062 1217.95 1286.07 1.000 alpha{1,2} 0.419190 0.227525 0.000163 1.387030 0.250710 1274.76 1351.78 1.001 alpha{3} 0.461036 0.240521 0.000315 1.444218 0.282197 1201.43 1258.70 1.000 pinvar{all} 0.998661 0.000003 0.995734 1.000000 0.999124 1030.40 1121.84 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1441.211515 Model 2: PositiveSelection -1441.211329 Model 0: one-ratio -1441.211329 Model 7: beta -1441.211612 Model 8: beta&w>1 -1441.211328 Model 0 vs 1 3.71999999970285E-4 Model 2 vs 1 3.71999999970285E-4 Model 8 vs 7 5.679999999301799E-4
>C1 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C2 LLLPTLERILDGRAPAMVVVPAQHEPIAALRALRVGEEIDDDVALVATTS GTTGVPKGALLTAAALTASASATHDRLGGPGSWLLALPPYHIGGLQVLVR SVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRRYTSLVATQLAKALTDS TATAVLAELDAVLVGGGPAPRPILDAATSAGIMVVGTYGMSETAGGCVYD GVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVPDPFAESGWFHTDDLGT VDGSGVLTVLGRADDAISTGGLTVLPGPVEAALCTHPAVSDCAVFGLTDD RLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDAMAAPRELHIVDTLPRR GIGKVDRTALVRRFAKSGoooooooooooooooo >C3 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C4 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C5 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C6 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=400 C1 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR C2 ----------------LLLPTLERILDGRAPAMVVVPAQHEPIAALRALR C3 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR C4 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR C5 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR C6 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR ********************************** C1 VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL C2 VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL C3 VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL C4 VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL C5 VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL C6 VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL ************************************************** C1 LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR C2 LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR C3 LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR C4 LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR C5 LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR C6 LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR ************************************************** C1 YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV C2 YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV C3 YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV C4 YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV C5 YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV C6 YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV ************************************************** C1 VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP C2 VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP C3 VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP C4 VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP C5 VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP C6 VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP ************************************************** C1 DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC C2 DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC C3 DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC C4 DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC C5 DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC C6 DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC ************************************************** C1 THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA C2 THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA C3 THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA C4 THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA C5 THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA C6 THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA ************************************************** C1 MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG---------------- C2 MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSGoooooooooooooooo C3 MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG---------------- C4 MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG---------------- C5 MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG---------------- C6 MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG---------------- ********************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 384 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 384 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11680] Library Relaxation: Multi_proc [96] Relaxation Summary: [11680]--->[11650] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.533 Mb, Max= 30.966 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 LLLPTLERILDGRAPAMVVVPAQHEPIAALRALRVGEEIDDDVALVATTS C2 LLLPTLERILDGRAPAMVVVPAQHEPIAALRALRVGEEIDDDVALVATTS C3 LLLPTLERILDGRAPAMVVVPAQHEPIAALRALRVGEEIDDDVALVATTS C4 LLLPTLERILDGRAPAMVVVPAQHEPIAALRALRVGEEIDDDVALVATTS C5 LLLPTLERILDGRAPAMVVVPAQHEPIAALRALRVGEEIDDDVALVATTS C6 LLLPTLERILDGRAPAMVVVPAQHEPIAALRALRVGEEIDDDVALVATTS ************************************************** C1 GTTGVPKGALLTAAALTASASATHDRLGGPGSWLLALPPYHIGGLQVLVR C2 GTTGVPKGALLTAAALTASASATHDRLGGPGSWLLALPPYHIGGLQVLVR C3 GTTGVPKGALLTAAALTASASATHDRLGGPGSWLLALPPYHIGGLQVLVR C4 GTTGVPKGALLTAAALTASASATHDRLGGPGSWLLALPPYHIGGLQVLVR C5 GTTGVPKGALLTAAALTASASATHDRLGGPGSWLLALPPYHIGGLQVLVR C6 GTTGVPKGALLTAAALTASASATHDRLGGPGSWLLALPPYHIGGLQVLVR ************************************************** C1 SVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRRYTSLVATQLAKALTDS C2 SVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRRYTSLVATQLAKALTDS C3 SVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRRYTSLVATQLAKALTDS C4 SVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRRYTSLVATQLAKALTDS C5 SVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRRYTSLVATQLAKALTDS C6 SVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRRYTSLVATQLAKALTDS ************************************************** C1 TATAVLAELDAVLVGGGPAPRPILDAATSAGIMVVGTYGMSETAGGCVYD C2 TATAVLAELDAVLVGGGPAPRPILDAATSAGIMVVGTYGMSETAGGCVYD C3 TATAVLAELDAVLVGGGPAPRPILDAATSAGIMVVGTYGMSETAGGCVYD C4 TATAVLAELDAVLVGGGPAPRPILDAATSAGIMVVGTYGMSETAGGCVYD C5 TATAVLAELDAVLVGGGPAPRPILDAATSAGIMVVGTYGMSETAGGCVYD C6 TATAVLAELDAVLVGGGPAPRPILDAATSAGIMVVGTYGMSETAGGCVYD ************************************************** C1 GVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVPDPFAESGWFHTDDLGT C2 GVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVPDPFAESGWFHTDDLGT C3 GVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVPDPFAESGWFHTDDLGT C4 GVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVPDPFAESGWFHTDDLGT C5 GVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVPDPFAESGWFHTDDLGT C6 GVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVPDPFAESGWFHTDDLGT ************************************************** C1 VDGSGVLTVLGRADDAISTGGLTVLPGPVEAALCTHPAVSDCAVFGLTDD C2 VDGSGVLTVLGRADDAISTGGLTVLPGPVEAALCTHPAVSDCAVFGLTDD C3 VDGSGVLTVLGRADDAISTGGLTVLPGPVEAALCTHPAVSDCAVFGLTDD C4 VDGSGVLTVLGRADDAISTGGLTVLPGPVEAALCTHPAVSDCAVFGLTDD C5 VDGSGVLTVLGRADDAISTGGLTVLPGPVEAALCTHPAVSDCAVFGLTDD C6 VDGSGVLTVLGRADDAISTGGLTVLPGPVEAALCTHPAVSDCAVFGLTDD ************************************************** C1 RLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDAMAAPRELHIVDTLPRR C2 RLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDAMAAPRELHIVDTLPRR C3 RLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDAMAAPRELHIVDTLPRR C4 RLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDAMAAPRELHIVDTLPRR C5 RLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDAMAAPRELHIVDTLPRR C6 RLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDAMAAPRELHIVDTLPRR ************************************************** C1 GIGKVDRTALVRRFAKSG C2 GIGKVDRTALVRRFAKSG C3 GIGKVDRTALVRRFAKSG C4 GIGKVDRTALVRRFAKSG C5 GIGKVDRTALVRRFAKSG C6 GIGKVDRTALVRRFAKSG ****************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT C2 ------------------------------------------------TT C3 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT C4 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT C5 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT C6 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT ** C1 GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG C2 GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG C3 GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG C4 GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG C5 GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG C6 GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG ************************************************** C1 TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA C2 TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA C3 TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA C4 TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA C5 TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA C6 TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA ************************************************** C1 GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG C2 GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG C3 GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG C4 GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG C5 GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG C6 GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG ************************************************** C1 AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG C2 AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG C3 AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG C4 AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG C5 AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG C6 AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG ************************************************** C1 CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG C2 CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG C3 CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG C4 CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG C5 CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG C6 CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG ************************************************** C1 CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG C2 CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG C3 CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG C4 CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG C5 CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG C6 CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG ************************************************** C1 CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG C2 CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG C3 CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG C4 CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG C5 CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG C6 CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG ************************************************** C1 ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA C2 ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA C3 ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA C4 ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA C5 ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA C6 ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA ************************************************** C1 TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC C2 TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC C3 TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC C4 TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC C5 TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC C6 TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC ************************************************** C1 GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC C2 GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC C3 GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC C4 GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC C5 GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC C6 GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC ************************************************** C1 CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG C2 CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG C3 CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG C4 CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG C5 CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG C6 CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG ************************************************** C1 GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG C2 GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG C3 GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG C4 GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG C5 GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG C6 GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG ************************************************** C1 CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG C2 CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG C3 CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG C4 CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG C5 CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG C6 CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG ************************************************** C1 CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC C2 CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC C3 CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC C4 CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC C5 CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC C6 CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC ************************************************** C1 GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT C2 GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT C3 GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT C4 GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT C5 GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT C6 GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT ************************************************** C1 CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA C2 CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA C3 CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA C4 CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA C5 CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA C6 CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA ************************************************** C1 GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC C2 GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC C3 GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC C4 GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC C5 GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC C6 GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC ************************************************** C1 ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG C2 ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG C3 ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG C4 ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG C5 ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG C6 ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG ************************************************** C1 GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA C2 GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA C3 GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA C4 GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA C5 GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA C6 GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA ************************************************** C1 CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC C2 CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC C3 CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC C4 CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC C5 CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC C6 CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC ************************************************** C1 ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG C2 ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG C3 ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG C4 ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG C5 ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG C6 ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG ************************************************** C1 CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG C2 CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG C3 CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG C4 CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG C5 CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG C6 CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG ************************************************** C1 GT------------------------------------------------ C2 GT------------------------------------------------ C3 GT------------------------------------------------ C4 GT------------------------------------------------ C5 GT------------------------------------------------ C6 GT------------------------------------------------ ** >C1 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG GT------------------------------------------------ >C2 ------------------------------------------------TT GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG GT------------------------------------------------ >C3 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG GT------------------------------------------------ >C4 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG GT------------------------------------------------ >C5 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG GT------------------------------------------------ >C6 ATAGCCGTCCTTCGCTCGCTTAGCGTTACGTCGGGTTCCGCAGCTCCATT GTTGCTGCCCACGCTGGAACGAATCCTGGATGGCCGCGCTCCCGCAATGG TCGTGGTACCGGCTCAGCATGAACCCATCGCTGCGCTGCGTGCTTTGCGA GTAGGTGAAGAGATCGACGACGATGTGGCTTTAGTGGCCACCACGTCGGG AACGACAGGTGTGCCCAAGGGCGCCTTGCTGACTGCCGCCGCCTTGACTG CCAGCGCGTCGGCCACCCACGACCGCCTTGGTGGTCCGGGCAGCTGGCTG CTGGCTTTGCCGCCGTATCATATCGGCGGGCTTCAGGTGCTGGTGCGTAG CGTGCTGGCCGGTTCGGTACCCATCGAGTTGGACATTTCTGCCGGGTTTG ACCTCGCCAAACTGCCGGACGCGGTGGGTCGATTGGGTACCGGTCGACGA TACACGTCACTGGTCGCTACCCAGCTGGCCAAGGCGCTCACCGACTCAAC GGCCACGGCCGTGCTAGCCGAATTGGATGCCGTCCTCGTTGGTGGCGGAC CAGCTCCCCGGCCGATCCTGGATGCCGCAACATCTGCCGGCATCATGGTG GTCGGCACCTATGGGATGAGCGAGACTGCGGGAGGTTGCGTTTACGACGG CGTCCCGCTGGATGGTGTGTGCATACGCGTACTGGTCAATGGCCACGTAG CGATCGGTGGTGCGACCTTGGCCAAGGGCTATCGCAATCCGATCGTTCCC GACCCGTTCGCCGAATCGGGTTGGTTCCACACAGACGACCTCGGTACTGT CGATGGCTCGGGTGTGCTAACAGTGCTGGGTCGGGCCGACGACGCGATCA GCACGGGTGGGCTAACCGTGCTGCCAGGACCCGTCGAAGCTGCGCTGTGC ACCCATCCCGCGGTCAGCGACTGTGCGGTGTTCGGGCTTACTGACGACCG GCTAGGTCAGCGGGTAGTAGCCGCAGTGGTACTGACTGACGGTTACGCAA CGCCGACGCTGAGCATGTTGCGGGCACATGTCACCCGCAGACTGGACGCC ATGGCCGCACCGCGCGAGCTACACATCGTTGATACACTGCCACGACGTGG CATCGGAAAGGTCGATCGCACGGCGTTAGTGCGCCGGTTCGCCAAGTCCG GT------------------------------------------------ >C1 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C2 ooooooooooooooooLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C3 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C4 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C5 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG >C6 IAVLRSLSVTSGSAAPLLLPTLERILDGRAPAMVVVPAQHEPIAALRALR VGEEIDDDVALVATTSGTTGVPKGALLTAAALTASASATHDRLGGPGSWL LALPPYHIGGLQVLVRSVLAGSVPIELDISAGFDLAKLPDAVGRLGTGRR YTSLVATQLAKALTDSTATAVLAELDAVLVGGGPAPRPILDAATSAGIMV VGTYGMSETAGGCVYDGVPLDGVCIRVLVNGHVAIGGATLAKGYRNPIVP DPFAESGWFHTDDLGTVDGSGVLTVLGRADDAISTGGLTVLPGPVEAALC THPAVSDCAVFGLTDDRLGQRVVAAVVLTDGYATPTLSMLRAHVTRRLDA MAAPRELHIVDTLPRRGIGKVDRTALVRRFAKSG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1200 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579792583 Setting output file names to "/data/3res/menE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 694780100 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0066157553 Seed = 35893060 Swapseed = 1579792583 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 9 unique site patterns Division 2 has 8 unique site patterns Division 3 has 9 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2573.663456 -- -24.965149 Chain 2 -- -2573.663608 -- -24.965149 Chain 3 -- -2573.663456 -- -24.965149 Chain 4 -- -2573.656711 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2573.662934 -- -24.965149 Chain 2 -- -2573.656852 -- -24.965149 Chain 3 -- -2573.656854 -- -24.965149 Chain 4 -- -2573.662934 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2573.663] (-2573.664) (-2573.663) (-2573.657) * [-2573.663] (-2573.657) (-2573.657) (-2573.663) 500 -- (-1574.433) [-1558.514] (-1576.901) (-1599.889) * (-1584.373) [-1563.340] (-1595.754) (-1569.322) -- 0:00:00 1000 -- (-1568.091) (-1561.554) (-1571.788) [-1564.325] * (-1569.087) [-1560.816] (-1564.088) (-1566.766) -- 0:00:00 1500 -- (-1569.225) [-1561.403] (-1562.319) (-1561.938) * (-1562.918) [-1560.594] (-1561.708) (-1557.233) -- 0:00:00 2000 -- (-1563.094) [-1561.014] (-1560.113) (-1557.759) * (-1567.176) (-1568.116) [-1557.243] (-1562.699) -- 0:00:00 2500 -- (-1560.961) (-1554.843) (-1561.299) [-1558.802] * [-1560.222] (-1564.720) (-1560.070) (-1564.025) -- 0:00:00 3000 -- (-1557.475) [-1560.618] (-1566.251) (-1559.571) * (-1561.184) [-1560.076] (-1562.827) (-1564.498) -- 0:00:00 3500 -- (-1560.993) (-1562.425) (-1569.159) [-1559.617] * (-1563.751) (-1567.022) [-1564.520] (-1559.686) -- 0:00:00 4000 -- (-1557.454) (-1561.066) [-1555.677] (-1554.858) * (-1563.598) (-1557.628) (-1555.866) [-1560.103] -- 0:00:00 4500 -- (-1560.862) [-1558.324] (-1561.819) (-1568.941) * (-1556.135) [-1556.893] (-1557.790) (-1557.069) -- 0:00:00 5000 -- (-1557.809) (-1565.206) (-1554.684) [-1553.819] * [-1561.314] (-1561.699) (-1563.203) (-1556.248) -- 0:00:00 Average standard deviation of split frequencies: 0.109994 5500 -- [-1559.133] (-1564.585) (-1559.482) (-1567.997) * [-1566.322] (-1565.284) (-1571.391) (-1573.602) -- 0:03:00 6000 -- (-1561.787) (-1557.386) [-1557.594] (-1555.501) * (-1558.929) (-1553.338) (-1561.936) [-1558.803] -- 0:02:45 6500 -- (-1555.149) (-1559.939) (-1559.324) [-1557.585] * (-1573.667) [-1558.440] (-1567.431) (-1561.898) -- 0:02:32 7000 -- [-1556.291] (-1561.897) (-1565.504) (-1566.912) * (-1561.302) [-1559.326] (-1564.237) (-1560.080) -- 0:02:21 7500 -- (-1561.949) (-1555.178) [-1567.082] (-1560.632) * (-1568.298) (-1567.964) (-1559.410) [-1558.102] -- 0:02:12 8000 -- [-1559.406] (-1562.807) (-1562.802) (-1556.526) * (-1567.876) (-1566.618) (-1557.475) [-1558.674] -- 0:02:04 8500 -- (-1561.645) [-1560.831] (-1557.473) (-1558.752) * (-1555.344) (-1565.395) [-1562.657] (-1566.456) -- 0:01:56 9000 -- (-1563.709) (-1554.390) (-1560.055) [-1556.193] * (-1566.078) (-1570.068) [-1559.802] (-1560.483) -- 0:01:50 9500 -- (-1564.984) (-1562.313) (-1558.600) [-1556.898] * (-1563.762) (-1574.230) [-1563.734] (-1562.818) -- 0:01:44 10000 -- (-1564.145) [-1559.475] (-1558.788) (-1556.762) * (-1557.566) (-1562.198) (-1556.357) [-1557.770] -- 0:01:39 Average standard deviation of split frequencies: 0.078567 10500 -- (-1566.671) [-1556.929] (-1561.519) (-1562.212) * (-1560.112) (-1559.679) [-1558.913] (-1567.971) -- 0:01:34 11000 -- (-1573.725) [-1561.695] (-1569.790) (-1567.544) * [-1558.073] (-1559.495) (-1555.082) (-1565.815) -- 0:01:29 11500 -- (-1560.626) (-1565.925) (-1562.148) [-1561.178] * (-1564.099) [-1557.809] (-1574.983) (-1556.376) -- 0:01:25 12000 -- (-1562.188) (-1559.704) [-1557.254] (-1567.527) * [-1560.036] (-1556.600) (-1563.368) (-1559.807) -- 0:01:22 12500 -- (-1556.663) (-1560.610) [-1557.450] (-1568.130) * [-1563.604] (-1561.000) (-1554.603) (-1565.026) -- 0:01:19 13000 -- (-1556.797) [-1561.490] (-1559.591) (-1565.187) * (-1566.196) [-1563.100] (-1568.707) (-1564.762) -- 0:01:15 13500 -- (-1560.416) (-1562.629) (-1565.355) [-1556.606] * (-1560.341) (-1558.393) (-1563.195) [-1557.641] -- 0:01:13 14000 -- (-1568.497) [-1553.476] (-1570.014) (-1550.525) * (-1563.219) (-1555.040) [-1560.248] (-1557.946) -- 0:01:10 14500 -- (-1571.673) [-1555.375] (-1559.055) (-1551.875) * (-1554.623) (-1563.119) (-1565.955) [-1562.096] -- 0:01:07 15000 -- (-1564.378) (-1561.527) [-1559.311] (-1552.702) * (-1556.170) (-1556.687) [-1561.314] (-1562.324) -- 0:01:05 Average standard deviation of split frequencies: 0.074358 15500 -- [-1558.571] (-1558.033) (-1559.301) (-1550.504) * (-1564.677) (-1555.211) [-1554.171] (-1564.573) -- 0:02:07 16000 -- (-1562.880) (-1558.422) (-1563.702) [-1552.132] * (-1558.356) [-1557.128] (-1551.828) (-1561.142) -- 0:02:03 16500 -- [-1560.755] (-1559.028) (-1565.446) (-1551.044) * (-1562.146) [-1561.516] (-1552.399) (-1563.675) -- 0:01:59 17000 -- (-1557.464) (-1560.632) [-1559.937] (-1553.223) * [-1554.719] (-1561.711) (-1554.528) (-1560.414) -- 0:01:55 17500 -- [-1565.154] (-1564.722) (-1559.189) (-1553.227) * (-1560.562) (-1566.138) (-1551.925) [-1562.374] -- 0:01:52 18000 -- (-1564.870) [-1560.218] (-1557.588) (-1551.342) * [-1561.099] (-1562.923) (-1552.902) (-1554.165) -- 0:01:49 18500 -- (-1565.167) (-1560.097) [-1564.177] (-1551.297) * (-1560.145) (-1555.997) (-1553.001) [-1557.570] -- 0:01:46 19000 -- [-1557.645] (-1562.412) (-1570.057) (-1552.170) * [-1558.451] (-1561.066) (-1553.410) (-1556.859) -- 0:01:43 19500 -- (-1559.695) (-1563.766) (-1558.713) [-1550.893] * (-1559.813) [-1559.850] (-1551.788) (-1566.448) -- 0:01:40 20000 -- [-1563.419] (-1557.385) (-1564.042) (-1552.109) * (-1558.861) (-1566.766) (-1551.531) [-1561.707] -- 0:01:38 Average standard deviation of split frequencies: 0.063868 20500 -- (-1563.374) [-1563.757] (-1557.306) (-1551.028) * (-1560.265) (-1563.515) (-1550.680) [-1563.454] -- 0:01:35 21000 -- (-1559.414) (-1563.021) (-1560.274) [-1552.157] * (-1560.899) [-1560.186] (-1551.645) (-1555.791) -- 0:01:33 21500 -- (-1561.654) (-1570.332) (-1555.829) [-1553.651] * (-1561.920) (-1558.019) [-1550.829] (-1558.336) -- 0:01:31 22000 -- (-1561.566) (-1560.872) [-1558.727] (-1553.708) * (-1557.654) (-1564.155) [-1550.999] (-1563.860) -- 0:01:28 22500 -- [-1566.895] (-1559.212) (-1556.222) (-1553.889) * (-1559.256) [-1559.277] (-1551.004) (-1551.786) -- 0:01:26 23000 -- (-1560.273) [-1558.560] (-1566.090) (-1554.309) * (-1562.702) (-1555.366) [-1550.216] (-1551.786) -- 0:01:24 23500 -- (-1557.444) (-1565.427) [-1560.403] (-1552.937) * (-1559.784) (-1554.540) (-1552.388) [-1553.184] -- 0:01:23 24000 -- (-1563.092) (-1561.169) (-1562.941) [-1551.428] * (-1565.204) (-1554.275) (-1550.232) [-1553.374] -- 0:01:21 24500 -- (-1569.643) (-1565.027) [-1563.417] (-1549.941) * (-1561.458) (-1551.734) (-1551.121) [-1555.663] -- 0:01:19 25000 -- [-1563.640] (-1560.746) (-1564.089) (-1550.077) * (-1564.149) [-1551.829] (-1550.137) (-1555.404) -- 0:01:18 Average standard deviation of split frequencies: 0.056041 25500 -- (-1557.548) [-1556.223] (-1558.095) (-1549.564) * (-1561.168) (-1552.488) [-1549.745] (-1555.562) -- 0:01:54 26000 -- [-1560.885] (-1560.743) (-1558.317) (-1549.666) * (-1557.883) [-1553.102] (-1550.205) (-1557.154) -- 0:01:52 26500 -- (-1563.056) (-1567.490) [-1567.692] (-1550.839) * (-1564.292) (-1552.857) [-1552.994] (-1551.063) -- 0:01:50 27000 -- (-1565.047) [-1558.163] (-1555.966) (-1549.595) * [-1563.871] (-1557.745) (-1552.994) (-1553.766) -- 0:01:48 27500 -- (-1556.437) [-1569.431] (-1559.640) (-1552.924) * (-1563.824) [-1555.767] (-1551.607) (-1555.746) -- 0:01:46 28000 -- (-1571.074) (-1560.854) (-1558.512) [-1551.651] * (-1561.377) [-1552.076] (-1551.921) (-1553.977) -- 0:01:44 28500 -- (-1564.981) [-1558.095] (-1562.875) (-1552.126) * [-1555.719] (-1551.437) (-1553.147) (-1554.560) -- 0:01:42 29000 -- (-1564.742) (-1558.323) [-1558.596] (-1549.817) * (-1563.239) (-1551.807) [-1552.117] (-1555.207) -- 0:01:40 29500 -- (-1556.428) [-1563.165] (-1564.885) (-1551.613) * (-1562.078) (-1552.357) (-1552.166) [-1557.711] -- 0:01:38 30000 -- [-1559.367] (-1557.381) (-1559.348) (-1554.570) * (-1561.662) [-1553.002] (-1551.873) (-1554.624) -- 0:01:37 Average standard deviation of split frequencies: 0.050508 30500 -- [-1571.643] (-1559.472) (-1560.854) (-1553.465) * [-1557.697] (-1555.939) (-1552.797) (-1554.764) -- 0:01:35 31000 -- (-1562.701) [-1556.965] (-1567.884) (-1553.347) * (-1562.558) [-1552.513] (-1550.471) (-1552.178) -- 0:01:33 31500 -- [-1563.681] (-1557.326) (-1554.690) (-1553.898) * (-1565.349) (-1550.886) [-1550.167] (-1551.780) -- 0:01:32 32000 -- (-1568.514) [-1563.798] (-1558.778) (-1552.452) * (-1566.953) (-1550.254) (-1550.111) [-1553.692] -- 0:01:30 32500 -- (-1565.431) [-1559.446] (-1571.407) (-1552.110) * [-1557.353] (-1551.789) (-1550.610) (-1553.072) -- 0:01:29 33000 -- (-1556.894) (-1562.813) (-1558.516) [-1550.610] * (-1558.908) [-1551.746] (-1550.468) (-1554.372) -- 0:01:27 33500 -- (-1557.963) (-1562.127) (-1560.401) [-1550.610] * (-1556.856) [-1550.393] (-1550.139) (-1552.713) -- 0:01:26 34000 -- [-1557.348] (-1567.765) (-1558.318) (-1551.012) * (-1562.560) (-1550.159) [-1555.028] (-1553.753) -- 0:01:25 34500 -- [-1564.250] (-1558.188) (-1565.013) (-1551.037) * [-1556.230] (-1552.984) (-1551.385) (-1551.642) -- 0:01:23 35000 -- (-1559.979) (-1565.972) [-1561.415] (-1552.813) * (-1561.390) [-1552.804] (-1552.933) (-1553.764) -- 0:01:22 Average standard deviation of split frequencies: 0.038714 35500 -- (-1563.818) (-1564.904) (-1566.869) [-1552.759] * (-1562.953) (-1551.611) [-1551.145] (-1553.695) -- 0:01:48 36000 -- (-1565.122) (-1563.822) [-1560.455] (-1551.200) * (-1559.838) [-1552.211] (-1550.264) (-1553.200) -- 0:01:47 36500 -- (-1567.918) (-1563.287) (-1566.839) [-1550.155] * [-1554.978] (-1552.874) (-1552.329) (-1553.449) -- 0:01:45 37000 -- (-1576.524) (-1564.507) (-1559.952) [-1549.971] * (-1564.218) (-1554.314) [-1550.430] (-1551.890) -- 0:01:44 37500 -- [-1550.411] (-1562.403) (-1561.813) (-1549.974) * (-1561.338) (-1554.956) [-1551.325] (-1552.185) -- 0:01:42 38000 -- (-1554.505) [-1558.938] (-1563.572) (-1551.732) * (-1556.982) (-1553.678) [-1550.806] (-1551.749) -- 0:01:41 38500 -- (-1557.302) (-1575.229) [-1559.755] (-1552.145) * (-1559.113) (-1553.006) [-1556.037] (-1551.418) -- 0:01:39 39000 -- (-1556.242) [-1556.490] (-1572.879) (-1553.921) * (-1561.764) [-1550.680] (-1555.594) (-1554.029) -- 0:01:38 39500 -- (-1554.143) (-1564.683) (-1553.604) [-1552.606] * (-1557.726) (-1550.407) (-1554.608) [-1556.724] -- 0:01:37 40000 -- (-1553.562) (-1560.731) (-1550.812) [-1553.186] * (-1561.110) (-1550.452) [-1550.579] (-1554.928) -- 0:01:36 Average standard deviation of split frequencies: 0.034224 40500 -- (-1557.593) [-1560.630] (-1549.933) (-1552.527) * (-1581.200) (-1554.885) (-1550.897) [-1550.510] -- 0:01:34 41000 -- (-1553.901) (-1562.537) [-1550.635] (-1552.572) * [-1563.015] (-1555.096) (-1552.755) (-1550.510) -- 0:01:33 41500 -- [-1554.512] (-1556.434) (-1553.326) (-1551.920) * [-1556.576] (-1554.537) (-1550.380) (-1550.753) -- 0:01:32 42000 -- (-1552.955) [-1559.370] (-1551.384) (-1550.759) * (-1575.636) [-1551.819] (-1551.457) (-1550.076) -- 0:01:31 42500 -- [-1551.729] (-1559.226) (-1549.893) (-1551.883) * (-1563.237) [-1551.788] (-1553.299) (-1551.046) -- 0:01:30 43000 -- (-1553.923) (-1562.565) [-1551.119] (-1551.094) * (-1558.197) (-1550.693) (-1553.082) [-1550.814] -- 0:01:29 43500 -- (-1552.974) [-1560.385] (-1551.297) (-1550.930) * (-1574.687) (-1550.751) [-1550.401] (-1550.839) -- 0:01:27 44000 -- (-1551.270) (-1563.708) (-1550.327) [-1551.228] * (-1559.794) [-1551.448] (-1550.621) (-1553.164) -- 0:01:26 44500 -- (-1554.753) (-1561.886) [-1550.225] (-1550.960) * (-1560.062) (-1555.393) [-1550.069] (-1552.751) -- 0:01:25 45000 -- [-1556.888] (-1562.525) (-1550.064) (-1550.548) * (-1564.683) (-1550.807) [-1552.995] (-1554.224) -- 0:01:24 Average standard deviation of split frequencies: 0.032607 45500 -- (-1559.938) (-1563.491) (-1549.996) [-1550.824] * (-1568.065) [-1550.842] (-1553.211) (-1552.046) -- 0:01:23 46000 -- (-1553.285) (-1564.120) (-1549.834) [-1550.390] * (-1556.473) (-1551.870) (-1553.114) [-1549.852] -- 0:01:43 46500 -- (-1552.747) [-1559.537] (-1553.128) (-1550.341) * (-1562.721) (-1553.217) (-1552.614) [-1550.721] -- 0:01:42 47000 -- (-1553.094) (-1565.416) (-1551.849) [-1550.345] * (-1560.326) (-1553.833) (-1551.158) [-1550.634] -- 0:01:41 47500 -- (-1551.656) (-1564.788) [-1550.988] (-1550.894) * (-1559.346) (-1553.417) [-1551.904] (-1552.082) -- 0:01:40 48000 -- (-1551.992) (-1561.618) [-1550.782] (-1552.187) * (-1556.748) (-1552.693) [-1554.398] (-1551.962) -- 0:01:39 48500 -- [-1551.147] (-1569.559) (-1552.100) (-1552.409) * (-1556.712) (-1555.806) (-1551.916) [-1550.498] -- 0:01:38 49000 -- (-1553.157) [-1560.287] (-1552.195) (-1551.010) * (-1561.034) (-1550.909) [-1552.398] (-1550.262) -- 0:01:37 49500 -- (-1551.408) (-1557.938) [-1549.779] (-1551.132) * [-1559.258] (-1550.174) (-1553.475) (-1550.073) -- 0:01:36 50000 -- [-1553.842] (-1557.053) (-1549.512) (-1550.943) * [-1559.060] (-1551.777) (-1550.413) (-1553.726) -- 0:01:35 Average standard deviation of split frequencies: 0.036370 50500 -- [-1555.146] (-1564.627) (-1556.046) (-1554.208) * (-1561.681) (-1553.347) [-1551.077] (-1552.159) -- 0:01:34 51000 -- (-1550.660) (-1564.401) (-1560.634) [-1551.589] * [-1558.599] (-1550.487) (-1553.041) (-1553.167) -- 0:01:33 51500 -- [-1550.086] (-1558.382) (-1559.364) (-1554.427) * (-1555.844) [-1550.920] (-1552.598) (-1556.054) -- 0:01:32 52000 -- (-1551.084) (-1564.141) [-1560.404] (-1555.912) * (-1567.197) [-1550.564] (-1552.797) (-1551.812) -- 0:01:31 52500 -- [-1550.817] (-1558.035) (-1553.146) (-1555.773) * (-1559.053) [-1550.705] (-1552.772) (-1552.180) -- 0:01:30 53000 -- (-1551.714) (-1564.019) [-1558.049] (-1553.270) * (-1560.511) (-1552.061) (-1552.040) [-1551.521] -- 0:01:29 53500 -- (-1551.647) (-1569.273) (-1555.947) [-1551.248] * [-1558.351] (-1550.571) (-1551.013) (-1551.915) -- 0:01:28 54000 -- [-1551.030] (-1566.367) (-1552.960) (-1552.737) * [-1560.621] (-1550.410) (-1551.480) (-1557.224) -- 0:01:27 54500 -- (-1554.483) [-1556.649] (-1550.751) (-1550.045) * (-1559.756) (-1552.508) (-1553.067) [-1556.683] -- 0:01:26 55000 -- (-1553.278) (-1559.906) [-1550.502] (-1552.554) * (-1562.184) (-1552.977) (-1551.124) [-1551.058] -- 0:01:25 Average standard deviation of split frequencies: 0.038482 55500 -- (-1550.837) [-1557.292] (-1549.899) (-1550.994) * (-1564.639) (-1552.960) [-1550.428] (-1556.118) -- 0:01:25 56000 -- (-1553.214) [-1559.973] (-1550.613) (-1550.809) * (-1564.121) [-1552.506] (-1550.582) (-1552.788) -- 0:01:24 56500 -- [-1556.419] (-1563.535) (-1553.671) (-1553.325) * (-1560.418) [-1553.278] (-1549.892) (-1551.782) -- 0:01:23 57000 -- (-1550.360) (-1567.736) (-1551.431) [-1551.249] * [-1563.490] (-1551.804) (-1550.025) (-1551.695) -- 0:01:22 57500 -- (-1550.755) (-1560.785) (-1553.097) [-1552.914] * (-1566.401) (-1552.229) (-1553.611) [-1551.292] -- 0:01:21 58000 -- [-1554.050] (-1557.274) (-1551.358) (-1552.570) * (-1563.361) [-1553.700] (-1551.216) (-1553.073) -- 0:01:37 58500 -- (-1553.773) (-1559.189) (-1552.190) [-1552.091] * (-1560.695) (-1554.643) [-1558.555] (-1553.769) -- 0:01:36 59000 -- (-1552.196) (-1568.127) (-1551.367) [-1552.182] * (-1556.719) (-1551.228) [-1551.900] (-1553.072) -- 0:01:35 59500 -- (-1549.989) (-1560.265) (-1554.013) [-1550.887] * (-1560.644) [-1551.557] (-1553.876) (-1552.111) -- 0:01:34 60000 -- [-1551.153] (-1583.500) (-1551.507) (-1554.680) * (-1560.895) (-1552.597) (-1552.385) [-1551.012] -- 0:01:34 Average standard deviation of split frequencies: 0.035522 60500 -- (-1550.383) (-1560.509) [-1552.320] (-1553.060) * [-1558.315] (-1552.041) (-1553.793) (-1550.858) -- 0:01:33 61000 -- (-1550.889) (-1551.379) (-1550.546) [-1552.870] * (-1560.940) [-1552.090] (-1553.283) (-1550.035) -- 0:01:32 61500 -- (-1551.992) [-1552.132] (-1551.907) (-1552.375) * (-1559.268) (-1555.279) (-1553.394) [-1551.779] -- 0:01:31 62000 -- (-1551.821) (-1550.092) [-1549.714] (-1556.357) * (-1559.824) (-1557.212) (-1553.055) [-1551.940] -- 0:01:30 62500 -- [-1551.675] (-1551.121) (-1551.868) (-1551.758) * [-1559.684] (-1557.879) (-1552.988) (-1551.160) -- 0:01:30 63000 -- (-1551.304) (-1551.132) [-1552.554] (-1549.886) * (-1560.307) (-1557.314) (-1553.424) [-1551.709] -- 0:01:29 63500 -- (-1552.564) [-1550.620] (-1550.101) (-1550.042) * (-1561.431) [-1551.716] (-1554.329) (-1551.260) -- 0:01:28 64000 -- (-1552.000) (-1550.976) [-1550.591] (-1552.385) * [-1565.514] (-1551.178) (-1553.526) (-1552.471) -- 0:01:27 64500 -- (-1555.969) [-1550.935] (-1553.213) (-1553.194) * (-1556.871) (-1552.265) (-1555.083) [-1553.661] -- 0:01:27 65000 -- (-1553.010) (-1552.143) [-1552.912] (-1551.611) * (-1564.566) (-1551.781) (-1553.625) [-1552.158] -- 0:01:26 Average standard deviation of split frequencies: 0.030611 65500 -- (-1553.986) (-1551.654) (-1554.779) [-1550.323] * (-1561.402) [-1550.777] (-1552.486) (-1551.408) -- 0:01:25 66000 -- (-1552.049) (-1552.025) (-1552.511) [-1550.535] * (-1568.311) [-1553.342] (-1552.604) (-1551.433) -- 0:01:24 66500 -- (-1551.929) (-1553.956) (-1551.009) [-1550.392] * (-1554.162) (-1555.379) [-1553.040] (-1552.023) -- 0:01:24 67000 -- (-1549.862) [-1551.524] (-1552.116) (-1550.130) * (-1556.277) (-1553.259) [-1555.701] (-1553.673) -- 0:01:23 67500 -- (-1551.595) (-1552.179) (-1551.005) [-1550.636] * (-1552.795) (-1554.544) (-1552.666) [-1554.481] -- 0:01:22 68000 -- (-1551.794) (-1550.754) [-1549.686] (-1551.465) * [-1551.395] (-1554.732) (-1551.519) (-1555.564) -- 0:01:22 68500 -- [-1549.851] (-1551.704) (-1549.945) (-1550.324) * (-1552.218) [-1553.714] (-1552.798) (-1552.496) -- 0:01:21 69000 -- [-1549.902] (-1550.381) (-1550.232) (-1551.624) * (-1550.787) (-1553.885) [-1553.249] (-1554.872) -- 0:01:20 69500 -- (-1552.253) [-1550.787] (-1549.960) (-1550.062) * [-1550.329] (-1554.085) (-1551.446) (-1555.702) -- 0:01:20 70000 -- [-1552.423] (-1550.601) (-1551.418) (-1550.842) * (-1551.655) (-1553.365) [-1555.931] (-1557.354) -- 0:01:33 Average standard deviation of split frequencies: 0.029225 70500 -- (-1553.915) [-1550.655] (-1552.131) (-1550.965) * (-1550.933) (-1550.776) [-1555.503] (-1553.752) -- 0:01:32 71000 -- (-1549.997) (-1551.394) [-1553.409] (-1551.139) * (-1552.530) (-1549.761) [-1551.209] (-1553.672) -- 0:01:31 71500 -- [-1550.960] (-1551.672) (-1557.060) (-1552.701) * [-1550.910] (-1550.419) (-1549.620) (-1553.155) -- 0:01:30 72000 -- (-1550.852) (-1550.424) (-1554.934) [-1552.561] * [-1550.012] (-1550.708) (-1549.684) (-1557.168) -- 0:01:30 72500 -- [-1550.432] (-1549.674) (-1551.262) (-1551.588) * (-1550.039) [-1550.269] (-1551.826) (-1556.454) -- 0:01:29 73000 -- (-1550.816) [-1550.949] (-1551.712) (-1554.204) * (-1549.926) (-1550.143) [-1551.245] (-1553.173) -- 0:01:28 73500 -- [-1551.485] (-1552.332) (-1551.516) (-1554.997) * [-1550.351] (-1550.695) (-1551.190) (-1551.534) -- 0:01:28 74000 -- (-1550.605) (-1550.324) [-1551.155] (-1553.458) * (-1550.440) [-1550.236] (-1550.503) (-1553.269) -- 0:01:27 74500 -- (-1550.000) (-1552.657) (-1552.199) [-1553.315] * [-1550.832] (-1550.868) (-1550.477) (-1552.671) -- 0:01:26 75000 -- [-1550.714] (-1553.737) (-1550.812) (-1552.663) * [-1552.798] (-1554.159) (-1551.822) (-1554.760) -- 0:01:26 Average standard deviation of split frequencies: 0.033952 75500 -- (-1550.264) (-1554.842) [-1550.159] (-1553.203) * [-1550.767] (-1551.467) (-1553.685) (-1560.920) -- 0:01:25 76000 -- [-1549.491] (-1550.926) (-1550.698) (-1553.960) * [-1551.822] (-1553.064) (-1550.849) (-1564.478) -- 0:01:25 76500 -- (-1550.569) (-1551.967) [-1550.965] (-1553.202) * (-1551.096) (-1559.466) [-1551.747] (-1561.414) -- 0:01:24 77000 -- (-1550.108) (-1551.950) [-1552.245] (-1553.329) * (-1551.110) [-1554.083] (-1550.398) (-1559.131) -- 0:01:23 77500 -- [-1552.215] (-1552.808) (-1550.813) (-1552.624) * [-1551.625] (-1553.368) (-1552.659) (-1559.218) -- 0:01:23 78000 -- (-1550.886) [-1555.195] (-1551.939) (-1551.112) * [-1552.095] (-1554.467) (-1551.185) (-1561.508) -- 0:01:22 78500 -- (-1550.380) (-1555.166) [-1550.549] (-1549.505) * [-1550.725] (-1553.596) (-1555.658) (-1553.371) -- 0:01:22 79000 -- (-1550.233) (-1553.891) [-1555.904] (-1550.557) * (-1554.161) (-1553.024) [-1550.707] (-1552.482) -- 0:01:21 79500 -- (-1554.579) (-1551.843) (-1552.582) [-1550.512] * (-1553.008) (-1550.052) (-1551.007) [-1556.666] -- 0:01:21 80000 -- (-1555.028) (-1550.815) [-1551.387] (-1551.134) * [-1552.101] (-1550.049) (-1552.286) (-1552.511) -- 0:01:20 Average standard deviation of split frequencies: 0.029527 80500 -- (-1553.678) (-1551.772) [-1551.126] (-1552.243) * (-1555.778) (-1550.845) [-1550.244] (-1553.900) -- 0:01:19 81000 -- (-1553.271) (-1551.396) (-1550.734) [-1551.191] * (-1550.722) [-1550.522] (-1552.083) (-1553.129) -- 0:01:19 81500 -- [-1550.398] (-1550.934) (-1553.154) (-1551.720) * (-1551.417) [-1552.454] (-1553.539) (-1554.071) -- 0:01:18 82000 -- [-1551.602] (-1550.625) (-1552.060) (-1551.002) * [-1551.743] (-1551.214) (-1554.172) (-1557.188) -- 0:01:29 82500 -- (-1551.939) (-1551.329) [-1551.352] (-1553.889) * [-1551.826] (-1551.225) (-1551.165) (-1552.448) -- 0:01:28 83000 -- (-1557.212) [-1552.220] (-1552.485) (-1550.712) * [-1550.955] (-1551.496) (-1550.797) (-1558.276) -- 0:01:28 83500 -- (-1555.034) (-1556.070) [-1552.656] (-1552.551) * (-1551.092) (-1550.998) (-1551.590) [-1554.127] -- 0:01:27 84000 -- [-1555.861] (-1550.865) (-1552.094) (-1552.590) * [-1551.031] (-1551.106) (-1551.563) (-1551.658) -- 0:01:27 84500 -- (-1554.987) [-1551.230] (-1551.203) (-1552.390) * [-1551.488] (-1551.569) (-1551.302) (-1553.194) -- 0:01:26 85000 -- (-1557.950) (-1550.188) [-1550.328] (-1551.098) * [-1553.887] (-1553.331) (-1553.101) (-1551.509) -- 0:01:26 Average standard deviation of split frequencies: 0.028273 85500 -- (-1552.352) (-1550.615) [-1552.325] (-1551.439) * (-1551.807) (-1550.165) (-1553.127) [-1550.792] -- 0:01:25 86000 -- (-1552.483) (-1550.372) [-1550.735] (-1550.946) * (-1552.617) [-1552.669] (-1551.421) (-1551.467) -- 0:01:25 86500 -- (-1553.483) [-1551.987] (-1555.187) (-1553.355) * [-1550.975] (-1554.530) (-1554.568) (-1551.099) -- 0:01:24 87000 -- (-1553.907) (-1551.851) [-1550.315] (-1555.002) * (-1551.774) [-1552.882] (-1552.700) (-1550.701) -- 0:01:23 87500 -- (-1551.110) (-1551.851) (-1552.716) [-1552.056] * (-1552.220) (-1551.461) (-1554.832) [-1550.701] -- 0:01:23 88000 -- (-1550.348) (-1553.077) (-1553.216) [-1551.846] * (-1552.299) (-1554.306) [-1552.468] (-1550.289) -- 0:01:22 88500 -- [-1549.805] (-1550.691) (-1550.988) (-1552.167) * (-1555.252) (-1550.706) [-1550.912] (-1550.691) -- 0:01:22 89000 -- (-1550.697) (-1556.991) [-1551.521] (-1554.339) * (-1557.284) [-1553.876] (-1552.795) (-1551.189) -- 0:01:21 89500 -- [-1551.385] (-1550.653) (-1551.578) (-1552.075) * [-1556.683] (-1553.651) (-1555.530) (-1551.469) -- 0:01:21 90000 -- (-1550.830) (-1551.241) (-1551.672) [-1550.201] * (-1554.730) (-1554.103) [-1550.545] (-1551.243) -- 0:01:20 Average standard deviation of split frequencies: 0.024957 90500 -- (-1553.479) (-1551.011) [-1550.569] (-1550.582) * [-1555.245] (-1552.422) (-1551.536) (-1552.435) -- 0:01:20 91000 -- (-1552.784) (-1550.381) [-1551.633] (-1551.375) * (-1556.015) [-1552.641] (-1553.434) (-1555.608) -- 0:01:19 91500 -- (-1552.894) [-1550.492] (-1551.439) (-1553.610) * (-1555.108) (-1554.149) [-1550.994] (-1555.624) -- 0:01:19 92000 -- (-1551.617) (-1550.801) (-1552.998) [-1550.827] * (-1554.223) (-1553.680) [-1553.514] (-1553.763) -- 0:01:18 92500 -- (-1550.831) (-1550.476) [-1551.683] (-1551.164) * [-1550.010] (-1550.726) (-1552.192) (-1551.238) -- 0:01:18 93000 -- (-1551.238) (-1552.258) [-1553.712] (-1551.497) * (-1553.504) (-1550.415) (-1556.496) [-1555.638] -- 0:01:18 93500 -- (-1550.447) (-1552.066) (-1553.628) [-1550.963] * (-1553.699) [-1553.002] (-1553.588) (-1554.009) -- 0:01:17 94000 -- [-1554.438] (-1551.897) (-1553.004) (-1551.154) * (-1556.731) (-1552.111) [-1553.455] (-1551.879) -- 0:01:26 94500 -- (-1554.798) (-1552.510) [-1554.314] (-1553.976) * (-1551.544) (-1550.593) (-1552.104) [-1555.088] -- 0:01:26 95000 -- (-1551.703) (-1552.026) (-1554.239) [-1552.548] * (-1553.577) (-1552.537) [-1551.184] (-1556.642) -- 0:01:25 Average standard deviation of split frequencies: 0.023816 95500 -- (-1552.387) (-1550.359) [-1553.605] (-1557.223) * (-1552.932) (-1549.769) [-1551.446] (-1556.589) -- 0:01:25 96000 -- (-1552.939) (-1551.160) [-1551.263] (-1552.537) * (-1552.850) (-1550.925) (-1551.112) [-1556.145] -- 0:01:24 96500 -- (-1552.133) (-1550.830) (-1552.386) [-1550.494] * (-1550.433) (-1551.001) (-1550.733) [-1558.209] -- 0:01:24 97000 -- [-1552.997] (-1551.203) (-1551.731) (-1551.359) * [-1551.225] (-1554.712) (-1552.400) (-1558.084) -- 0:01:23 97500 -- (-1552.540) (-1555.838) [-1550.239] (-1549.664) * [-1550.868] (-1551.821) (-1551.775) (-1556.547) -- 0:01:23 98000 -- [-1552.175] (-1554.464) (-1550.910) (-1550.200) * (-1552.918) (-1552.564) (-1549.772) [-1552.312] -- 0:01:22 98500 -- (-1555.345) (-1554.398) [-1552.815] (-1552.764) * [-1553.914] (-1551.917) (-1550.273) (-1551.761) -- 0:01:22 99000 -- [-1550.104] (-1551.977) (-1552.884) (-1550.566) * (-1553.091) (-1550.928) [-1550.169] (-1551.101) -- 0:01:21 99500 -- (-1555.205) (-1553.165) (-1553.632) [-1552.026] * [-1553.365] (-1550.073) (-1550.261) (-1552.061) -- 0:01:21 100000 -- (-1555.793) [-1551.890] (-1553.428) (-1549.846) * (-1553.529) (-1550.466) [-1553.280] (-1551.962) -- 0:01:21 Average standard deviation of split frequencies: 0.026090 100500 -- (-1557.532) [-1552.358] (-1552.954) (-1550.685) * (-1551.001) (-1551.647) [-1554.844] (-1551.105) -- 0:01:20 101000 -- (-1556.082) [-1551.841] (-1553.148) (-1552.083) * (-1552.328) (-1552.154) [-1552.889] (-1551.102) -- 0:01:20 101500 -- (-1554.123) (-1554.350) [-1553.199] (-1550.957) * (-1555.629) [-1550.596] (-1553.313) (-1550.449) -- 0:01:19 102000 -- [-1553.420] (-1551.126) (-1552.952) (-1553.062) * (-1554.574) (-1550.286) [-1553.463] (-1550.418) -- 0:01:19 102500 -- (-1553.416) (-1551.269) [-1551.296] (-1552.102) * (-1555.033) (-1553.689) (-1551.163) [-1550.550] -- 0:01:18 103000 -- (-1551.944) (-1551.280) (-1556.015) [-1552.012] * (-1552.882) (-1550.738) (-1552.916) [-1550.645] -- 0:01:18 103500 -- (-1552.196) (-1553.590) [-1555.995] (-1549.628) * (-1550.509) (-1554.066) [-1552.344] (-1552.470) -- 0:01:17 104000 -- (-1552.197) (-1553.590) [-1553.303] (-1550.963) * (-1552.469) (-1552.486) (-1555.135) [-1551.669] -- 0:01:17 104500 -- (-1551.350) [-1552.671] (-1553.145) (-1551.244) * (-1553.146) (-1549.683) (-1551.440) [-1553.583] -- 0:01:17 105000 -- (-1553.671) [-1551.851] (-1552.001) (-1551.806) * (-1552.355) (-1549.953) (-1552.694) [-1550.624] -- 0:01:16 Average standard deviation of split frequencies: 0.023045 105500 -- (-1555.004) [-1551.340] (-1551.939) (-1550.944) * [-1550.581] (-1550.215) (-1550.426) (-1551.353) -- 0:01:16 106000 -- (-1553.090) [-1551.089] (-1552.184) (-1551.531) * (-1550.576) [-1550.769] (-1550.313) (-1551.245) -- 0:01:24 106500 -- (-1551.620) [-1551.082] (-1553.202) (-1552.312) * (-1553.732) (-1550.788) (-1552.503) [-1552.080] -- 0:01:23 107000 -- (-1550.951) (-1552.105) (-1551.228) [-1553.808] * (-1552.269) (-1550.273) (-1552.405) [-1552.234] -- 0:01:23 107500 -- (-1551.704) (-1554.171) [-1550.346] (-1551.079) * (-1555.718) [-1552.228] (-1554.119) (-1550.946) -- 0:01:23 108000 -- (-1550.332) (-1550.387) (-1552.776) [-1550.127] * (-1551.588) (-1551.811) [-1551.168] (-1552.776) -- 0:01:22 108500 -- (-1551.647) (-1553.445) (-1560.984) [-1556.218] * (-1555.694) (-1550.791) (-1551.481) [-1552.189] -- 0:01:22 109000 -- (-1553.047) (-1553.844) (-1555.612) [-1552.280] * (-1551.474) (-1551.644) [-1551.032] (-1553.170) -- 0:01:21 109500 -- (-1551.775) [-1550.879] (-1555.612) (-1553.119) * (-1549.813) (-1551.648) (-1550.170) [-1552.278] -- 0:01:21 110000 -- [-1551.274] (-1551.009) (-1552.339) (-1555.766) * (-1550.849) [-1550.958] (-1550.609) (-1552.336) -- 0:01:20 Average standard deviation of split frequencies: 0.025171 110500 -- (-1551.505) [-1554.149] (-1550.218) (-1555.639) * (-1551.985) [-1551.143] (-1550.556) (-1552.740) -- 0:01:20 111000 -- [-1553.721] (-1552.549) (-1550.923) (-1554.396) * (-1552.159) (-1550.576) [-1552.240] (-1554.296) -- 0:01:20 111500 -- (-1550.852) (-1550.333) [-1550.161] (-1555.010) * (-1553.463) [-1550.344] (-1551.945) (-1557.270) -- 0:01:19 112000 -- [-1550.392] (-1552.982) (-1549.600) (-1556.392) * (-1555.610) (-1551.122) [-1551.099] (-1552.409) -- 0:01:19 112500 -- (-1550.472) (-1551.531) [-1550.468] (-1557.188) * (-1550.895) (-1550.079) (-1551.099) [-1550.887] -- 0:01:18 113000 -- (-1550.154) (-1550.961) [-1553.021] (-1554.023) * (-1551.327) (-1550.924) (-1551.558) [-1551.568] -- 0:01:18 113500 -- (-1550.528) [-1549.991] (-1550.571) (-1554.894) * (-1551.126) (-1553.221) (-1550.786) [-1550.483] -- 0:01:18 114000 -- (-1550.386) [-1549.775] (-1550.336) (-1552.651) * (-1551.037) (-1551.625) [-1550.786] (-1554.012) -- 0:01:17 114500 -- [-1551.446] (-1550.735) (-1551.067) (-1550.281) * [-1550.716] (-1552.198) (-1551.379) (-1554.009) -- 0:01:17 115000 -- [-1550.323] (-1556.414) (-1552.140) (-1551.227) * (-1554.479) (-1553.376) (-1555.176) [-1551.174] -- 0:01:16 Average standard deviation of split frequencies: 0.022672 115500 -- (-1550.138) [-1555.508] (-1555.349) (-1551.543) * [-1554.877] (-1553.361) (-1554.714) (-1551.233) -- 0:01:16 116000 -- [-1550.059] (-1559.610) (-1552.001) (-1553.056) * (-1550.312) [-1553.316] (-1552.391) (-1550.863) -- 0:01:16 116500 -- [-1550.951] (-1557.413) (-1551.025) (-1553.064) * (-1555.295) (-1550.985) (-1552.531) [-1550.382] -- 0:01:15 117000 -- [-1550.948] (-1556.588) (-1551.025) (-1553.925) * (-1552.337) (-1552.282) (-1551.045) [-1552.004] -- 0:01:15 117500 -- [-1550.328] (-1558.067) (-1552.114) (-1552.276) * [-1551.884] (-1555.145) (-1555.394) (-1551.651) -- 0:01:15 118000 -- (-1553.491) (-1558.523) (-1552.030) [-1551.767] * (-1551.993) (-1552.638) (-1555.051) [-1551.934] -- 0:01:22 118500 -- (-1549.677) (-1551.792) (-1551.977) [-1554.486] * (-1552.710) [-1551.062] (-1552.786) (-1552.964) -- 0:01:21 119000 -- [-1550.168] (-1552.887) (-1550.086) (-1554.035) * (-1554.212) (-1550.655) (-1550.494) [-1553.412] -- 0:01:21 119500 -- (-1549.536) [-1552.569] (-1549.891) (-1553.837) * (-1552.935) (-1552.504) (-1554.856) [-1551.585] -- 0:01:21 120000 -- (-1550.894) (-1553.044) (-1549.788) [-1554.643] * (-1558.404) (-1552.476) [-1553.326] (-1552.012) -- 0:01:20 Average standard deviation of split frequencies: 0.022789 120500 -- (-1551.539) [-1554.661] (-1550.979) (-1552.627) * (-1553.400) [-1550.092] (-1552.973) (-1553.389) -- 0:01:20 121000 -- (-1554.495) (-1552.997) [-1551.190] (-1553.847) * (-1553.482) (-1553.501) (-1551.058) [-1550.488] -- 0:01:19 121500 -- (-1552.942) [-1551.412] (-1551.176) (-1553.252) * (-1550.415) [-1553.731] (-1551.399) (-1550.270) -- 0:01:19 122000 -- [-1553.251] (-1552.742) (-1554.138) (-1555.241) * (-1553.257) (-1551.568) [-1551.387] (-1550.278) -- 0:01:19 122500 -- [-1551.892] (-1553.295) (-1551.831) (-1551.853) * (-1551.442) (-1551.043) [-1551.288] (-1551.994) -- 0:01:18 123000 -- [-1553.060] (-1555.317) (-1553.911) (-1554.581) * (-1551.701) (-1550.703) (-1553.972) [-1555.204] -- 0:01:18 123500 -- (-1552.338) [-1554.346] (-1556.489) (-1560.750) * (-1550.941) [-1551.342] (-1555.045) (-1550.936) -- 0:01:18 124000 -- [-1555.309] (-1552.877) (-1553.810) (-1551.439) * (-1551.859) [-1554.280] (-1551.085) (-1556.890) -- 0:01:17 124500 -- (-1552.170) (-1554.607) (-1553.471) [-1551.295] * (-1552.398) [-1552.193] (-1550.639) (-1557.674) -- 0:01:17 125000 -- [-1553.084] (-1552.158) (-1551.689) (-1551.879) * (-1552.258) (-1554.358) [-1553.260] (-1552.762) -- 0:01:17 Average standard deviation of split frequencies: 0.019691 125500 -- [-1552.514] (-1553.586) (-1550.779) (-1553.770) * (-1551.320) [-1550.336] (-1554.162) (-1554.764) -- 0:01:16 126000 -- (-1551.645) (-1554.560) [-1553.146] (-1552.952) * (-1553.448) (-1550.852) (-1554.932) [-1552.432] -- 0:01:16 126500 -- [-1552.604] (-1551.025) (-1551.504) (-1555.610) * (-1553.802) (-1550.527) [-1555.783] (-1552.802) -- 0:01:15 127000 -- (-1555.400) (-1552.303) [-1553.055] (-1553.186) * (-1553.573) [-1550.892] (-1551.400) (-1552.825) -- 0:01:15 127500 -- (-1553.193) (-1552.511) (-1552.735) [-1551.514] * (-1554.249) [-1551.781] (-1553.204) (-1559.217) -- 0:01:15 128000 -- (-1552.115) [-1552.995] (-1553.814) (-1551.273) * [-1553.027] (-1551.830) (-1553.852) (-1554.013) -- 0:01:14 128500 -- (-1551.348) (-1553.675) [-1552.293] (-1553.097) * (-1555.731) (-1551.572) (-1552.104) [-1551.523] -- 0:01:14 129000 -- (-1555.615) [-1550.679] (-1553.103) (-1555.088) * (-1553.182) (-1552.052) (-1552.775) [-1551.603] -- 0:01:14 129500 -- (-1554.531) (-1554.491) [-1550.967] (-1550.792) * (-1552.384) [-1552.168] (-1553.006) (-1549.676) -- 0:01:13 130000 -- (-1552.005) (-1552.033) (-1551.136) [-1550.683] * [-1549.963] (-1552.366) (-1553.812) (-1550.630) -- 0:01:20 Average standard deviation of split frequencies: 0.019041 130500 -- (-1550.708) (-1550.664) (-1551.335) [-1550.029] * [-1550.483] (-1550.530) (-1555.120) (-1550.110) -- 0:01:19 131000 -- [-1554.223] (-1550.875) (-1551.982) (-1550.128) * [-1550.478] (-1550.763) (-1557.173) (-1549.990) -- 0:01:19 131500 -- (-1553.144) [-1553.321] (-1552.224) (-1551.365) * (-1550.759) (-1549.829) (-1554.773) [-1549.992] -- 0:01:19 132000 -- [-1550.633] (-1555.708) (-1551.697) (-1553.699) * (-1553.424) [-1550.701] (-1555.572) (-1549.650) -- 0:01:18 132500 -- (-1552.411) (-1551.589) (-1550.133) [-1549.671] * (-1550.760) [-1550.821] (-1558.088) (-1550.533) -- 0:01:18 133000 -- (-1553.279) (-1552.141) [-1551.193] (-1550.651) * [-1550.714] (-1551.501) (-1552.187) (-1551.602) -- 0:01:18 133500 -- [-1551.779] (-1551.156) (-1550.585) (-1549.683) * (-1550.457) [-1551.872] (-1555.511) (-1550.561) -- 0:01:17 134000 -- (-1549.975) (-1556.882) [-1551.512] (-1550.268) * (-1553.511) (-1551.284) [-1553.307] (-1550.125) -- 0:01:17 134500 -- [-1550.801] (-1554.594) (-1551.004) (-1553.460) * (-1554.664) (-1551.327) (-1551.063) [-1550.319] -- 0:01:17 135000 -- (-1553.342) [-1551.361] (-1551.367) (-1553.972) * (-1552.102) (-1554.267) (-1554.183) [-1550.767] -- 0:01:16 Average standard deviation of split frequencies: 0.018061 135500 -- (-1550.338) [-1550.947] (-1551.553) (-1556.809) * (-1550.974) (-1550.631) (-1553.351) [-1551.079] -- 0:01:16 136000 -- (-1552.180) [-1550.883] (-1555.942) (-1557.898) * [-1551.551] (-1549.708) (-1556.263) (-1551.233) -- 0:01:16 136500 -- [-1552.099] (-1551.936) (-1558.630) (-1557.511) * (-1552.633) (-1549.953) [-1554.498] (-1551.757) -- 0:01:15 137000 -- (-1551.322) (-1554.411) (-1550.470) [-1553.915] * (-1551.626) [-1549.735] (-1554.096) (-1553.993) -- 0:01:15 137500 -- (-1550.133) (-1554.790) (-1550.465) [-1552.573] * (-1551.203) (-1551.490) [-1553.345] (-1551.706) -- 0:01:15 138000 -- (-1549.706) [-1550.865] (-1550.689) (-1550.707) * (-1551.070) (-1550.850) [-1552.993] (-1551.527) -- 0:01:14 138500 -- (-1553.165) [-1551.137] (-1553.584) (-1550.890) * (-1552.967) (-1550.429) [-1551.977] (-1551.735) -- 0:01:14 139000 -- [-1552.303] (-1552.651) (-1550.688) (-1555.091) * [-1552.484] (-1551.092) (-1552.512) (-1555.825) -- 0:01:14 139500 -- (-1551.783) (-1554.433) (-1550.568) [-1552.157] * (-1553.523) (-1553.306) [-1553.183] (-1554.000) -- 0:01:14 140000 -- (-1553.197) [-1552.451] (-1551.146) (-1552.681) * (-1551.308) (-1550.302) (-1554.577) [-1555.674] -- 0:01:13 Average standard deviation of split frequencies: 0.018696 140500 -- (-1551.532) [-1551.728] (-1551.450) (-1549.685) * (-1551.277) (-1550.952) (-1549.858) [-1554.227] -- 0:01:13 141000 -- (-1553.579) [-1550.926] (-1552.192) (-1549.774) * (-1551.334) (-1550.476) (-1549.858) [-1556.898] -- 0:01:13 141500 -- (-1554.992) (-1550.441) (-1552.938) [-1549.684] * [-1550.936] (-1552.898) (-1550.371) (-1556.984) -- 0:01:12 142000 -- (-1554.209) [-1550.698] (-1553.043) (-1550.864) * (-1552.407) [-1553.224] (-1552.217) (-1556.153) -- 0:01:12 142500 -- (-1551.460) (-1550.867) [-1550.778] (-1550.816) * (-1551.765) [-1552.323] (-1550.839) (-1551.441) -- 0:01:18 143000 -- (-1553.954) [-1551.232] (-1550.526) (-1550.387) * (-1551.812) [-1550.140] (-1550.557) (-1551.036) -- 0:01:17 143500 -- (-1553.091) (-1552.237) (-1550.492) [-1552.972] * (-1550.681) (-1556.716) [-1551.371] (-1550.015) -- 0:01:17 144000 -- (-1554.680) (-1556.036) (-1551.627) [-1554.217] * (-1552.001) (-1552.438) [-1550.262] (-1550.036) -- 0:01:17 144500 -- (-1551.235) [-1549.824] (-1551.509) (-1552.540) * [-1551.289] (-1553.814) (-1553.708) (-1553.026) -- 0:01:16 145000 -- [-1550.627] (-1554.670) (-1551.262) (-1551.997) * (-1550.654) (-1550.363) [-1551.352] (-1554.575) -- 0:01:16 Average standard deviation of split frequencies: 0.019050 145500 -- (-1551.179) (-1551.979) (-1550.563) [-1551.998] * (-1556.385) (-1551.054) (-1552.017) [-1553.179] -- 0:01:16 146000 -- (-1552.024) (-1552.384) [-1550.880] (-1550.482) * [-1549.960] (-1552.450) (-1550.246) (-1552.188) -- 0:01:16 146500 -- (-1554.018) [-1550.703] (-1550.402) (-1550.093) * (-1549.960) (-1551.931) [-1552.351] (-1551.121) -- 0:01:15 147000 -- (-1553.530) (-1550.852) [-1550.255] (-1550.093) * (-1551.109) (-1550.659) [-1549.766] (-1552.585) -- 0:01:15 147500 -- (-1551.304) (-1552.481) [-1550.296] (-1550.208) * (-1550.325) [-1550.206] (-1552.798) (-1551.484) -- 0:01:15 148000 -- (-1551.536) (-1550.512) [-1550.503] (-1549.869) * (-1550.473) (-1550.175) (-1550.279) [-1551.247] -- 0:01:14 148500 -- [-1549.994] (-1550.501) (-1550.498) (-1550.972) * [-1550.501] (-1550.043) (-1550.958) (-1551.887) -- 0:01:14 149000 -- (-1551.484) (-1551.268) [-1551.569] (-1549.800) * (-1550.503) (-1549.959) (-1549.924) [-1554.657] -- 0:01:14 149500 -- [-1550.344] (-1551.869) (-1551.112) (-1549.531) * (-1551.814) [-1549.729] (-1554.858) (-1551.631) -- 0:01:13 150000 -- (-1550.911) (-1551.819) (-1549.853) [-1550.803] * (-1552.141) (-1550.227) [-1552.235] (-1552.679) -- 0:01:13 Average standard deviation of split frequencies: 0.019369 150500 -- [-1549.912] (-1550.034) (-1552.962) (-1549.860) * (-1553.220) [-1551.147] (-1549.850) (-1550.953) -- 0:01:13 151000 -- (-1553.437) [-1551.149] (-1552.549) (-1550.665) * (-1550.974) (-1552.454) (-1550.101) [-1551.674] -- 0:01:13 151500 -- [-1549.626] (-1553.125) (-1552.085) (-1550.342) * (-1550.835) (-1552.118) (-1550.831) [-1551.605] -- 0:01:12 152000 -- (-1550.278) (-1550.370) [-1550.950] (-1550.342) * (-1552.963) [-1554.132] (-1551.166) (-1551.101) -- 0:01:12 152500 -- (-1550.335) (-1550.362) (-1550.434) [-1550.761] * (-1551.131) [-1551.461] (-1551.531) (-1550.591) -- 0:01:12 153000 -- (-1549.916) [-1550.415] (-1550.464) (-1550.801) * (-1551.275) (-1553.133) (-1551.401) [-1552.007] -- 0:01:11 153500 -- (-1550.700) [-1551.545] (-1550.811) (-1554.944) * (-1552.605) [-1551.275] (-1550.085) (-1551.569) -- 0:01:11 154000 -- [-1551.034] (-1554.512) (-1552.183) (-1556.941) * [-1552.722] (-1551.438) (-1552.207) (-1554.409) -- 0:01:11 154500 -- (-1550.379) (-1551.998) [-1552.092] (-1555.518) * [-1552.195] (-1552.999) (-1551.933) (-1552.360) -- 0:01:16 155000 -- (-1553.388) [-1551.626] (-1553.316) (-1554.341) * (-1554.409) [-1553.604] (-1553.251) (-1553.538) -- 0:01:16 Average standard deviation of split frequencies: 0.019340 155500 -- (-1555.937) (-1551.644) [-1554.287] (-1553.449) * (-1551.290) (-1551.968) (-1551.816) [-1552.052] -- 0:01:16 156000 -- (-1553.862) (-1550.710) [-1551.271] (-1552.131) * [-1551.543] (-1552.136) (-1550.974) (-1551.524) -- 0:01:15 156500 -- (-1552.957) (-1552.685) (-1551.548) [-1551.206] * (-1553.264) [-1554.044] (-1552.453) (-1551.412) -- 0:01:15 157000 -- [-1552.247] (-1550.094) (-1550.711) (-1550.224) * (-1552.611) (-1551.443) [-1553.152] (-1552.821) -- 0:01:15 157500 -- (-1553.134) (-1552.233) [-1550.843] (-1549.930) * (-1552.315) (-1553.897) (-1553.755) [-1551.342] -- 0:01:14 158000 -- (-1556.863) (-1555.626) [-1550.948] (-1550.936) * (-1550.650) (-1554.945) (-1551.348) [-1551.436] -- 0:01:14 158500 -- (-1554.880) (-1551.025) (-1552.863) [-1550.508] * (-1553.379) (-1550.285) [-1554.196] (-1557.067) -- 0:01:14 159000 -- (-1552.589) (-1554.220) (-1553.807) [-1556.327] * (-1552.313) (-1552.863) (-1553.028) [-1551.216] -- 0:01:14 159500 -- (-1551.190) [-1551.512] (-1552.793) (-1554.322) * (-1552.293) (-1552.315) [-1554.329] (-1553.284) -- 0:01:13 160000 -- (-1552.737) (-1551.304) [-1551.643] (-1552.028) * (-1551.367) [-1551.064] (-1551.930) (-1554.538) -- 0:01:13 Average standard deviation of split frequencies: 0.019886 160500 -- [-1551.098] (-1550.503) (-1553.033) (-1551.613) * (-1551.494) (-1553.209) [-1551.866] (-1555.330) -- 0:01:13 161000 -- (-1551.556) (-1555.924) [-1551.809] (-1551.680) * (-1553.761) (-1550.339) [-1551.764] (-1551.993) -- 0:01:12 161500 -- (-1550.961) (-1553.506) [-1551.414] (-1550.885) * (-1553.049) (-1551.216) [-1553.706] (-1554.982) -- 0:01:12 162000 -- (-1551.182) (-1552.705) [-1550.057] (-1551.101) * (-1552.218) (-1551.745) (-1552.192) [-1552.989] -- 0:01:12 162500 -- (-1550.896) (-1551.779) (-1551.107) [-1550.460] * (-1553.027) (-1552.818) [-1552.052] (-1552.444) -- 0:01:12 163000 -- (-1550.121) (-1551.136) (-1550.077) [-1550.249] * (-1550.868) [-1552.563] (-1550.246) (-1551.705) -- 0:01:11 163500 -- (-1551.074) (-1552.769) [-1550.176] (-1550.151) * (-1551.884) [-1552.122] (-1551.005) (-1550.636) -- 0:01:11 164000 -- (-1551.233) (-1553.135) [-1550.092] (-1550.151) * [-1553.811] (-1556.523) (-1550.707) (-1550.256) -- 0:01:11 164500 -- (-1551.283) (-1553.729) [-1550.120] (-1550.935) * (-1552.524) [-1554.070] (-1550.225) (-1550.296) -- 0:01:11 165000 -- (-1549.925) [-1551.479] (-1552.056) (-1550.592) * [-1552.847] (-1556.170) (-1550.033) (-1549.987) -- 0:01:10 Average standard deviation of split frequencies: 0.018317 165500 -- (-1550.601) (-1551.737) (-1551.744) [-1550.441] * (-1553.389) (-1552.255) [-1550.852] (-1550.795) -- 0:01:10 166000 -- (-1551.133) (-1555.679) (-1550.094) [-1551.411] * (-1550.445) (-1555.659) (-1551.156) [-1553.850] -- 0:01:10 166500 -- (-1551.378) (-1556.620) (-1549.982) [-1553.430] * [-1550.686] (-1553.303) (-1552.558) (-1552.698) -- 0:01:15 167000 -- (-1554.053) (-1553.303) [-1550.290] (-1558.331) * [-1550.493] (-1551.782) (-1551.926) (-1552.002) -- 0:01:14 167500 -- (-1550.891) (-1553.984) [-1551.783] (-1550.744) * (-1551.018) [-1552.065] (-1552.614) (-1552.037) -- 0:01:14 168000 -- (-1550.735) (-1552.102) [-1550.678] (-1550.917) * (-1551.555) [-1552.300] (-1551.801) (-1550.600) -- 0:01:14 168500 -- (-1553.189) (-1552.749) (-1550.716) [-1551.126] * (-1551.449) (-1551.572) (-1550.862) [-1552.944] -- 0:01:14 169000 -- (-1553.485) (-1552.757) [-1551.183] (-1552.610) * [-1550.397] (-1550.668) (-1551.714) (-1550.347) -- 0:01:13 169500 -- [-1555.904] (-1552.465) (-1551.079) (-1551.948) * (-1551.077) (-1555.087) (-1551.113) [-1551.596] -- 0:01:13 170000 -- [-1554.261] (-1558.356) (-1551.557) (-1554.730) * (-1550.262) (-1551.212) [-1552.004] (-1551.614) -- 0:01:13 Average standard deviation of split frequencies: 0.016864 170500 -- (-1552.824) (-1552.384) (-1552.456) [-1556.851] * (-1550.271) [-1550.812] (-1559.019) (-1551.742) -- 0:01:12 171000 -- (-1552.226) [-1551.712] (-1554.922) (-1552.710) * [-1552.121] (-1553.076) (-1554.629) (-1550.390) -- 0:01:12 171500 -- (-1552.217) (-1551.293) (-1554.889) [-1554.014] * (-1550.492) (-1552.064) [-1551.609] (-1550.197) -- 0:01:12 172000 -- (-1551.698) (-1550.262) (-1553.845) [-1556.004] * (-1551.585) (-1551.861) (-1554.133) [-1550.467] -- 0:01:12 172500 -- (-1551.275) [-1551.181] (-1554.251) (-1552.154) * (-1550.133) (-1552.665) [-1554.724] (-1552.817) -- 0:01:11 173000 -- (-1551.708) (-1550.201) [-1553.907] (-1551.950) * (-1551.175) (-1551.602) (-1553.453) [-1552.597] -- 0:01:11 173500 -- (-1551.437) [-1550.127] (-1552.749) (-1552.138) * (-1551.091) (-1549.576) (-1552.049) [-1554.146] -- 0:01:11 174000 -- (-1551.216) [-1550.061] (-1552.449) (-1553.034) * (-1551.024) [-1549.589] (-1554.620) (-1552.530) -- 0:01:11 174500 -- (-1553.262) [-1550.197] (-1552.834) (-1552.333) * (-1551.370) (-1549.846) (-1551.855) [-1551.170] -- 0:01:10 175000 -- (-1553.081) (-1550.610) (-1551.603) [-1551.604] * (-1551.272) [-1549.787] (-1554.472) (-1550.837) -- 0:01:10 Average standard deviation of split frequencies: 0.017008 175500 -- (-1554.452) (-1552.587) [-1552.502] (-1553.654) * (-1552.833) (-1551.187) (-1552.146) [-1551.923] -- 0:01:10 176000 -- (-1550.044) [-1553.395] (-1553.774) (-1552.114) * [-1550.868] (-1549.865) (-1550.310) (-1556.601) -- 0:01:10 176500 -- (-1551.652) (-1551.538) (-1556.329) [-1552.539] * (-1550.748) [-1551.350] (-1550.939) (-1557.967) -- 0:01:09 177000 -- (-1551.151) (-1551.519) [-1550.498] (-1553.061) * [-1551.969] (-1551.655) (-1550.804) (-1554.259) -- 0:01:09 177500 -- (-1553.312) [-1550.692] (-1553.326) (-1556.751) * (-1550.711) (-1551.014) [-1552.998] (-1551.913) -- 0:01:09 178000 -- (-1549.808) [-1551.606] (-1553.854) (-1553.583) * (-1550.657) (-1551.022) (-1560.599) [-1552.524] -- 0:01:09 178500 -- (-1552.896) [-1550.641] (-1556.842) (-1550.319) * (-1555.294) (-1553.308) (-1551.138) [-1554.819] -- 0:01:13 179000 -- (-1552.944) (-1550.813) [-1551.789] (-1553.943) * (-1551.433) (-1551.011) [-1551.185] (-1551.278) -- 0:01:13 179500 -- [-1555.306] (-1552.672) (-1553.968) (-1553.822) * (-1552.240) (-1551.741) [-1553.624] (-1552.737) -- 0:01:13 180000 -- (-1554.326) (-1554.407) [-1551.298] (-1553.822) * (-1552.087) (-1550.811) (-1553.778) [-1550.338] -- 0:01:12 Average standard deviation of split frequencies: 0.017715 180500 -- [-1553.420] (-1552.794) (-1551.492) (-1553.249) * (-1553.688) [-1550.963] (-1551.949) (-1551.508) -- 0:01:12 181000 -- [-1553.192] (-1554.802) (-1550.491) (-1552.866) * (-1552.865) [-1551.726] (-1552.960) (-1554.547) -- 0:01:12 181500 -- (-1553.439) (-1555.310) (-1550.503) [-1551.456] * [-1551.589] (-1551.732) (-1553.571) (-1553.038) -- 0:01:12 182000 -- (-1551.509) [-1552.257] (-1552.400) (-1551.296) * [-1551.006] (-1551.247) (-1553.258) (-1552.048) -- 0:01:11 182500 -- (-1555.284) (-1553.153) [-1550.269] (-1552.217) * (-1551.658) (-1549.786) (-1554.902) [-1554.979] -- 0:01:11 183000 -- (-1550.895) (-1551.600) [-1550.324] (-1552.226) * [-1550.548] (-1550.572) (-1551.984) (-1553.929) -- 0:01:11 183500 -- [-1551.080] (-1551.715) (-1550.213) (-1552.897) * (-1550.463) [-1550.026] (-1552.286) (-1550.398) -- 0:01:11 184000 -- (-1550.605) (-1557.370) (-1550.534) [-1552.199] * (-1550.820) (-1550.839) (-1551.324) [-1551.535] -- 0:01:10 184500 -- (-1550.968) (-1555.643) (-1550.683) [-1552.257] * [-1551.237] (-1550.780) (-1550.314) (-1551.805) -- 0:01:10 185000 -- (-1552.061) [-1556.026] (-1552.791) (-1550.524) * (-1550.689) (-1552.526) (-1551.142) [-1553.575] -- 0:01:10 Average standard deviation of split frequencies: 0.016541 185500 -- (-1557.004) [-1550.978] (-1554.526) (-1554.185) * [-1551.186] (-1551.241) (-1555.357) (-1552.461) -- 0:01:10 186000 -- (-1551.180) [-1551.674] (-1554.389) (-1552.630) * [-1552.279] (-1550.462) (-1557.498) (-1554.759) -- 0:01:10 186500 -- (-1551.347) (-1555.203) [-1551.459] (-1552.764) * [-1551.173] (-1552.155) (-1552.746) (-1551.832) -- 0:01:09 187000 -- (-1554.137) [-1552.620] (-1550.243) (-1550.975) * [-1550.369] (-1552.357) (-1552.679) (-1551.736) -- 0:01:09 187500 -- (-1551.433) (-1552.010) [-1550.779] (-1552.770) * (-1551.134) [-1550.944] (-1555.103) (-1553.178) -- 0:01:09 188000 -- (-1551.598) (-1550.106) (-1550.738) [-1551.249] * [-1554.796] (-1553.378) (-1557.775) (-1553.022) -- 0:01:09 188500 -- (-1550.865) (-1552.397) [-1553.222] (-1550.441) * (-1550.334) (-1556.826) [-1554.617] (-1551.583) -- 0:01:08 189000 -- (-1549.615) [-1553.702] (-1550.837) (-1551.023) * [-1550.186] (-1556.483) (-1552.565) (-1550.292) -- 0:01:08 189500 -- [-1550.290] (-1551.912) (-1550.628) (-1550.590) * (-1552.279) [-1550.761] (-1552.036) (-1550.059) -- 0:01:08 190000 -- (-1550.389) (-1551.898) (-1550.596) [-1550.871] * (-1556.649) [-1551.700] (-1550.401) (-1550.780) -- 0:01:08 Average standard deviation of split frequencies: 0.017957 190500 -- (-1555.271) [-1551.189] (-1550.832) (-1551.857) * [-1553.508] (-1555.196) (-1550.402) (-1553.886) -- 0:01:12 191000 -- (-1552.751) [-1553.419] (-1554.595) (-1552.272) * (-1551.821) (-1552.412) [-1550.213] (-1550.842) -- 0:01:12 191500 -- [-1551.643] (-1552.142) (-1549.898) (-1550.996) * (-1551.363) (-1550.176) (-1550.902) [-1550.542] -- 0:01:11 192000 -- [-1550.712] (-1550.041) (-1550.996) (-1552.358) * [-1551.539] (-1550.102) (-1552.479) (-1553.380) -- 0:01:11 192500 -- (-1552.884) [-1551.563] (-1550.713) (-1552.114) * (-1553.649) (-1553.901) (-1550.796) [-1550.589] -- 0:01:11 193000 -- (-1550.107) [-1553.418] (-1551.726) (-1552.457) * (-1552.307) [-1551.126] (-1551.811) (-1551.913) -- 0:01:11 193500 -- (-1552.105) [-1551.581] (-1552.327) (-1552.367) * (-1551.476) (-1551.867) [-1552.550] (-1551.239) -- 0:01:10 194000 -- (-1551.020) (-1553.025) [-1553.146] (-1552.978) * [-1549.841] (-1553.801) (-1553.057) (-1552.090) -- 0:01:10 194500 -- (-1552.036) [-1552.820] (-1551.637) (-1552.935) * (-1551.668) [-1554.580] (-1553.923) (-1552.451) -- 0:01:10 195000 -- [-1552.026] (-1550.227) (-1550.799) (-1550.431) * [-1551.338] (-1552.124) (-1554.782) (-1550.458) -- 0:01:10 Average standard deviation of split frequencies: 0.016569 195500 -- [-1552.428] (-1552.131) (-1550.544) (-1550.880) * (-1550.660) [-1554.012] (-1551.509) (-1550.864) -- 0:01:09 196000 -- [-1553.691] (-1553.018) (-1550.974) (-1551.527) * [-1550.640] (-1553.587) (-1550.683) (-1552.318) -- 0:01:09 196500 -- [-1551.948] (-1549.710) (-1550.918) (-1554.362) * [-1550.666] (-1558.260) (-1552.243) (-1552.199) -- 0:01:09 197000 -- (-1551.693) [-1552.310] (-1552.548) (-1553.463) * (-1552.481) [-1559.600] (-1551.168) (-1553.747) -- 0:01:09 197500 -- (-1552.237) [-1551.030] (-1551.975) (-1555.737) * (-1550.804) (-1551.354) [-1551.305] (-1552.801) -- 0:01:09 198000 -- (-1552.224) [-1552.759] (-1552.056) (-1550.796) * (-1551.368) (-1551.170) [-1551.259] (-1551.877) -- 0:01:08 198500 -- [-1551.715] (-1551.750) (-1550.573) (-1550.090) * (-1555.131) (-1551.087) [-1553.030] (-1551.819) -- 0:01:08 199000 -- (-1552.563) (-1554.891) [-1552.403] (-1549.975) * (-1551.640) (-1551.013) [-1551.909] (-1552.887) -- 0:01:08 199500 -- [-1551.616] (-1551.572) (-1551.194) (-1550.959) * [-1551.070] (-1552.959) (-1553.576) (-1552.555) -- 0:01:08 200000 -- (-1552.930) (-1551.632) [-1551.995] (-1550.640) * [-1551.443] (-1552.094) (-1556.015) (-1553.014) -- 0:01:08 Average standard deviation of split frequencies: 0.016183 200500 -- (-1554.231) (-1555.553) (-1550.750) [-1550.830] * (-1553.118) (-1550.441) [-1550.960] (-1553.380) -- 0:01:07 201000 -- (-1550.596) (-1549.861) (-1554.049) [-1549.946] * (-1551.365) (-1550.065) (-1552.866) [-1553.282] -- 0:01:07 201500 -- (-1552.153) [-1551.474] (-1550.861) (-1551.458) * (-1551.065) (-1550.824) (-1554.019) [-1551.650] -- 0:01:07 202000 -- [-1552.366] (-1555.323) (-1551.901) (-1551.168) * [-1551.077] (-1551.857) (-1553.579) (-1552.229) -- 0:01:07 202500 -- [-1552.259] (-1552.217) (-1553.649) (-1550.610) * (-1552.057) (-1551.850) (-1551.762) [-1551.125] -- 0:01:10 203000 -- (-1551.373) (-1552.315) [-1551.187] (-1549.660) * (-1555.370) [-1549.839] (-1552.005) (-1552.151) -- 0:01:10 203500 -- (-1553.680) (-1551.841) (-1549.647) [-1549.937] * (-1555.093) (-1549.944) (-1553.614) [-1550.137] -- 0:01:10 204000 -- [-1555.206] (-1552.226) (-1550.548) (-1552.196) * [-1550.947] (-1551.636) (-1551.723) (-1551.342) -- 0:01:10 204500 -- (-1552.642) (-1551.849) (-1550.811) [-1551.249] * [-1551.095] (-1552.511) (-1554.135) (-1552.269) -- 0:01:10 205000 -- [-1550.134] (-1554.868) (-1550.010) (-1552.413) * (-1554.977) (-1554.771) [-1553.714] (-1552.952) -- 0:01:09 Average standard deviation of split frequencies: 0.015891 205500 -- (-1552.755) (-1554.906) (-1551.409) [-1550.889] * [-1555.655] (-1552.363) (-1552.191) (-1551.314) -- 0:01:09 206000 -- (-1554.555) [-1556.115] (-1551.727) (-1551.209) * (-1553.355) (-1555.964) (-1552.890) [-1550.693] -- 0:01:09 206500 -- (-1553.361) (-1555.583) (-1551.781) [-1549.961] * (-1551.292) (-1551.956) [-1552.292] (-1550.694) -- 0:01:09 207000 -- (-1549.617) (-1551.010) (-1554.399) [-1551.287] * (-1552.005) (-1551.595) [-1552.656] (-1552.388) -- 0:01:08 207500 -- (-1550.835) (-1551.415) (-1554.189) [-1551.962] * (-1551.500) (-1552.882) (-1551.738) [-1550.966] -- 0:01:08 208000 -- (-1551.550) (-1552.842) (-1551.653) [-1552.686] * [-1551.854] (-1550.478) (-1553.937) (-1553.022) -- 0:01:08 208500 -- (-1551.799) (-1553.070) (-1552.194) [-1550.950] * (-1554.397) (-1553.271) (-1551.993) [-1555.732] -- 0:01:08 209000 -- [-1550.307] (-1550.016) (-1553.334) (-1551.084) * (-1552.209) [-1551.379] (-1550.931) (-1554.254) -- 0:01:08 209500 -- (-1551.638) (-1552.358) (-1552.350) [-1551.165] * [-1551.372] (-1551.599) (-1551.018) (-1554.391) -- 0:01:07 210000 -- (-1552.147) (-1553.131) (-1555.817) [-1552.174] * (-1551.866) [-1550.470] (-1559.427) (-1553.765) -- 0:01:07 Average standard deviation of split frequencies: 0.015546 210500 -- (-1551.689) (-1555.822) (-1555.743) [-1551.016] * (-1550.860) (-1550.509) (-1555.243) [-1556.465] -- 0:01:07 211000 -- (-1552.712) (-1555.183) (-1550.904) [-1555.387] * (-1553.344) (-1551.119) (-1554.744) [-1552.393] -- 0:01:07 211500 -- (-1551.654) [-1550.547] (-1551.260) (-1552.487) * (-1552.132) (-1551.177) [-1550.796] (-1551.714) -- 0:01:07 212000 -- (-1550.705) (-1553.178) [-1551.389] (-1553.228) * (-1552.135) (-1551.177) [-1551.863] (-1552.374) -- 0:01:06 212500 -- [-1553.249] (-1553.052) (-1554.466) (-1551.273) * (-1553.813) [-1550.097] (-1549.828) (-1552.363) -- 0:01:06 213000 -- (-1550.851) (-1551.375) [-1551.343] (-1550.397) * (-1551.233) (-1553.583) (-1554.017) [-1551.375] -- 0:01:06 213500 -- [-1550.872] (-1551.968) (-1550.679) (-1551.263) * (-1551.545) (-1552.031) [-1550.650] (-1551.164) -- 0:01:06 214000 -- (-1550.072) [-1550.703] (-1550.194) (-1551.161) * (-1554.947) (-1551.119) [-1556.786] (-1551.436) -- 0:01:06 214500 -- (-1553.048) (-1549.926) [-1550.082] (-1553.784) * [-1550.584] (-1550.472) (-1550.632) (-1549.791) -- 0:01:09 215000 -- (-1552.851) (-1551.883) (-1555.059) [-1551.404] * (-1553.241) (-1551.647) (-1550.465) [-1551.876] -- 0:01:09 Average standard deviation of split frequencies: 0.015641 215500 -- (-1552.243) (-1553.718) (-1554.540) [-1549.869] * (-1552.870) [-1553.775] (-1552.949) (-1553.430) -- 0:01:09 216000 -- (-1551.447) [-1551.863] (-1550.492) (-1549.882) * (-1552.039) (-1552.575) (-1551.259) [-1552.285] -- 0:01:08 216500 -- (-1552.173) (-1552.015) [-1552.020] (-1552.570) * (-1552.607) (-1550.781) (-1550.905) [-1551.874] -- 0:01:08 217000 -- (-1550.471) (-1556.074) (-1554.117) [-1552.271] * (-1552.752) (-1550.581) (-1550.437) [-1552.169] -- 0:01:08 217500 -- (-1552.436) [-1554.206] (-1551.128) (-1557.011) * (-1550.473) (-1555.067) (-1557.698) [-1552.820] -- 0:01:08 218000 -- [-1550.700] (-1553.930) (-1552.214) (-1551.566) * (-1555.164) (-1554.007) (-1556.278) [-1552.674] -- 0:01:08 218500 -- (-1550.872) [-1553.063] (-1552.946) (-1552.832) * [-1551.604] (-1553.192) (-1557.744) (-1552.275) -- 0:01:07 219000 -- (-1551.681) (-1551.609) [-1552.417] (-1552.174) * (-1555.420) [-1549.599] (-1552.109) (-1551.231) -- 0:01:07 219500 -- (-1559.085) [-1552.014] (-1552.747) (-1552.199) * (-1553.220) (-1552.990) [-1552.578] (-1552.143) -- 0:01:07 220000 -- (-1555.544) [-1551.642] (-1550.923) (-1554.392) * (-1553.467) [-1554.390] (-1550.508) (-1550.783) -- 0:01:07 Average standard deviation of split frequencies: 0.015547 220500 -- (-1551.098) [-1551.556] (-1552.350) (-1554.843) * (-1554.457) (-1554.025) (-1549.964) [-1550.643] -- 0:01:07 221000 -- (-1550.578) (-1551.898) [-1552.393] (-1554.213) * (-1551.449) (-1550.236) (-1550.380) [-1550.288] -- 0:01:06 221500 -- (-1552.483) [-1550.343] (-1551.584) (-1553.947) * (-1553.424) (-1554.370) (-1550.490) [-1551.975] -- 0:01:06 222000 -- [-1550.825] (-1550.973) (-1553.299) (-1553.922) * (-1553.104) (-1555.493) (-1550.524) [-1552.081] -- 0:01:06 222500 -- (-1552.006) (-1555.269) (-1550.448) [-1550.875] * (-1553.218) (-1553.540) [-1549.747] (-1551.200) -- 0:01:06 223000 -- (-1552.582) (-1550.738) [-1553.776] (-1551.723) * (-1554.182) [-1551.188] (-1549.541) (-1554.182) -- 0:01:06 223500 -- (-1550.617) (-1552.267) [-1552.740] (-1550.501) * (-1554.366) (-1549.920) (-1550.104) [-1551.049] -- 0:01:06 224000 -- (-1549.527) (-1552.084) (-1552.602) [-1550.887] * (-1552.041) (-1552.858) [-1551.754] (-1551.274) -- 0:01:05 224500 -- (-1549.517) (-1552.285) [-1552.207] (-1551.892) * (-1551.972) (-1552.291) [-1550.315] (-1551.320) -- 0:01:05 225000 -- (-1551.457) (-1551.050) [-1550.466] (-1552.622) * (-1550.933) (-1551.126) [-1551.964] (-1551.794) -- 0:01:05 Average standard deviation of split frequencies: 0.014810 225500 -- (-1551.209) (-1553.162) [-1550.996] (-1552.593) * (-1551.469) [-1549.684] (-1550.781) (-1550.982) -- 0:01:05 226000 -- (-1554.503) [-1551.357] (-1550.900) (-1554.462) * (-1559.781) [-1549.799] (-1552.221) (-1553.515) -- 0:01:05 226500 -- (-1557.063) [-1550.436] (-1550.032) (-1554.663) * (-1557.155) (-1549.994) (-1552.587) [-1552.948] -- 0:01:08 227000 -- [-1551.965] (-1551.754) (-1553.013) (-1554.079) * [-1554.151] (-1550.925) (-1551.522) (-1550.807) -- 0:01:08 227500 -- (-1551.778) (-1553.787) [-1552.679] (-1558.751) * (-1554.167) (-1550.674) [-1550.313] (-1551.524) -- 0:01:07 228000 -- (-1552.213) [-1553.649] (-1551.166) (-1559.786) * (-1553.096) (-1553.404) [-1549.927] (-1550.811) -- 0:01:07 228500 -- (-1554.513) (-1552.755) [-1551.150] (-1561.772) * (-1553.617) (-1553.650) [-1550.698] (-1550.748) -- 0:01:07 229000 -- (-1552.129) (-1552.798) [-1553.478] (-1564.740) * [-1551.310] (-1553.423) (-1550.322) (-1551.568) -- 0:01:07 229500 -- (-1552.136) (-1550.896) [-1554.352] (-1554.483) * (-1550.872) (-1553.800) [-1549.946] (-1551.520) -- 0:01:07 230000 -- (-1551.607) (-1553.693) [-1550.011] (-1553.332) * [-1549.729] (-1551.954) (-1551.367) (-1551.509) -- 0:01:06 Average standard deviation of split frequencies: 0.016656 230500 -- (-1551.341) [-1552.961] (-1554.231) (-1554.180) * (-1552.904) (-1551.185) (-1557.704) [-1551.509] -- 0:01:06 231000 -- (-1554.529) (-1551.915) [-1553.625] (-1550.996) * (-1551.864) (-1550.609) [-1558.450] (-1550.090) -- 0:01:06 231500 -- (-1554.023) (-1552.687) (-1554.916) [-1551.420] * (-1551.152) (-1552.348) (-1555.558) [-1550.358] -- 0:01:06 232000 -- [-1552.480] (-1553.294) (-1552.268) (-1558.054) * (-1551.066) (-1552.365) [-1553.296] (-1550.199) -- 0:01:06 232500 -- (-1558.293) [-1550.662] (-1553.458) (-1552.173) * [-1551.078] (-1550.178) (-1553.443) (-1549.617) -- 0:01:06 233000 -- (-1557.154) (-1551.221) [-1551.237] (-1552.173) * (-1550.778) (-1552.348) (-1552.903) [-1551.458] -- 0:01:05 233500 -- (-1557.744) (-1552.727) (-1551.422) [-1552.931] * [-1550.796] (-1552.393) (-1551.867) (-1551.443) -- 0:01:05 234000 -- (-1552.123) (-1552.205) (-1550.242) [-1550.398] * (-1551.043) [-1553.523] (-1553.660) (-1551.720) -- 0:01:05 234500 -- (-1555.384) [-1550.629] (-1550.242) (-1550.485) * (-1552.547) [-1555.941] (-1554.311) (-1550.598) -- 0:01:05 235000 -- (-1551.421) [-1550.281] (-1550.461) (-1550.445) * (-1550.874) (-1551.739) (-1555.083) [-1550.449] -- 0:01:05 Average standard deviation of split frequencies: 0.018188 235500 -- (-1550.545) [-1550.002] (-1560.395) (-1551.892) * [-1550.095] (-1550.330) (-1553.310) (-1551.020) -- 0:01:04 236000 -- (-1552.939) (-1551.234) (-1551.769) [-1551.711] * [-1550.064] (-1550.750) (-1551.344) (-1551.395) -- 0:01:04 236500 -- (-1552.511) (-1551.280) [-1552.149] (-1552.638) * [-1554.519] (-1551.157) (-1551.599) (-1551.035) -- 0:01:04 237000 -- (-1554.172) (-1550.865) [-1550.018] (-1551.700) * (-1551.935) (-1552.401) (-1552.347) [-1551.074] -- 0:01:04 237500 -- (-1553.551) (-1550.023) (-1550.149) [-1550.524] * [-1551.588] (-1549.923) (-1553.693) (-1550.326) -- 0:01:04 238000 -- (-1552.083) (-1550.498) (-1550.262) [-1550.623] * (-1552.206) (-1549.861) [-1553.988] (-1551.304) -- 0:01:04 238500 -- (-1550.663) (-1552.503) (-1552.611) [-1550.656] * (-1552.461) [-1550.334] (-1552.591) (-1550.321) -- 0:01:07 239000 -- (-1549.667) [-1552.195] (-1553.776) (-1552.026) * [-1552.281] (-1551.032) (-1551.482) (-1551.970) -- 0:01:06 239500 -- (-1550.700) (-1551.055) [-1553.596] (-1552.094) * (-1551.309) (-1550.463) [-1550.991] (-1552.020) -- 0:01:06 240000 -- (-1551.164) (-1551.202) (-1551.756) [-1553.253] * (-1550.808) [-1551.533] (-1551.840) (-1550.352) -- 0:01:06 Average standard deviation of split frequencies: 0.017010 240500 -- (-1554.370) (-1551.532) [-1552.867] (-1555.191) * (-1554.973) [-1550.675] (-1557.552) (-1552.312) -- 0:01:06 241000 -- (-1551.660) (-1550.534) (-1552.925) [-1552.944] * (-1551.300) (-1550.641) (-1552.472) [-1550.023] -- 0:01:06 241500 -- [-1552.628] (-1555.953) (-1552.545) (-1552.439) * (-1552.426) [-1550.905] (-1556.513) (-1550.023) -- 0:01:05 242000 -- (-1553.762) (-1552.840) [-1551.339] (-1553.019) * (-1552.736) [-1552.210] (-1559.835) (-1551.595) -- 0:01:05 242500 -- (-1552.654) [-1553.950] (-1550.836) (-1552.535) * (-1554.440) (-1552.799) (-1549.690) [-1552.207] -- 0:01:05 243000 -- [-1553.167] (-1551.060) (-1551.168) (-1550.802) * (-1553.448) (-1551.225) (-1551.072) [-1553.771] -- 0:01:05 243500 -- (-1554.894) [-1551.705] (-1551.244) (-1550.487) * (-1551.953) [-1550.603] (-1552.031) (-1554.298) -- 0:01:05 244000 -- (-1552.196) (-1551.115) (-1551.659) [-1550.100] * (-1556.490) (-1554.203) [-1552.288] (-1555.161) -- 0:01:05 244500 -- (-1554.340) (-1553.775) (-1551.171) [-1550.358] * (-1557.116) [-1553.702] (-1550.022) (-1551.938) -- 0:01:04 245000 -- (-1553.933) (-1550.151) [-1551.779] (-1552.339) * (-1558.702) [-1552.837] (-1550.804) (-1550.586) -- 0:01:04 Average standard deviation of split frequencies: 0.016137 245500 -- [-1554.783] (-1552.124) (-1550.631) (-1552.365) * (-1557.870) (-1551.529) [-1551.237] (-1554.321) -- 0:01:04 246000 -- [-1551.494] (-1552.004) (-1551.203) (-1554.782) * [-1550.957] (-1551.080) (-1553.609) (-1550.352) -- 0:01:04 246500 -- (-1551.154) (-1557.178) [-1553.569] (-1554.262) * (-1556.140) (-1551.066) (-1552.346) [-1551.199] -- 0:01:04 247000 -- (-1550.283) [-1555.185] (-1552.192) (-1553.595) * (-1553.998) (-1552.298) [-1551.026] (-1550.481) -- 0:01:04 247500 -- [-1557.256] (-1552.199) (-1551.840) (-1551.260) * (-1560.495) (-1552.602) [-1550.234] (-1549.751) -- 0:01:03 248000 -- [-1555.328] (-1552.775) (-1551.570) (-1553.759) * (-1553.462) (-1551.114) [-1554.819] (-1551.387) -- 0:01:03 248500 -- [-1553.043] (-1554.390) (-1551.462) (-1553.325) * (-1553.305) (-1553.447) (-1551.825) [-1551.136] -- 0:01:03 249000 -- (-1555.079) [-1553.894] (-1551.560) (-1550.552) * (-1555.161) (-1554.944) [-1556.264] (-1552.408) -- 0:01:03 249500 -- (-1551.718) (-1554.154) (-1551.695) [-1551.731] * [-1550.377] (-1552.022) (-1555.112) (-1552.725) -- 0:01:03 250000 -- (-1552.602) (-1552.409) (-1552.454) [-1551.585] * (-1556.958) (-1554.515) (-1552.764) [-1551.691] -- 0:01:03 Average standard deviation of split frequencies: 0.016727 250500 -- [-1554.003] (-1551.530) (-1550.672) (-1550.302) * (-1551.896) (-1552.829) (-1549.833) [-1553.858] -- 0:01:05 251000 -- (-1553.738) (-1552.048) (-1550.258) [-1550.847] * (-1550.000) (-1552.686) [-1551.134] (-1550.937) -- 0:01:05 251500 -- (-1553.284) [-1552.012] (-1554.230) (-1551.377) * [-1550.000] (-1554.207) (-1553.445) (-1552.203) -- 0:01:05 252000 -- (-1551.463) [-1553.129] (-1552.961) (-1551.311) * [-1550.096] (-1553.075) (-1551.095) (-1554.054) -- 0:01:05 252500 -- (-1554.873) (-1551.739) (-1553.829) [-1553.049] * (-1550.664) [-1554.847] (-1554.922) (-1552.337) -- 0:01:05 253000 -- (-1554.614) [-1550.719] (-1552.214) (-1556.661) * (-1549.825) (-1552.851) (-1551.839) [-1551.002] -- 0:01:04 253500 -- (-1553.622) (-1557.639) (-1552.250) [-1556.294] * (-1550.361) (-1551.994) [-1551.837] (-1551.613) -- 0:01:04 254000 -- [-1549.641] (-1550.927) (-1552.028) (-1555.361) * [-1550.241] (-1552.007) (-1550.617) (-1552.848) -- 0:01:04 254500 -- (-1551.897) (-1550.004) (-1551.269) [-1555.824] * (-1551.474) [-1551.698] (-1551.930) (-1552.021) -- 0:01:04 255000 -- (-1553.996) [-1551.479] (-1550.952) (-1552.782) * (-1554.720) [-1551.128] (-1555.624) (-1550.145) -- 0:01:04 Average standard deviation of split frequencies: 0.016282 255500 -- (-1558.101) (-1549.992) [-1549.874] (-1553.131) * [-1557.197] (-1552.433) (-1551.460) (-1560.752) -- 0:01:04 256000 -- (-1555.671) (-1550.506) [-1551.335] (-1554.115) * (-1551.473) (-1550.839) [-1552.442] (-1557.577) -- 0:01:03 256500 -- (-1551.073) (-1552.153) (-1552.013) [-1552.255] * (-1552.908) (-1553.162) [-1551.939] (-1556.997) -- 0:01:03 257000 -- (-1550.512) (-1555.254) (-1551.788) [-1550.950] * (-1552.530) (-1551.392) [-1551.991] (-1552.550) -- 0:01:03 257500 -- (-1551.074) (-1554.138) (-1551.790) [-1551.277] * (-1551.406) (-1550.306) (-1553.371) [-1551.732] -- 0:01:03 258000 -- (-1550.848) (-1554.388) [-1551.030] (-1554.704) * (-1553.293) [-1550.873] (-1550.731) (-1555.149) -- 0:01:03 258500 -- (-1552.108) (-1554.285) [-1552.671] (-1552.214) * [-1553.885] (-1553.195) (-1550.153) (-1554.104) -- 0:01:03 259000 -- (-1551.053) [-1553.538] (-1558.020) (-1553.235) * (-1554.647) (-1551.784) [-1551.353] (-1553.793) -- 0:01:02 259500 -- [-1550.904] (-1559.671) (-1551.619) (-1552.185) * [-1551.447] (-1552.097) (-1550.750) (-1555.220) -- 0:01:02 260000 -- (-1552.735) (-1559.028) (-1551.091) [-1552.440] * (-1551.322) [-1550.839] (-1550.332) (-1553.894) -- 0:01:02 Average standard deviation of split frequencies: 0.016181 260500 -- (-1552.009) (-1552.346) (-1552.325) [-1552.792] * (-1552.314) [-1550.056] (-1550.260) (-1552.988) -- 0:01:02 261000 -- (-1555.726) (-1555.663) (-1551.325) [-1552.019] * (-1551.283) [-1552.345] (-1551.765) (-1552.807) -- 0:01:02 261500 -- (-1554.438) (-1555.092) (-1554.149) [-1551.815] * [-1551.204] (-1554.789) (-1551.951) (-1552.831) -- 0:01:02 262000 -- (-1553.361) (-1552.397) (-1551.276) [-1552.292] * (-1554.498) [-1552.042] (-1555.733) (-1557.462) -- 0:01:01 262500 -- (-1552.785) [-1549.512] (-1551.625) (-1553.876) * [-1552.763] (-1551.797) (-1552.209) (-1553.092) -- 0:01:04 263000 -- (-1550.147) (-1549.501) (-1552.011) [-1552.928] * (-1551.187) [-1551.463] (-1550.685) (-1553.725) -- 0:01:04 263500 -- (-1550.253) (-1551.785) [-1551.699] (-1552.001) * (-1553.377) (-1551.199) [-1550.694] (-1552.573) -- 0:01:04 264000 -- [-1551.215] (-1552.733) (-1551.702) (-1552.530) * [-1551.046] (-1551.913) (-1551.272) (-1552.288) -- 0:01:04 264500 -- (-1554.359) [-1552.322] (-1553.662) (-1553.103) * (-1555.602) (-1551.087) (-1552.849) [-1550.814] -- 0:01:03 265000 -- (-1549.881) (-1550.506) (-1554.381) [-1550.659] * (-1552.712) (-1550.908) [-1552.767] (-1550.922) -- 0:01:03 Average standard deviation of split frequencies: 0.017256 265500 -- (-1553.836) (-1550.916) (-1552.498) [-1550.441] * (-1555.591) (-1553.118) [-1551.722] (-1551.900) -- 0:01:03 266000 -- (-1551.979) [-1549.981] (-1551.380) (-1555.958) * [-1553.839] (-1559.010) (-1556.456) (-1551.327) -- 0:01:03 266500 -- (-1550.606) (-1552.178) [-1550.709] (-1553.348) * [-1552.520] (-1552.857) (-1551.697) (-1551.711) -- 0:01:03 267000 -- (-1551.135) (-1551.460) [-1550.919] (-1551.466) * (-1553.941) [-1552.851] (-1551.742) (-1551.938) -- 0:01:03 267500 -- (-1552.025) [-1551.954] (-1551.337) (-1553.255) * (-1551.696) [-1553.683] (-1551.524) (-1550.527) -- 0:01:02 268000 -- (-1555.043) (-1553.200) [-1551.472] (-1555.131) * [-1553.015] (-1555.230) (-1550.180) (-1549.970) -- 0:01:02 268500 -- (-1557.925) (-1552.006) (-1551.848) [-1552.672] * [-1554.976] (-1557.457) (-1551.153) (-1550.342) -- 0:01:02 269000 -- (-1552.325) (-1550.157) [-1552.899] (-1552.321) * (-1552.174) [-1557.531] (-1550.348) (-1551.848) -- 0:01:02 269500 -- (-1552.402) (-1552.973) (-1552.947) [-1553.709] * (-1551.743) [-1554.452] (-1550.315) (-1550.207) -- 0:01:02 270000 -- (-1552.942) [-1552.696] (-1553.410) (-1553.232) * [-1551.960] (-1554.360) (-1550.317) (-1550.561) -- 0:01:02 Average standard deviation of split frequencies: 0.019066 270500 -- (-1556.578) (-1555.211) [-1552.092] (-1559.374) * (-1553.711) (-1557.269) [-1552.423] (-1551.240) -- 0:01:02 271000 -- (-1556.283) (-1552.997) (-1551.964) [-1553.492] * (-1552.731) [-1550.441] (-1551.718) (-1554.807) -- 0:01:01 271500 -- [-1551.169] (-1552.852) (-1553.193) (-1551.187) * (-1551.304) (-1550.309) [-1551.076] (-1552.415) -- 0:01:01 272000 -- [-1551.064] (-1551.726) (-1551.584) (-1552.880) * (-1553.724) (-1552.395) [-1551.253] (-1552.097) -- 0:01:04 272500 -- (-1551.201) [-1550.256] (-1553.108) (-1551.540) * (-1550.869) (-1552.949) (-1550.443) [-1552.053] -- 0:01:04 273000 -- [-1552.842] (-1551.592) (-1552.293) (-1553.200) * (-1551.645) (-1551.427) (-1550.364) [-1554.077] -- 0:01:03 273500 -- [-1555.116] (-1550.676) (-1554.777) (-1552.834) * (-1550.983) (-1551.363) (-1550.364) [-1553.114] -- 0:01:03 274000 -- (-1552.509) [-1550.641] (-1555.324) (-1552.475) * [-1552.371] (-1551.130) (-1554.711) (-1550.447) -- 0:01:03 274500 -- [-1551.398] (-1551.681) (-1552.777) (-1552.456) * [-1550.973] (-1551.945) (-1553.196) (-1552.037) -- 0:01:03 275000 -- [-1552.255] (-1550.755) (-1551.056) (-1551.312) * (-1552.653) (-1550.093) [-1551.024] (-1553.149) -- 0:01:03 Average standard deviation of split frequencies: 0.019058 275500 -- (-1552.704) (-1549.783) [-1552.404] (-1552.603) * [-1553.246] (-1551.016) (-1554.381) (-1553.270) -- 0:01:03 276000 -- [-1550.880] (-1551.291) (-1552.122) (-1550.950) * (-1551.684) (-1550.921) [-1552.240] (-1550.797) -- 0:01:02 276500 -- (-1550.365) (-1551.173) (-1552.879) [-1550.492] * (-1550.804) [-1550.810] (-1552.847) (-1553.963) -- 0:01:02 277000 -- (-1550.246) [-1553.263] (-1553.902) (-1554.195) * (-1551.171) (-1554.662) (-1551.687) [-1556.674] -- 0:01:02 277500 -- (-1550.462) (-1553.212) [-1551.692] (-1556.632) * (-1551.181) [-1550.582] (-1553.317) (-1556.486) -- 0:01:02 278000 -- (-1551.649) (-1556.232) [-1552.304] (-1557.652) * [-1550.445] (-1556.660) (-1552.055) (-1552.293) -- 0:01:02 278500 -- (-1551.385) [-1551.590] (-1551.669) (-1553.346) * (-1550.286) [-1551.362] (-1551.946) (-1552.279) -- 0:01:02 279000 -- [-1551.125] (-1551.822) (-1555.180) (-1557.634) * (-1550.429) [-1552.411] (-1551.672) (-1552.408) -- 0:01:02 279500 -- [-1551.118] (-1550.269) (-1554.194) (-1552.957) * [-1551.988] (-1552.624) (-1551.986) (-1553.092) -- 0:01:01 280000 -- [-1550.997] (-1551.115) (-1562.408) (-1556.300) * [-1552.002] (-1551.825) (-1559.683) (-1551.620) -- 0:01:01 Average standard deviation of split frequencies: 0.019271 280500 -- (-1551.739) [-1551.045] (-1556.458) (-1553.485) * [-1552.018] (-1553.618) (-1552.847) (-1551.207) -- 0:01:01 281000 -- (-1552.207) [-1551.730] (-1552.827) (-1551.997) * (-1552.830) (-1556.319) [-1552.866] (-1551.744) -- 0:01:01 281500 -- (-1550.565) (-1550.560) (-1553.985) [-1551.614] * (-1553.230) [-1553.044] (-1553.721) (-1552.049) -- 0:01:01 282000 -- (-1550.096) [-1555.375] (-1555.957) (-1559.794) * (-1553.442) (-1553.494) (-1555.048) [-1553.936] -- 0:01:01 282500 -- (-1551.428) (-1550.237) (-1554.914) [-1553.352] * [-1553.405] (-1551.395) (-1550.549) (-1554.855) -- 0:01:00 283000 -- [-1549.904] (-1550.230) (-1553.567) (-1551.678) * (-1550.823) (-1551.635) [-1551.213] (-1551.870) -- 0:01:00 283500 -- (-1551.280) (-1557.998) (-1552.302) [-1550.172] * (-1551.317) (-1553.018) [-1552.646] (-1551.079) -- 0:01:03 284000 -- (-1551.264) (-1552.531) (-1552.769) [-1551.171] * (-1551.446) [-1552.082] (-1551.981) (-1551.682) -- 0:01:03 284500 -- (-1552.647) (-1551.856) [-1553.430] (-1552.163) * [-1553.165] (-1552.681) (-1551.878) (-1552.733) -- 0:01:02 285000 -- [-1551.612] (-1551.190) (-1552.101) (-1552.459) * (-1552.892) [-1551.253] (-1552.462) (-1553.012) -- 0:01:02 Average standard deviation of split frequencies: 0.018912 285500 -- (-1553.524) (-1551.594) (-1550.949) [-1551.310] * [-1550.910] (-1551.205) (-1554.141) (-1550.547) -- 0:01:02 286000 -- [-1550.747] (-1551.824) (-1551.240) (-1551.298) * [-1550.727] (-1551.699) (-1551.904) (-1550.938) -- 0:01:02 286500 -- [-1550.470] (-1553.524) (-1551.247) (-1550.225) * [-1552.123] (-1552.044) (-1557.358) (-1549.888) -- 0:01:02 287000 -- (-1551.470) [-1551.100] (-1551.134) (-1552.186) * (-1550.297) (-1551.775) [-1557.090] (-1550.243) -- 0:01:02 287500 -- (-1550.624) (-1550.763) [-1553.240] (-1550.855) * (-1550.093) [-1552.394] (-1553.375) (-1550.402) -- 0:01:01 288000 -- (-1550.410) (-1551.539) (-1553.049) [-1549.714] * (-1550.725) (-1552.256) (-1550.969) [-1550.867] -- 0:01:01 288500 -- (-1555.377) (-1554.862) (-1555.477) [-1550.539] * [-1550.719] (-1550.995) (-1551.449) (-1551.850) -- 0:01:01 289000 -- (-1553.820) (-1551.592) (-1555.279) [-1551.207] * (-1551.554) [-1552.321] (-1551.307) (-1552.319) -- 0:01:01 289500 -- (-1553.449) (-1552.618) (-1549.711) [-1551.931] * (-1553.353) (-1552.216) [-1549.904] (-1551.592) -- 0:01:01 290000 -- [-1552.442] (-1550.107) (-1549.796) (-1550.651) * (-1549.677) [-1553.672] (-1551.788) (-1554.239) -- 0:01:01 Average standard deviation of split frequencies: 0.018437 290500 -- (-1551.196) (-1552.729) (-1552.173) [-1550.466] * [-1549.714] (-1550.893) (-1550.186) (-1549.672) -- 0:01:01 291000 -- (-1551.264) (-1553.943) [-1551.754] (-1553.984) * (-1549.907) [-1550.110] (-1550.570) (-1550.740) -- 0:01:00 291500 -- (-1551.932) (-1554.044) [-1551.251] (-1554.411) * (-1552.342) [-1554.098] (-1550.220) (-1550.979) -- 0:01:00 292000 -- (-1551.646) [-1549.610] (-1553.684) (-1554.046) * [-1550.934] (-1551.895) (-1550.221) (-1554.839) -- 0:01:00 292500 -- (-1550.645) [-1549.800] (-1554.386) (-1551.472) * (-1552.350) (-1553.226) (-1550.321) [-1551.935] -- 0:01:00 293000 -- (-1552.404) [-1549.550] (-1556.834) (-1550.115) * (-1554.743) (-1554.167) (-1551.190) [-1554.453] -- 0:01:00 293500 -- (-1555.401) (-1551.022) (-1550.176) [-1550.082] * (-1550.851) (-1554.803) (-1550.645) [-1556.912] -- 0:01:00 294000 -- (-1559.775) (-1551.656) [-1550.672] (-1550.479) * [-1551.030] (-1553.144) (-1553.409) (-1556.414) -- 0:01:00 294500 -- (-1557.468) (-1549.860) (-1550.996) [-1549.779] * (-1553.523) (-1551.546) [-1552.125] (-1552.044) -- 0:00:59 295000 -- (-1553.579) (-1552.064) [-1551.611] (-1553.787) * (-1553.406) (-1551.577) [-1551.148] (-1552.695) -- 0:00:59 Average standard deviation of split frequencies: 0.018189 295500 -- (-1553.314) [-1551.898] (-1552.265) (-1550.568) * (-1553.506) (-1553.070) [-1553.875] (-1553.067) -- 0:01:01 296000 -- (-1552.195) (-1551.305) [-1551.376] (-1550.323) * (-1551.651) [-1553.070] (-1551.929) (-1551.421) -- 0:01:01 296500 -- (-1552.199) [-1550.454] (-1550.475) (-1551.933) * (-1555.539) (-1551.168) (-1551.787) [-1550.663] -- 0:01:01 297000 -- (-1549.683) (-1550.454) (-1551.273) [-1550.232] * (-1555.114) [-1551.824] (-1551.419) (-1550.673) -- 0:01:01 297500 -- [-1550.130] (-1551.757) (-1551.661) (-1552.128) * (-1553.482) (-1551.821) (-1551.694) [-1550.812] -- 0:01:01 298000 -- (-1550.588) (-1556.171) (-1552.135) [-1550.833] * (-1552.105) (-1554.613) (-1551.689) [-1550.771] -- 0:01:01 298500 -- (-1551.020) (-1554.999) (-1551.085) [-1550.817] * (-1554.448) (-1553.890) (-1550.643) [-1551.261] -- 0:01:01 299000 -- (-1552.189) (-1551.100) (-1552.465) [-1552.466] * [-1551.718] (-1552.043) (-1551.057) (-1551.720) -- 0:01:00 299500 -- (-1553.468) (-1549.591) [-1551.585] (-1549.732) * (-1557.888) [-1551.921] (-1552.601) (-1552.383) -- 0:01:00 300000 -- [-1551.142] (-1551.947) (-1552.623) (-1549.730) * [-1555.353] (-1552.826) (-1551.197) (-1550.155) -- 0:01:00 Average standard deviation of split frequencies: 0.018402 300500 -- (-1552.152) (-1553.715) [-1553.210] (-1552.128) * [-1554.621] (-1551.451) (-1550.291) (-1551.802) -- 0:01:00 301000 -- (-1551.801) [-1551.451] (-1550.102) (-1551.893) * (-1553.910) (-1552.753) (-1550.233) [-1549.919] -- 0:01:00 301500 -- (-1553.089) (-1552.995) (-1552.382) [-1554.315] * (-1550.703) (-1552.959) (-1550.762) [-1550.877] -- 0:01:00 302000 -- (-1551.995) (-1551.183) (-1555.145) [-1552.021] * [-1551.289] (-1550.304) (-1550.820) (-1553.191) -- 0:01:00 302500 -- (-1552.216) [-1552.643] (-1553.170) (-1552.763) * (-1550.734) (-1550.266) (-1560.349) [-1550.791] -- 0:00:59 303000 -- (-1551.545) (-1556.105) (-1552.512) [-1550.019] * [-1550.231] (-1552.006) (-1556.054) (-1550.211) -- 0:00:59 303500 -- (-1552.643) (-1556.106) (-1552.743) [-1550.858] * (-1550.290) (-1553.257) (-1552.513) [-1551.515] -- 0:00:59 304000 -- (-1551.324) (-1551.720) (-1551.085) [-1551.857] * (-1553.063) (-1553.113) [-1551.503] (-1551.703) -- 0:00:59 304500 -- (-1553.765) [-1550.224] (-1550.875) (-1555.484) * (-1556.213) (-1551.985) [-1550.897] (-1550.039) -- 0:00:59 305000 -- (-1550.203) [-1551.703] (-1552.182) (-1552.196) * (-1552.857) [-1552.852] (-1556.235) (-1550.575) -- 0:00:59 Average standard deviation of split frequencies: 0.017838 305500 -- (-1555.623) (-1549.691) [-1553.947] (-1552.478) * [-1553.579] (-1552.037) (-1555.137) (-1551.552) -- 0:00:59 306000 -- (-1551.725) (-1550.515) [-1550.871] (-1549.919) * [-1551.463] (-1552.836) (-1555.045) (-1552.591) -- 0:00:58 306500 -- (-1550.463) [-1550.872] (-1550.139) (-1550.278) * [-1552.468] (-1550.901) (-1552.824) (-1552.098) -- 0:00:58 307000 -- [-1551.430] (-1551.336) (-1550.961) (-1550.356) * (-1553.358) (-1552.264) (-1553.955) [-1550.878] -- 0:00:58 307500 -- (-1551.659) [-1552.106] (-1550.348) (-1550.356) * [-1551.173] (-1555.795) (-1552.635) (-1553.992) -- 0:01:00 308000 -- [-1554.896] (-1555.155) (-1550.231) (-1552.564) * (-1552.143) (-1559.077) (-1552.664) [-1552.650] -- 0:01:00 308500 -- (-1551.044) (-1559.079) (-1550.301) [-1550.908] * (-1550.603) (-1567.916) [-1552.114] (-1554.005) -- 0:01:00 309000 -- [-1553.655] (-1553.473) (-1551.086) (-1553.167) * [-1550.709] (-1554.709) (-1552.998) (-1554.049) -- 0:01:00 309500 -- (-1550.958) [-1552.820] (-1550.706) (-1552.486) * [-1551.017] (-1552.096) (-1553.300) (-1552.883) -- 0:01:00 310000 -- (-1560.894) [-1553.461] (-1552.868) (-1551.517) * [-1550.195] (-1552.488) (-1555.387) (-1554.479) -- 0:01:00 Average standard deviation of split frequencies: 0.018129 310500 -- (-1554.195) (-1557.266) (-1550.153) [-1552.540] * (-1550.880) [-1551.436] (-1552.826) (-1556.062) -- 0:00:59 311000 -- (-1551.131) (-1553.667) [-1549.906] (-1553.148) * [-1549.910] (-1552.940) (-1552.564) (-1554.301) -- 0:00:59 311500 -- (-1552.155) [-1551.215] (-1551.635) (-1551.210) * (-1551.154) (-1552.887) (-1554.855) [-1552.732] -- 0:00:59 312000 -- (-1551.947) [-1553.358] (-1551.367) (-1551.579) * (-1550.707) (-1551.304) (-1551.305) [-1552.671] -- 0:00:59 312500 -- (-1553.645) [-1554.425] (-1551.979) (-1552.207) * (-1552.688) (-1551.776) (-1551.761) [-1552.078] -- 0:00:59 313000 -- [-1552.410] (-1554.359) (-1552.051) (-1551.983) * [-1553.704] (-1551.971) (-1550.757) (-1554.537) -- 0:00:59 313500 -- (-1552.413) (-1555.572) (-1550.796) [-1550.538] * (-1555.992) [-1550.728] (-1550.967) (-1551.461) -- 0:00:59 314000 -- [-1551.606] (-1551.430) (-1552.963) (-1551.712) * (-1551.296) (-1549.778) [-1550.516] (-1552.584) -- 0:00:58 314500 -- (-1552.553) (-1551.692) [-1552.438] (-1552.180) * (-1551.657) [-1553.035] (-1553.069) (-1552.664) -- 0:00:58 315000 -- [-1552.646] (-1552.810) (-1551.499) (-1550.718) * (-1551.657) (-1550.864) [-1551.798] (-1552.653) -- 0:00:58 Average standard deviation of split frequencies: 0.018896 315500 -- (-1551.066) (-1551.564) (-1552.714) [-1551.014] * (-1551.515) [-1551.874] (-1551.811) (-1552.277) -- 0:00:58 316000 -- (-1553.856) [-1553.820] (-1551.727) (-1553.010) * (-1553.746) (-1553.238) (-1555.295) [-1551.427] -- 0:00:58 316500 -- (-1553.982) (-1555.825) [-1552.067] (-1550.695) * [-1552.057] (-1552.957) (-1552.274) (-1557.414) -- 0:00:58 317000 -- (-1552.921) (-1551.959) [-1551.135] (-1550.975) * (-1553.825) (-1553.278) [-1551.625] (-1551.880) -- 0:00:58 317500 -- (-1554.591) [-1551.847] (-1555.779) (-1550.854) * (-1554.730) (-1552.323) (-1552.788) [-1555.617] -- 0:00:58 318000 -- (-1554.096) [-1551.858] (-1556.052) (-1551.587) * [-1552.495] (-1556.338) (-1550.362) (-1553.107) -- 0:00:57 318500 -- (-1551.492) (-1552.966) (-1551.529) [-1552.208] * [-1553.173] (-1556.332) (-1552.688) (-1551.988) -- 0:00:57 319000 -- (-1551.194) (-1550.906) [-1549.981] (-1551.561) * (-1554.868) [-1557.763] (-1551.170) (-1553.142) -- 0:00:57 319500 -- [-1551.587] (-1550.342) (-1554.141) (-1552.145) * (-1553.166) (-1555.432) (-1551.386) [-1552.527] -- 0:00:59 320000 -- (-1552.766) [-1550.821] (-1554.107) (-1550.980) * (-1554.269) [-1551.897] (-1550.521) (-1550.987) -- 0:00:59 Average standard deviation of split frequencies: 0.018948 320500 -- (-1551.059) [-1554.057] (-1551.732) (-1551.494) * (-1553.884) [-1551.517] (-1551.513) (-1552.605) -- 0:00:59 321000 -- (-1550.509) (-1551.812) [-1551.871] (-1551.445) * (-1555.111) [-1550.473] (-1550.539) (-1552.485) -- 0:00:59 321500 -- (-1551.459) (-1555.786) (-1553.925) [-1552.295] * (-1558.717) (-1551.629) (-1549.798) [-1552.371] -- 0:00:59 322000 -- (-1554.952) (-1550.573) [-1550.484] (-1554.158) * (-1555.392) [-1552.123] (-1550.583) (-1551.258) -- 0:00:58 322500 -- (-1553.046) [-1554.400] (-1550.532) (-1555.413) * [-1552.371] (-1552.122) (-1551.732) (-1550.033) -- 0:00:58 323000 -- (-1551.985) (-1554.811) [-1551.407] (-1551.467) * (-1552.822) [-1551.715] (-1553.755) (-1551.613) -- 0:00:58 323500 -- (-1551.363) (-1552.604) (-1552.618) [-1553.721] * [-1552.563] (-1550.250) (-1550.935) (-1551.000) -- 0:00:58 324000 -- (-1551.129) [-1550.693] (-1553.265) (-1554.213) * [-1551.391] (-1551.444) (-1556.216) (-1551.358) -- 0:00:58 324500 -- (-1551.244) (-1553.501) (-1550.194) [-1551.508] * (-1550.885) (-1552.000) [-1552.204] (-1551.906) -- 0:00:58 325000 -- [-1552.762] (-1554.037) (-1549.999) (-1550.865) * (-1552.260) (-1551.379) (-1551.120) [-1553.039] -- 0:00:58 Average standard deviation of split frequencies: 0.018236 325500 -- (-1550.602) [-1551.130] (-1550.558) (-1554.323) * (-1553.993) (-1551.064) [-1551.336] (-1551.887) -- 0:00:58 326000 -- (-1550.392) (-1551.215) [-1553.161] (-1553.661) * (-1553.616) [-1550.390] (-1552.200) (-1551.887) -- 0:00:57 326500 -- (-1551.019) (-1551.294) [-1550.729] (-1552.513) * (-1552.008) [-1550.374] (-1556.132) (-1550.832) -- 0:00:57 327000 -- (-1550.693) (-1554.174) [-1550.381] (-1552.300) * [-1552.552] (-1550.895) (-1555.277) (-1552.772) -- 0:00:57 327500 -- (-1551.030) (-1550.082) [-1549.676] (-1551.609) * (-1553.426) (-1553.671) [-1553.619] (-1552.601) -- 0:00:57 328000 -- (-1552.615) [-1551.317] (-1549.676) (-1553.662) * (-1554.614) (-1551.045) (-1550.926) [-1551.567] -- 0:00:57 328500 -- [-1550.651] (-1555.108) (-1551.636) (-1550.660) * (-1553.699) [-1553.731] (-1553.178) (-1551.441) -- 0:00:57 329000 -- (-1550.033) (-1557.045) (-1551.241) [-1551.650] * (-1552.639) (-1551.789) (-1549.653) [-1549.505] -- 0:00:57 329500 -- (-1551.344) [-1554.968] (-1550.701) (-1551.999) * (-1551.703) (-1550.803) [-1550.065] (-1551.171) -- 0:00:56 330000 -- [-1551.280] (-1555.535) (-1550.385) (-1552.929) * [-1553.279] (-1551.438) (-1551.143) (-1549.832) -- 0:00:56 Average standard deviation of split frequencies: 0.018929 330500 -- (-1551.406) [-1551.639] (-1554.021) (-1551.744) * [-1551.851] (-1551.001) (-1550.420) (-1549.942) -- 0:00:56 331000 -- (-1550.724) [-1551.125] (-1550.755) (-1552.339) * [-1552.693] (-1551.227) (-1550.694) (-1550.911) -- 0:00:56 331500 -- (-1552.540) [-1552.034] (-1551.172) (-1550.399) * (-1552.594) (-1553.820) (-1551.564) [-1550.417] -- 0:00:58 332000 -- (-1552.540) (-1550.293) [-1551.181] (-1551.860) * (-1553.181) (-1550.275) [-1552.599] (-1552.503) -- 0:00:58 332500 -- (-1550.903) [-1550.381] (-1551.366) (-1549.934) * [-1553.181] (-1551.817) (-1550.351) (-1552.562) -- 0:00:58 333000 -- (-1553.445) [-1551.747] (-1550.865) (-1553.898) * [-1552.933] (-1551.169) (-1550.525) (-1553.230) -- 0:00:58 333500 -- (-1552.882) (-1551.901) [-1550.549] (-1555.186) * [-1552.331] (-1552.027) (-1554.029) (-1555.155) -- 0:00:57 334000 -- (-1550.820) (-1550.512) (-1550.804) [-1551.400] * [-1550.509] (-1549.843) (-1552.851) (-1553.611) -- 0:00:57 334500 -- (-1553.324) (-1550.190) [-1551.005] (-1553.150) * (-1550.897) [-1549.729] (-1552.182) (-1551.864) -- 0:00:57 335000 -- (-1553.114) [-1551.780] (-1551.302) (-1552.877) * (-1551.978) [-1549.709] (-1554.095) (-1554.036) -- 0:00:57 Average standard deviation of split frequencies: 0.018473 335500 -- (-1552.209) (-1555.783) [-1552.752] (-1551.110) * (-1550.861) (-1551.496) [-1552.712] (-1553.592) -- 0:00:57 336000 -- (-1551.642) (-1550.311) [-1549.785] (-1550.595) * (-1551.198) [-1550.561] (-1555.356) (-1551.055) -- 0:00:57 336500 -- (-1552.363) (-1553.616) (-1551.004) [-1549.848] * (-1551.521) [-1551.617] (-1552.772) (-1552.481) -- 0:00:57 337000 -- [-1550.581] (-1552.166) (-1551.087) (-1550.112) * (-1554.126) (-1554.011) (-1551.801) [-1551.828] -- 0:00:57 337500 -- (-1552.069) (-1555.239) (-1553.352) [-1550.764] * (-1552.552) (-1553.537) (-1552.692) [-1551.553] -- 0:00:56 338000 -- (-1552.120) (-1550.598) (-1553.939) [-1549.977] * [-1552.193] (-1550.432) (-1553.112) (-1553.516) -- 0:00:56 338500 -- (-1550.712) [-1551.249] (-1553.422) (-1553.109) * [-1550.745] (-1553.160) (-1551.923) (-1551.707) -- 0:00:56 339000 -- (-1549.764) [-1551.023] (-1552.915) (-1552.095) * (-1552.001) (-1553.024) [-1552.523] (-1551.721) -- 0:00:56 339500 -- [-1549.764] (-1551.050) (-1555.861) (-1550.511) * (-1553.097) (-1554.971) (-1552.662) [-1552.831] -- 0:00:56 340000 -- (-1553.430) (-1552.738) [-1553.696] (-1552.527) * (-1550.493) [-1552.709] (-1552.809) (-1552.833) -- 0:00:56 Average standard deviation of split frequencies: 0.018527 340500 -- (-1550.986) [-1552.670] (-1550.176) (-1555.523) * (-1551.460) (-1550.320) [-1552.495] (-1552.309) -- 0:00:56 341000 -- (-1550.062) (-1553.681) [-1552.519] (-1550.688) * (-1553.046) (-1550.050) (-1558.047) [-1552.328] -- 0:00:56 341500 -- (-1550.082) [-1553.267] (-1550.143) (-1552.565) * [-1550.512] (-1551.842) (-1553.384) (-1552.418) -- 0:00:55 342000 -- (-1552.313) [-1554.539] (-1550.388) (-1552.082) * (-1550.482) [-1551.432] (-1553.925) (-1550.534) -- 0:00:55 342500 -- (-1550.481) (-1551.165) [-1550.729] (-1550.765) * (-1551.540) (-1551.026) (-1553.526) [-1550.805] -- 0:00:55 343000 -- (-1551.632) (-1550.662) [-1551.217] (-1552.730) * (-1552.316) (-1550.514) [-1551.670] (-1550.607) -- 0:00:55 343500 -- [-1552.408] (-1555.541) (-1552.090) (-1550.799) * (-1550.236) (-1552.827) [-1551.749] (-1552.605) -- 0:00:55 344000 -- (-1551.082) (-1555.136) (-1551.467) [-1551.289] * (-1550.034) [-1555.674] (-1551.485) (-1553.990) -- 0:00:57 344500 -- [-1552.029] (-1551.675) (-1552.060) (-1553.014) * [-1553.304] (-1554.021) (-1552.083) (-1554.507) -- 0:00:57 345000 -- (-1550.828) [-1549.682] (-1551.559) (-1552.066) * (-1551.016) (-1553.187) [-1551.717] (-1557.202) -- 0:00:56 Average standard deviation of split frequencies: 0.019301 345500 -- (-1553.563) [-1549.702] (-1552.706) (-1551.971) * (-1552.635) (-1551.476) [-1551.278] (-1556.757) -- 0:00:56 346000 -- (-1555.498) [-1549.996] (-1552.595) (-1554.174) * (-1553.510) (-1551.374) [-1550.816] (-1555.903) -- 0:00:56 346500 -- (-1551.916) [-1552.491] (-1554.437) (-1551.636) * [-1552.313] (-1553.026) (-1552.536) (-1555.427) -- 0:00:56 347000 -- (-1552.090) (-1552.614) (-1553.565) [-1551.063] * (-1549.592) (-1552.573) [-1550.243] (-1551.461) -- 0:00:56 347500 -- (-1552.846) [-1551.911] (-1553.618) (-1550.565) * [-1549.980] (-1551.458) (-1550.557) (-1552.472) -- 0:00:56 348000 -- [-1554.227] (-1552.679) (-1553.661) (-1552.526) * (-1552.096) (-1553.251) (-1551.323) [-1550.877] -- 0:00:56 348500 -- (-1556.872) (-1552.102) (-1550.974) [-1550.230] * (-1551.984) (-1556.110) (-1549.927) [-1552.092] -- 0:00:56 349000 -- (-1554.633) (-1550.675) [-1551.769] (-1551.332) * (-1554.779) [-1550.898] (-1557.532) (-1551.555) -- 0:00:55 349500 -- (-1551.746) (-1551.368) [-1550.284] (-1550.327) * (-1553.009) (-1551.585) (-1550.939) [-1550.773] -- 0:00:55 350000 -- (-1551.998) (-1551.339) (-1550.119) [-1550.852] * (-1550.669) [-1551.347] (-1552.934) (-1552.682) -- 0:00:55 Average standard deviation of split frequencies: 0.019137 350500 -- (-1552.377) [-1553.584] (-1550.312) (-1551.844) * (-1557.259) (-1552.481) (-1557.788) [-1554.670] -- 0:00:55 351000 -- (-1552.905) (-1553.645) (-1549.820) [-1552.353] * (-1551.196) [-1551.819] (-1552.127) (-1550.880) -- 0:00:55 351500 -- (-1552.336) (-1554.580) (-1550.074) [-1551.673] * [-1552.506] (-1551.809) (-1557.914) (-1550.942) -- 0:00:55 352000 -- [-1550.978] (-1553.799) (-1550.320) (-1553.210) * (-1552.088) [-1551.860] (-1552.851) (-1557.372) -- 0:00:55 352500 -- (-1552.517) (-1554.052) [-1550.618] (-1552.814) * [-1551.522] (-1551.779) (-1550.561) (-1554.734) -- 0:00:55 353000 -- (-1554.807) (-1557.032) [-1553.450] (-1552.411) * (-1552.866) (-1550.043) [-1549.746] (-1554.528) -- 0:00:54 353500 -- (-1553.894) (-1551.846) [-1551.540] (-1550.920) * (-1553.405) (-1551.749) (-1550.791) [-1556.511] -- 0:00:54 354000 -- (-1551.929) (-1552.396) (-1552.046) [-1554.247] * (-1552.999) [-1552.709] (-1551.568) (-1554.296) -- 0:00:54 354500 -- (-1551.557) [-1552.150] (-1551.604) (-1552.569) * (-1552.203) [-1549.996] (-1551.408) (-1554.740) -- 0:00:54 355000 -- [-1550.435] (-1551.092) (-1550.186) (-1550.093) * (-1550.983) [-1551.803] (-1552.577) (-1552.503) -- 0:00:54 Average standard deviation of split frequencies: 0.018227 355500 -- (-1553.123) [-1554.151] (-1551.095) (-1551.326) * (-1552.076) [-1553.557] (-1554.195) (-1552.442) -- 0:00:56 356000 -- [-1551.427] (-1553.308) (-1551.023) (-1552.556) * [-1551.525] (-1554.552) (-1554.511) (-1553.820) -- 0:00:56 356500 -- (-1551.789) (-1551.015) (-1557.833) [-1550.092] * [-1554.538] (-1553.623) (-1551.657) (-1553.908) -- 0:00:55 357000 -- (-1551.911) (-1552.894) [-1554.606] (-1552.728) * (-1552.933) (-1555.399) [-1553.640] (-1555.817) -- 0:00:55 357500 -- (-1554.320) (-1553.364) (-1553.814) [-1550.209] * (-1558.160) [-1550.774] (-1551.350) (-1553.104) -- 0:00:55 358000 -- (-1553.712) (-1556.322) [-1550.610] (-1555.150) * [-1553.877] (-1553.706) (-1557.340) (-1552.648) -- 0:00:55 358500 -- (-1552.568) (-1553.211) [-1551.675] (-1554.216) * (-1554.518) [-1553.235] (-1553.391) (-1551.383) -- 0:00:55 359000 -- (-1552.749) (-1550.176) [-1551.101] (-1550.930) * (-1554.020) (-1555.199) [-1553.134] (-1555.386) -- 0:00:55 359500 -- [-1552.680] (-1551.162) (-1552.343) (-1550.697) * (-1552.516) [-1551.706] (-1550.001) (-1552.706) -- 0:00:55 360000 -- (-1551.615) (-1552.844) (-1559.184) [-1550.853] * (-1550.653) (-1550.467) [-1550.537] (-1552.103) -- 0:00:55 Average standard deviation of split frequencies: 0.019315 360500 -- (-1552.241) (-1551.638) (-1554.947) [-1551.621] * (-1550.548) (-1553.611) (-1552.200) [-1549.970] -- 0:00:54 361000 -- (-1554.082) (-1550.818) (-1554.079) [-1553.127] * (-1551.830) (-1550.625) [-1555.286] (-1550.978) -- 0:00:54 361500 -- (-1552.966) (-1553.290) [-1551.045] (-1551.569) * (-1554.416) (-1550.652) (-1556.470) [-1550.975] -- 0:00:54 362000 -- (-1553.432) (-1551.777) [-1552.264] (-1551.569) * [-1550.918] (-1551.505) (-1553.356) (-1551.882) -- 0:00:54 362500 -- (-1554.227) (-1550.476) (-1555.158) [-1550.281] * (-1549.737) (-1551.549) [-1551.017] (-1551.915) -- 0:00:54 363000 -- [-1555.103] (-1551.701) (-1554.686) (-1550.848) * (-1550.723) (-1551.466) (-1550.046) [-1550.698] -- 0:00:54 363500 -- (-1552.299) [-1551.737] (-1551.755) (-1551.523) * (-1550.871) (-1550.762) (-1551.149) [-1560.198] -- 0:00:54 364000 -- (-1551.650) (-1552.835) [-1552.897] (-1553.252) * (-1551.531) (-1554.577) (-1552.272) [-1552.930] -- 0:00:54 364500 -- (-1553.083) [-1551.494] (-1552.906) (-1553.330) * (-1557.484) (-1550.836) [-1552.184] (-1551.881) -- 0:00:54 365000 -- (-1551.471) (-1551.462) (-1552.855) [-1554.177] * (-1557.600) (-1551.499) [-1550.231] (-1554.964) -- 0:00:53 Average standard deviation of split frequencies: 0.017653 365500 -- [-1550.941] (-1554.286) (-1551.671) (-1550.076) * (-1554.233) (-1550.870) [-1549.891] (-1551.213) -- 0:00:53 366000 -- (-1552.174) (-1553.956) (-1551.685) [-1551.634] * (-1556.354) [-1552.151] (-1552.232) (-1550.516) -- 0:00:53 366500 -- [-1550.842] (-1550.863) (-1556.987) (-1551.659) * (-1552.476) (-1552.097) (-1552.531) [-1550.202] -- 0:00:53 367000 -- (-1552.555) (-1552.294) (-1552.441) [-1552.569] * (-1554.104) [-1551.085] (-1552.472) (-1550.105) -- 0:00:53 367500 -- (-1551.210) (-1549.991) [-1550.520] (-1552.097) * (-1550.892) [-1550.975] (-1552.723) (-1550.103) -- 0:00:55 368000 -- (-1550.777) [-1551.401] (-1550.317) (-1554.397) * (-1555.246) [-1550.851] (-1553.286) (-1552.042) -- 0:00:54 368500 -- (-1553.123) (-1551.408) [-1551.067] (-1550.106) * (-1554.917) (-1550.745) (-1551.264) [-1551.169] -- 0:00:54 369000 -- [-1553.409] (-1552.112) (-1553.316) (-1553.720) * (-1552.968) (-1550.741) (-1552.983) [-1554.473] -- 0:00:54 369500 -- (-1552.464) (-1549.964) [-1552.465] (-1553.930) * [-1550.306] (-1550.170) (-1553.463) (-1552.727) -- 0:00:54 370000 -- [-1551.616] (-1552.418) (-1550.163) (-1553.543) * [-1551.303] (-1551.334) (-1550.154) (-1554.351) -- 0:00:54 Average standard deviation of split frequencies: 0.017281 370500 -- (-1550.100) (-1554.110) [-1550.346] (-1553.355) * (-1552.776) [-1550.670] (-1551.520) (-1550.744) -- 0:00:54 371000 -- (-1550.843) (-1556.672) [-1549.484] (-1555.754) * [-1554.760] (-1550.261) (-1551.540) (-1551.907) -- 0:00:54 371500 -- (-1551.270) [-1552.428] (-1552.557) (-1551.052) * [-1550.489] (-1552.396) (-1552.740) (-1550.748) -- 0:00:54 372000 -- (-1551.635) (-1550.465) [-1550.582] (-1551.054) * [-1550.520] (-1552.366) (-1552.331) (-1555.983) -- 0:00:54 372500 -- (-1557.494) [-1550.226] (-1550.194) (-1551.349) * [-1551.839] (-1551.151) (-1551.852) (-1553.722) -- 0:00:53 373000 -- (-1553.849) [-1550.438] (-1550.717) (-1551.270) * (-1552.315) (-1553.591) [-1551.355] (-1552.920) -- 0:00:53 373500 -- (-1553.666) (-1550.249) (-1549.870) [-1551.838] * (-1552.010) (-1551.642) [-1551.289] (-1552.473) -- 0:00:53 374000 -- [-1552.438] (-1550.264) (-1549.825) (-1551.628) * (-1549.828) (-1551.227) (-1551.704) [-1553.549] -- 0:00:53 374500 -- (-1552.575) (-1550.933) (-1550.259) [-1551.539] * (-1549.978) (-1551.733) [-1553.677] (-1558.122) -- 0:00:53 375000 -- (-1551.430) (-1551.158) [-1551.148] (-1550.196) * (-1549.784) (-1551.412) [-1553.439] (-1557.558) -- 0:00:53 Average standard deviation of split frequencies: 0.016159 375500 -- (-1550.362) (-1552.284) [-1550.691] (-1551.853) * [-1550.207] (-1554.578) (-1554.654) (-1554.909) -- 0:00:53 376000 -- (-1550.635) (-1555.699) [-1550.054] (-1552.288) * (-1550.242) [-1553.412] (-1551.284) (-1553.680) -- 0:00:53 376500 -- (-1552.118) [-1553.286] (-1551.269) (-1550.686) * (-1551.920) [-1550.845] (-1550.947) (-1553.681) -- 0:00:52 377000 -- [-1550.909] (-1551.622) (-1551.625) (-1550.837) * (-1552.637) (-1551.647) (-1551.859) [-1551.424] -- 0:00:52 377500 -- [-1551.000] (-1551.176) (-1550.978) (-1551.739) * (-1551.331) (-1551.647) [-1551.926] (-1549.923) -- 0:00:52 378000 -- (-1551.818) (-1553.320) [-1550.372] (-1551.755) * (-1551.219) [-1551.714] (-1551.931) (-1553.202) -- 0:00:52 378500 -- (-1550.995) (-1551.349) (-1550.467) [-1550.192] * (-1553.404) (-1551.881) (-1552.587) [-1551.871] -- 0:00:52 379000 -- (-1551.779) (-1550.391) (-1551.380) [-1550.958] * (-1550.716) (-1551.082) [-1552.479] (-1551.952) -- 0:00:52 379500 -- (-1553.581) [-1551.343] (-1552.035) (-1553.806) * (-1555.935) (-1550.214) [-1551.742] (-1552.000) -- 0:00:53 380000 -- [-1550.654] (-1554.404) (-1552.649) (-1552.763) * (-1553.480) [-1555.051] (-1552.395) (-1551.614) -- 0:00:53 Average standard deviation of split frequencies: 0.016754 380500 -- (-1553.913) (-1556.168) [-1551.964] (-1552.339) * (-1553.173) (-1554.518) [-1551.153] (-1552.540) -- 0:00:53 381000 -- [-1555.030] (-1553.411) (-1552.748) (-1550.327) * (-1554.234) (-1550.500) (-1551.213) [-1552.484] -- 0:00:53 381500 -- (-1554.065) [-1551.164] (-1552.532) (-1550.326) * [-1551.810] (-1551.888) (-1551.205) (-1552.879) -- 0:00:53 382000 -- (-1556.623) [-1551.237] (-1554.543) (-1552.583) * (-1553.349) (-1550.958) (-1554.107) [-1552.193] -- 0:00:53 382500 -- (-1553.935) [-1550.978] (-1557.157) (-1550.605) * [-1553.218] (-1551.773) (-1553.060) (-1552.152) -- 0:00:53 383000 -- (-1554.552) [-1551.155] (-1554.118) (-1552.572) * [-1553.753] (-1555.387) (-1554.097) (-1552.132) -- 0:00:53 383500 -- [-1550.907] (-1550.119) (-1555.585) (-1554.578) * (-1554.752) [-1553.731] (-1551.425) (-1550.508) -- 0:00:53 384000 -- (-1550.873) (-1552.553) [-1552.990] (-1552.772) * (-1551.794) (-1551.505) (-1551.493) [-1550.508] -- 0:00:52 384500 -- [-1550.297] (-1552.547) (-1552.177) (-1550.899) * (-1551.522) (-1552.151) (-1551.877) [-1550.203] -- 0:00:52 385000 -- (-1550.998) (-1551.729) (-1551.947) [-1553.686] * (-1550.472) (-1550.099) (-1552.024) [-1552.645] -- 0:00:52 Average standard deviation of split frequencies: 0.015876 385500 -- (-1552.627) (-1551.723) (-1552.656) [-1551.161] * (-1551.496) [-1550.083] (-1553.082) (-1551.947) -- 0:00:52 386000 -- (-1549.860) (-1550.648) [-1556.113] (-1550.563) * [-1550.341] (-1551.697) (-1553.062) (-1550.189) -- 0:00:52 386500 -- (-1549.866) (-1552.325) (-1554.228) [-1550.184] * (-1551.830) (-1551.536) (-1551.444) [-1551.234] -- 0:00:52 387000 -- [-1550.973] (-1550.755) (-1554.838) (-1550.720) * (-1553.816) [-1551.548] (-1554.356) (-1552.404) -- 0:00:52 387500 -- [-1552.444] (-1551.724) (-1550.212) (-1552.149) * (-1552.535) [-1551.389] (-1550.881) (-1553.189) -- 0:00:52 388000 -- (-1550.340) (-1551.032) [-1555.097] (-1552.598) * (-1551.810) (-1550.802) (-1553.541) [-1552.473] -- 0:00:52 388500 -- (-1551.190) (-1552.464) [-1554.762] (-1555.344) * (-1551.268) [-1550.272] (-1551.897) (-1551.852) -- 0:00:51 389000 -- [-1550.841] (-1552.747) (-1553.545) (-1550.115) * (-1555.169) [-1551.314] (-1554.545) (-1551.742) -- 0:00:51 389500 -- [-1550.072] (-1550.502) (-1553.964) (-1551.690) * (-1551.754) (-1551.603) [-1552.857] (-1553.620) -- 0:00:51 390000 -- (-1549.999) (-1550.189) [-1553.609] (-1550.577) * [-1552.006] (-1554.705) (-1552.875) (-1563.308) -- 0:00:51 Average standard deviation of split frequencies: 0.016004 390500 -- (-1551.977) (-1553.128) [-1554.207] (-1553.544) * (-1550.690) [-1553.269] (-1553.371) (-1556.304) -- 0:00:51 391000 -- (-1552.143) (-1554.590) (-1550.188) [-1552.470] * [-1550.836] (-1552.698) (-1552.246) (-1550.916) -- 0:00:51 391500 -- (-1555.547) (-1555.400) [-1550.713] (-1553.449) * [-1551.718] (-1551.579) (-1552.808) (-1553.896) -- 0:00:52 392000 -- [-1552.043] (-1554.101) (-1550.695) (-1553.224) * (-1552.616) (-1550.515) (-1554.770) [-1551.974] -- 0:00:52 392500 -- (-1552.783) (-1553.649) [-1552.056] (-1549.767) * [-1554.557] (-1550.339) (-1553.348) (-1552.408) -- 0:00:52 393000 -- (-1553.610) [-1551.086] (-1555.827) (-1552.847) * (-1551.211) (-1550.248) [-1553.549] (-1549.885) -- 0:00:52 393500 -- [-1557.888] (-1553.605) (-1556.122) (-1550.343) * (-1555.699) [-1550.624] (-1560.418) (-1550.033) -- 0:00:52 394000 -- [-1554.007] (-1552.183) (-1551.510) (-1557.145) * (-1556.985) [-1551.609] (-1553.396) (-1550.556) -- 0:00:52 394500 -- [-1555.930] (-1551.010) (-1555.561) (-1555.468) * (-1550.992) (-1551.933) (-1553.158) [-1549.723] -- 0:00:52 395000 -- (-1552.010) [-1551.674] (-1557.423) (-1554.364) * [-1550.657] (-1551.769) (-1554.817) (-1550.202) -- 0:00:52 Average standard deviation of split frequencies: 0.015416 395500 -- (-1550.815) (-1557.437) (-1553.727) [-1550.582] * (-1551.907) (-1550.750) [-1550.760] (-1554.841) -- 0:00:51 396000 -- [-1550.843] (-1554.770) (-1550.655) (-1553.061) * (-1555.669) (-1553.470) (-1551.631) [-1550.488] -- 0:00:51 396500 -- (-1551.291) [-1555.312] (-1554.197) (-1550.876) * (-1553.057) (-1555.269) (-1554.281) [-1550.685] -- 0:00:51 397000 -- (-1553.645) (-1555.596) [-1551.191] (-1553.438) * [-1553.986] (-1558.703) (-1552.229) (-1553.961) -- 0:00:51 397500 -- (-1552.183) (-1553.883) (-1554.055) [-1553.335] * (-1554.339) (-1555.862) (-1550.736) [-1552.278] -- 0:00:51 398000 -- [-1551.558] (-1550.520) (-1556.763) (-1550.719) * [-1550.511] (-1554.273) (-1553.920) (-1552.229) -- 0:00:51 398500 -- (-1552.431) (-1553.779) [-1552.907] (-1550.985) * (-1550.346) (-1557.062) (-1552.505) [-1553.731] -- 0:00:51 399000 -- (-1552.512) (-1553.029) (-1553.606) [-1551.437] * (-1550.883) [-1551.486] (-1552.447) (-1552.757) -- 0:00:51 399500 -- [-1552.470] (-1554.105) (-1551.983) (-1549.570) * (-1550.565) (-1551.722) (-1553.064) [-1553.224] -- 0:00:51 400000 -- [-1551.700] (-1549.689) (-1551.844) (-1549.988) * (-1551.919) (-1551.505) (-1551.887) [-1552.980] -- 0:00:51 Average standard deviation of split frequencies: 0.014772 400500 -- (-1551.203) [-1551.032] (-1553.616) (-1551.161) * (-1554.931) (-1550.782) [-1551.494] (-1550.768) -- 0:00:50 401000 -- [-1550.061] (-1551.607) (-1554.936) (-1550.727) * [-1550.904] (-1551.176) (-1550.824) (-1550.717) -- 0:00:50 401500 -- (-1551.398) [-1552.163] (-1553.481) (-1550.736) * (-1551.607) (-1550.197) [-1550.416] (-1551.718) -- 0:00:50 402000 -- (-1551.328) (-1551.646) [-1553.264] (-1549.856) * [-1551.002] (-1552.211) (-1550.927) (-1550.067) -- 0:00:50 402500 -- [-1552.840] (-1550.485) (-1553.746) (-1550.401) * [-1552.012] (-1551.455) (-1549.696) (-1551.509) -- 0:00:50 403000 -- (-1550.724) (-1551.888) (-1551.219) [-1549.984] * (-1553.723) (-1552.057) [-1551.408] (-1551.597) -- 0:00:50 403500 -- (-1551.683) (-1551.029) (-1553.124) [-1549.984] * (-1552.019) (-1549.844) [-1556.729] (-1551.539) -- 0:00:51 404000 -- [-1551.822] (-1552.242) (-1552.669) (-1549.864) * (-1553.858) (-1549.928) (-1551.390) [-1551.341] -- 0:00:51 404500 -- [-1550.750] (-1552.577) (-1553.336) (-1550.411) * (-1552.251) (-1553.271) [-1550.510] (-1551.854) -- 0:00:51 405000 -- [-1553.441] (-1551.008) (-1552.067) (-1552.117) * (-1550.833) (-1554.972) (-1551.421) [-1553.371] -- 0:00:51 Average standard deviation of split frequencies: 0.015501 405500 -- [-1556.609] (-1559.011) (-1551.507) (-1549.885) * [-1553.836] (-1558.291) (-1551.076) (-1551.214) -- 0:00:51 406000 -- (-1555.607) [-1554.263] (-1551.550) (-1558.651) * [-1553.201] (-1551.805) (-1551.074) (-1551.009) -- 0:00:51 406500 -- (-1552.527) [-1553.241] (-1551.335) (-1553.716) * (-1555.037) (-1553.806) (-1553.045) [-1550.830] -- 0:00:51 407000 -- (-1553.025) (-1550.916) [-1550.305] (-1550.392) * (-1552.530) (-1553.667) (-1554.579) [-1550.921] -- 0:00:50 407500 -- (-1552.702) [-1551.687] (-1549.861) (-1553.836) * [-1549.618] (-1554.879) (-1550.768) (-1551.760) -- 0:00:50 408000 -- (-1551.337) (-1553.908) (-1551.810) [-1553.132] * (-1550.088) [-1553.263] (-1552.735) (-1551.392) -- 0:00:50 408500 -- (-1554.637) (-1552.545) [-1551.827] (-1554.268) * (-1550.428) (-1552.945) [-1554.471] (-1551.594) -- 0:00:50 409000 -- (-1551.110) (-1551.125) [-1551.370] (-1551.914) * [-1550.816] (-1551.511) (-1555.250) (-1555.330) -- 0:00:50 409500 -- [-1555.634] (-1553.564) (-1552.407) (-1554.185) * (-1553.294) (-1552.312) [-1551.923] (-1553.929) -- 0:00:50 410000 -- (-1552.825) [-1551.523] (-1552.036) (-1554.162) * (-1550.580) [-1553.287] (-1551.556) (-1552.959) -- 0:00:50 Average standard deviation of split frequencies: 0.014808 410500 -- (-1551.066) [-1551.698] (-1551.494) (-1550.396) * [-1550.697] (-1552.648) (-1551.676) (-1552.139) -- 0:00:50 411000 -- (-1550.477) [-1552.097] (-1551.949) (-1550.746) * (-1555.199) (-1551.310) (-1552.921) [-1553.412] -- 0:00:50 411500 -- (-1552.728) [-1551.391] (-1550.544) (-1551.296) * (-1555.142) [-1553.145] (-1552.937) (-1551.206) -- 0:00:50 412000 -- [-1552.435] (-1551.075) (-1550.546) (-1552.126) * (-1551.632) (-1552.811) (-1552.142) [-1551.973] -- 0:00:49 412500 -- (-1549.691) (-1551.065) [-1550.257] (-1552.177) * [-1551.067] (-1551.139) (-1553.683) (-1552.917) -- 0:00:49 413000 -- (-1551.104) (-1551.133) [-1552.472] (-1552.354) * (-1551.592) (-1551.139) (-1554.205) [-1554.390] -- 0:00:49 413500 -- (-1551.702) [-1554.615] (-1550.307) (-1552.919) * (-1550.990) (-1552.638) (-1552.022) [-1551.499] -- 0:00:49 414000 -- (-1551.571) (-1556.925) (-1550.404) [-1552.387] * [-1551.383] (-1551.202) (-1551.065) (-1550.834) -- 0:00:49 414500 -- [-1550.462] (-1551.783) (-1550.689) (-1550.992) * [-1551.284] (-1550.881) (-1552.925) (-1553.032) -- 0:00:49 415000 -- [-1550.822] (-1550.706) (-1550.837) (-1551.713) * (-1551.383) (-1549.865) (-1552.837) [-1556.244] -- 0:00:50 Average standard deviation of split frequencies: 0.014417 415500 -- (-1554.596) (-1550.294) [-1551.585] (-1552.129) * (-1552.784) (-1551.420) [-1551.348] (-1552.095) -- 0:00:50 416000 -- (-1552.535) [-1552.237] (-1550.759) (-1554.726) * (-1550.611) (-1551.610) [-1553.763] (-1552.795) -- 0:00:50 416500 -- (-1554.343) (-1549.637) (-1551.945) [-1553.108] * (-1556.453) (-1551.445) (-1551.853) [-1551.421] -- 0:00:50 417000 -- (-1551.627) [-1552.935] (-1554.175) (-1550.317) * [-1552.917] (-1550.946) (-1550.491) (-1551.389) -- 0:00:50 417500 -- (-1554.612) [-1551.389] (-1553.402) (-1552.394) * (-1554.036) [-1550.663] (-1550.855) (-1550.315) -- 0:00:50 418000 -- [-1557.397] (-1550.465) (-1553.953) (-1554.029) * (-1552.684) (-1551.410) [-1552.629] (-1550.146) -- 0:00:50 418500 -- [-1550.571] (-1550.988) (-1551.425) (-1554.377) * (-1551.229) [-1551.819] (-1553.284) (-1549.966) -- 0:00:50 419000 -- (-1551.040) [-1550.249] (-1551.813) (-1553.590) * (-1551.854) (-1552.257) (-1553.429) [-1549.978] -- 0:00:49 419500 -- (-1552.217) (-1550.074) [-1551.561] (-1554.073) * (-1554.644) (-1554.570) (-1556.830) [-1551.310] -- 0:00:49 420000 -- (-1552.644) (-1550.048) [-1551.939] (-1550.799) * (-1549.798) (-1551.817) [-1552.781] (-1551.435) -- 0:00:49 Average standard deviation of split frequencies: 0.014041 420500 -- [-1553.867] (-1550.161) (-1550.763) (-1550.906) * (-1550.383) [-1555.495] (-1553.971) (-1553.369) -- 0:00:49 421000 -- (-1555.217) (-1551.328) (-1550.640) [-1552.370] * [-1553.697] (-1554.239) (-1552.733) (-1554.333) -- 0:00:49 421500 -- (-1553.049) (-1553.373) [-1551.780] (-1554.233) * (-1550.217) (-1551.336) (-1552.958) [-1554.517] -- 0:00:49 422000 -- (-1552.720) [-1551.080] (-1551.890) (-1551.549) * (-1552.132) [-1550.084] (-1552.486) (-1551.761) -- 0:00:49 422500 -- [-1551.164] (-1551.089) (-1553.859) (-1551.536) * (-1552.587) (-1550.336) [-1553.999] (-1552.012) -- 0:00:49 423000 -- (-1552.189) [-1551.168] (-1554.136) (-1552.282) * (-1553.371) (-1551.240) (-1551.802) [-1550.534] -- 0:00:49 423500 -- (-1552.524) [-1552.767] (-1552.521) (-1552.281) * (-1552.764) (-1553.177) [-1552.042] (-1550.353) -- 0:00:49 424000 -- (-1551.251) (-1551.099) (-1551.023) [-1550.420] * (-1552.549) [-1551.608] (-1551.243) (-1552.819) -- 0:00:48 424500 -- (-1551.693) (-1557.523) (-1553.813) [-1550.387] * [-1551.748] (-1551.106) (-1551.179) (-1553.244) -- 0:00:48 425000 -- (-1551.148) (-1559.917) (-1551.203) [-1551.118] * (-1551.323) [-1552.946] (-1551.014) (-1556.622) -- 0:00:48 Average standard deviation of split frequencies: 0.013803 425500 -- [-1550.943] (-1550.498) (-1550.524) (-1551.234) * (-1551.393) (-1553.245) [-1551.247] (-1551.404) -- 0:00:48 426000 -- (-1551.496) [-1550.827] (-1550.377) (-1552.360) * (-1552.047) (-1556.013) [-1552.051] (-1552.102) -- 0:00:48 426500 -- [-1552.267] (-1551.130) (-1550.399) (-1551.284) * (-1551.201) (-1553.180) (-1553.524) [-1550.380] -- 0:00:49 427000 -- [-1551.789] (-1551.290) (-1550.825) (-1552.801) * [-1549.867] (-1552.068) (-1553.410) (-1550.398) -- 0:00:49 427500 -- (-1550.927) (-1553.805) [-1551.190] (-1556.628) * (-1553.374) (-1549.630) (-1552.047) [-1551.430] -- 0:00:49 428000 -- (-1551.345) (-1552.328) [-1550.747] (-1554.181) * [-1550.834] (-1551.960) (-1552.302) (-1550.348) -- 0:00:49 428500 -- [-1552.030] (-1555.788) (-1550.615) (-1551.243) * (-1551.005) (-1552.514) [-1553.008] (-1553.340) -- 0:00:49 429000 -- (-1550.234) [-1555.551] (-1553.395) (-1550.858) * (-1557.979) [-1552.197] (-1550.113) (-1552.126) -- 0:00:49 429500 -- (-1551.371) (-1556.059) (-1554.372) [-1554.537] * (-1554.634) (-1549.619) [-1550.113] (-1551.574) -- 0:00:49 430000 -- (-1552.170) (-1551.179) [-1550.344] (-1554.416) * (-1551.609) [-1549.630] (-1550.238) (-1552.682) -- 0:00:49 Average standard deviation of split frequencies: 0.013769 430500 -- (-1554.766) [-1555.318] (-1550.422) (-1552.425) * [-1552.194] (-1552.142) (-1550.234) (-1551.375) -- 0:00:48 431000 -- (-1550.997) [-1551.599] (-1549.923) (-1557.956) * (-1552.888) [-1554.077] (-1549.950) (-1550.921) -- 0:00:48 431500 -- (-1550.639) [-1552.448] (-1550.179) (-1554.704) * [-1551.323] (-1550.631) (-1557.038) (-1551.741) -- 0:00:48 432000 -- (-1551.628) [-1554.192] (-1552.406) (-1556.201) * (-1550.738) [-1550.807] (-1554.544) (-1553.682) -- 0:00:48 432500 -- (-1550.665) (-1552.688) (-1552.663) [-1550.798] * (-1552.419) (-1551.590) [-1552.837] (-1553.102) -- 0:00:48 433000 -- (-1550.132) (-1552.762) [-1552.413] (-1551.180) * (-1551.021) (-1553.204) (-1553.086) [-1551.414] -- 0:00:48 433500 -- (-1551.565) [-1552.237] (-1552.041) (-1555.388) * (-1553.829) (-1555.151) (-1556.766) [-1551.232] -- 0:00:48 434000 -- (-1554.878) (-1549.967) [-1551.057] (-1555.090) * (-1551.395) (-1553.713) (-1555.910) [-1550.311] -- 0:00:48 434500 -- (-1550.551) [-1550.499] (-1556.755) (-1557.131) * (-1551.570) (-1550.498) [-1551.696] (-1550.319) -- 0:00:48 435000 -- [-1550.115] (-1553.742) (-1549.656) (-1555.007) * (-1551.422) (-1550.551) [-1553.991] (-1551.026) -- 0:00:48 Average standard deviation of split frequencies: 0.012914 435500 -- (-1551.443) [-1551.356] (-1553.915) (-1552.350) * [-1551.986] (-1554.683) (-1551.749) (-1551.979) -- 0:00:47 436000 -- (-1550.637) (-1553.010) [-1549.878] (-1552.123) * (-1552.179) (-1552.212) (-1553.561) [-1554.341] -- 0:00:47 436500 -- (-1551.592) [-1553.447] (-1549.971) (-1552.238) * (-1553.094) [-1550.468] (-1552.341) (-1550.613) -- 0:00:47 437000 -- (-1550.319) (-1550.092) (-1550.941) [-1551.008] * (-1553.714) (-1555.099) [-1553.243] (-1554.283) -- 0:00:47 437500 -- [-1550.333] (-1550.067) (-1549.838) (-1556.581) * (-1554.148) (-1556.720) [-1554.387] (-1552.234) -- 0:00:47 438000 -- [-1552.156] (-1550.836) (-1549.990) (-1551.545) * (-1549.734) [-1552.418] (-1552.350) (-1555.462) -- 0:00:47 438500 -- (-1552.265) (-1550.611) (-1549.990) [-1552.199] * (-1550.680) (-1554.452) (-1552.548) [-1552.843] -- 0:00:48 439000 -- [-1553.818] (-1550.683) (-1553.031) (-1552.420) * (-1552.357) (-1551.647) (-1553.980) [-1551.228] -- 0:00:48 439500 -- [-1550.564] (-1549.686) (-1550.978) (-1552.858) * [-1551.185] (-1554.953) (-1553.855) (-1553.169) -- 0:00:48 440000 -- (-1550.553) (-1549.671) [-1550.410] (-1554.083) * (-1550.880) (-1550.533) (-1551.263) [-1555.327] -- 0:00:48 Average standard deviation of split frequencies: 0.012522 440500 -- (-1550.669) (-1550.822) (-1553.811) [-1550.088] * (-1550.324) [-1552.579] (-1552.560) (-1552.075) -- 0:00:48 441000 -- [-1551.032] (-1550.767) (-1556.455) (-1554.107) * (-1552.073) (-1549.641) [-1552.082] (-1554.017) -- 0:00:48 441500 -- (-1554.785) (-1551.102) [-1551.647] (-1553.219) * (-1553.474) (-1549.995) (-1551.083) [-1550.139] -- 0:00:48 442000 -- (-1551.914) (-15