--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:41:29 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/gltA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1783.87         -1789.39
2      -1783.85         -1787.03
--------------------------------------
TOTAL    -1783.86         -1788.79
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899272    0.095866    0.332720    1.487652    0.864506   1338.65   1419.83    1.000
r(A<->C){all}   0.163369    0.019417    0.000034    0.445743    0.127937    201.33    216.09    1.007
r(A<->G){all}   0.183592    0.023521    0.000051    0.488174    0.145055    214.19    223.94    1.000
r(A<->T){all}   0.156011    0.019172    0.000476    0.443286    0.115985    232.84    241.46    1.000
r(C<->G){all}   0.171467    0.019783    0.000051    0.446473    0.138090    195.45    203.93    1.000
r(C<->T){all}   0.163775    0.018533    0.000124    0.445622    0.129555    124.81    208.49    1.004
r(G<->T){all}   0.161787    0.018538    0.000027    0.436272    0.126423    192.65    211.35    1.000
pi(A){all}      0.215488    0.000125    0.195117    0.237937    0.215313   1364.27   1397.64    1.000
pi(C){all}      0.279903    0.000157    0.257310    0.306158    0.279515   1285.77   1343.06    1.000
pi(G){all}      0.283550    0.000154    0.259263    0.307023    0.283513   1044.07   1272.53    1.000
pi(T){all}      0.221059    0.000133    0.199290    0.244782    0.220730   1081.09   1194.59    1.000
alpha{1,2}      0.427705    0.234260    0.000148    1.404366    0.251611   1275.49   1331.74    1.000
alpha{3}        0.450235    0.229567    0.000135    1.395565    0.297958   1404.06   1452.53    1.000
pinvar{all}     0.998822    0.000002    0.996172    0.999998    0.999289   1081.33   1167.79    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1710.327847
Model 2: PositiveSelection	-1710.327847
Model 0: one-ratio	-1710.327847
Model 7: beta	-1710.327847
Model 8: beta&w>1	-1710.327847


Model 0 vs 1	0.0

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C2
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C3
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C4
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C5
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C6
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=431 

C1              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C2              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C3              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C4              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C5              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C6              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
                **************************************************

C1              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C2              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C3              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C4              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C5              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C6              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
                **************************************************

C1              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C2              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C3              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C4              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C5              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C6              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
                **************************************************

C1              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C2              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C3              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C4              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C5              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C6              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
                **************************************************

C1              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C2              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C3              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C4              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C5              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C6              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
                **************************************************

C1              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C2              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C3              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C4              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C5              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C6              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
                **************************************************

C1              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C2              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C3              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C4              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C5              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C6              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
                **************************************************

C1              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C2              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C3              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C4              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C5              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C6              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
                **************************************************

C1              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C2              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C3              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C4              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C5              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C6              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
                *******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  431 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  431 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12930]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [12930]--->[12930]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.531 Mb, Max= 31.007 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C2              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C3              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C4              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C5              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
C6              VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
                **************************************************

C1              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C2              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C3              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C4              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C5              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
C6              NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
                **************************************************

C1              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C2              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C3              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C4              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C5              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
C6              DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
                **************************************************

C1              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C2              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C3              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C4              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C5              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
C6              ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
                **************************************************

C1              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C2              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C3              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C4              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C5              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
C6              LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
                **************************************************

C1              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C2              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C3              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C4              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C5              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
C6              LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
                **************************************************

C1              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C2              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C3              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C4              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C5              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
C6              GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
                **************************************************

C1              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C2              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C3              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C4              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C5              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
C6              LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
                **************************************************

C1              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C2              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C3              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C4              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C5              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
C6              EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
                *******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
C2              GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
C3              GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
C4              GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
C5              GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
C6              GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
                **************************************************

C1              CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
C2              CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
C3              CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
C4              CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
C5              CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
C6              CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
                **************************************************

C1              TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
C2              TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
C3              TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
C4              TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
C5              TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
C6              TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
                **************************************************

C1              AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
C2              AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
C3              AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
C4              AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
C5              AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
C6              AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
                **************************************************

C1              GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
C2              GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
C3              GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
C4              GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
C5              GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
C6              GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
                **************************************************

C1              CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
C2              CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
C3              CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
C4              CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
C5              CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
C6              CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
                **************************************************

C1              GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
C2              GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
C3              GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
C4              GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
C5              GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
C6              GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
                **************************************************

C1              CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
C2              CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
C3              CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
C4              CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
C5              CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
C6              CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
                **************************************************

C1              TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
C2              TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
C3              TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
C4              TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
C5              TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
C6              TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
                **************************************************

C1              GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
C2              GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
C3              GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
C4              GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
C5              GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
C6              GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
                **************************************************

C1              CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
C2              CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
C3              CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
C4              CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
C5              CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
C6              CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
                **************************************************

C1              GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
C2              GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
C3              GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
C4              GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
C5              GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
C6              GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
                **************************************************

C1              CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
C2              CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
C3              CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
C4              CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
C5              CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
C6              CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
                **************************************************

C1              GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
C2              GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
C3              GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
C4              GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
C5              GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
C6              GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
                **************************************************

C1              AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
C2              AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
C3              AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
C4              AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
C5              AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
C6              AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
                **************************************************

C1              CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
C2              CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
C3              CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
C4              CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
C5              CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
C6              CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
                **************************************************

C1              CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
C2              CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
C3              CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
C4              CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
C5              CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
C6              CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
                **************************************************

C1              GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
C2              GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
C3              GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
C4              GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
C5              GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
C6              GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
                **************************************************

C1              GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
C2              GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
C3              GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
C4              GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
C5              GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
C6              GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
                **************************************************

C1              GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
C2              GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
C3              GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
C4              GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
C5              GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
C6              GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
                **************************************************

C1              GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
C2              GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
C3              GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
C4              GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
C5              GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
C6              GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
                **************************************************

C1              CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
C2              CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
C3              CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
C4              CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
C5              CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
C6              CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
                **************************************************

C1              CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
C2              CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
C3              CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
C4              CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
C5              CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
C6              CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
                **************************************************

C1              CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
C2              CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
C3              CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
C4              CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
C5              CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
C6              CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
                **************************************************

C1              GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
C2              GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
C3              GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
C4              GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
C5              GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
C6              GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
                **************************************************

C1              CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
C2              CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
C3              CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
C4              CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
C5              CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
C6              CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
                *******************************************



>C1
GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
>C2
GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
>C3
GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
>C4
GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
>C5
GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
>C6
GTGGCCGACACCGACGACACCGTCACTCTGAAGTATCCGGGAGGCGAGAT
CGATCTACAGATTGTCCGTGCCACCGAAGGTAATGACGGCATTGCGATCG
TCCCGGTATTGGCCAAGACCGGTTACACTACGTTTGATGTCGGCTACGGT
AACACCGCATCCACCAAGAGTTCCATCACCTACATTGATGGTGACGCCGG
GATTCTGCGTTACCGCGGCTATCCGATTGAGCAGCTCGCCGAGAAGTCGA
CCTTCATAGAGGTTTGCTATCTGCTGATCTATGGGGAGTTACCAGCCACC
GATCAGCTGGCCGAATTCACCCATCGGATCCAGCGCCACACCATGTTGCA
CGAGGACCTTAAGCGATTCTATGATGGCTTCCCGCGCAACGCGCACCCGA
TGCCGGTGTTGTCCAGCGTGGTCAACGCATTGAGTGCTTACTATCAGGAT
GCACTGGACCCGATGGACAACGGCCAAGTAGAGCTGTCGACGATCCGACT
CTTGGCCAAGCTGCCCACTATCGCTGCCTATGCATACAAGAAGTCGGTAG
GCCAGCCGTTCCTTTACCCGGACAACGCGTTTTCTCTAGTAGAGAACTTC
CTTCGAATGACTTTTGGTTTGCCGGCTGAGCCCTATGAGCCCGACCCTGA
GGTGGTCCGGGCTCTGGACATGCTGTTTATCCTGCATGCTGACCACGAGC
AAAACTGTTCGACGTCAACCGTGCGTTTGGTGGGCTCGTCGCGAGCCAAC
CTGTTCACCTCGATTTCGGGCGGCATTAACGCGCTGTGGGGACCGCTGCA
CGGCGGTGCCAACCAGGCGGTGCTTGAGATGCTCGAAGGTATCCGCGAGA
GTGGCGACGACGTTGGTGGATTTGTCCAAAAAGTAAAGAATTGCCAGGCC
GGTGTGAAATTGATGGGCTTTGGTCACCGCGTCTACAAGAACTACGATCC
GCGGGCCCGCATCGTCAAGGAACAGGCTGACAAGATCCTGGTCAAACTTG
GTGGCGATGACGATTTGCTGAACATTGCCAAGGGACTCGAGGAGGCGGCG
CTAACCGATGACTATTTCATCGAGCGCAAGCTTTACCCGAACGTCGACTT
CTACACCGGTCTGATCTACCGGGCCCTCGGTTTTCCGACCCGGATGTTCA
CCGTGTTGTTTGCTTTGGGTCGGCTGCCAGGCTGGATTGCGCACTGGCGT
GAGATGCACGACGAGGGTGACAGTAAGATTGGCCGTCCGCGCCAAATATA
CACCGGCTACACAGAGCGTGACTACACCGCAATTGAAACACGA
>C1
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C2
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C3
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C4
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C5
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR
>C6
VADTDDTVTLKYPGGEIDLQIVRATEGNDGIAIVPVLAKTGYTTFDVGYG
NTASTKSSITYIDGDAGILRYRGYPIEQLAEKSTFIEVCYLLIYGELPAT
DQLAEFTHRIQRHTMLHEDLKRFYDGFPRNAHPMPVLSSVVNALSAYYQD
ALDPMDNGQVELSTIRLLAKLPTIAAYAYKKSVGQPFLYPDNAFSLVENF
LRMTFGLPAEPYEPDPEVVRALDMLFILHADHEQNCSTSTVRLVGSSRAN
LFTSISGGINALWGPLHGGANQAVLEMLEGIRESGDDVGGFVQKVKNCQA
GVKLMGFGHRVYKNYDPRARIVKEQADKILVKLGGDDDLLNIAKGLEEAA
LTDDYFIERKLYPNVDFYTGLIYRALGFPTRMFTVLFALGRLPGWIAHWR
EMHDEGDSKIGRPRQIYTGYTERDYTAIETR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1293 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790404
      Setting output file names to "/data/2res/gltA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1937911113
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0422242346
      Seed = 1337655814
      Swapseed = 1579790404
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2893.795988 -- -24.965149
         Chain 2 -- -2893.795988 -- -24.965149
         Chain 3 -- -2893.795547 -- -24.965149
         Chain 4 -- -2893.795547 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2893.795988 -- -24.965149
         Chain 2 -- -2893.795988 -- -24.965149
         Chain 3 -- -2893.795822 -- -24.965149
         Chain 4 -- -2893.795988 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2893.796] (-2893.796) (-2893.796) (-2893.796) * [-2893.796] (-2893.796) (-2893.796) (-2893.796) 
        500 -- [-1794.051] (-1795.218) (-1813.126) (-1795.688) * (-1796.506) (-1820.006) [-1799.651] (-1791.752) -- 0:00:00
       1000 -- (-1801.161) (-1798.762) [-1790.427] (-1796.160) * [-1791.271] (-1791.990) (-1800.955) (-1801.095) -- 0:00:00
       1500 -- (-1791.586) (-1795.928) (-1795.668) [-1791.473] * (-1793.967) (-1794.861) [-1805.055] (-1804.224) -- 0:00:00
       2000 -- (-1796.143) (-1791.034) [-1793.265] (-1793.562) * (-1798.901) (-1795.750) (-1795.376) [-1796.444] -- 0:00:00
       2500 -- (-1793.586) (-1789.840) (-1794.861) [-1795.208] * [-1792.845] (-1792.251) (-1790.891) (-1792.637) -- 0:00:00
       3000 -- (-1795.221) (-1794.357) (-1798.481) [-1789.089] * (-1794.614) [-1790.427] (-1796.808) (-1792.484) -- 0:00:00
       3500 -- (-1795.775) (-1795.055) [-1790.977] (-1792.219) * [-1792.333] (-1793.996) (-1800.742) (-1788.817) -- 0:00:00
       4000 -- (-1797.404) (-1792.846) (-1786.669) [-1795.262] * (-1793.686) (-1792.159) (-1796.859) [-1791.851] -- 0:00:00
       4500 -- (-1797.953) (-1795.738) (-1793.340) [-1795.989] * (-1795.192) (-1796.853) (-1797.407) [-1797.809] -- 0:00:00
       5000 -- (-1801.979) (-1791.152) (-1794.796) [-1790.699] * (-1796.118) (-1798.479) (-1798.140) [-1791.619] -- 0:00:00

      Average standard deviation of split frequencies: 0.078567

       5500 -- (-1790.204) [-1789.454] (-1793.374) (-1797.168) * (-1803.794) (-1788.145) (-1794.591) [-1791.916] -- 0:03:00
       6000 -- (-1796.952) (-1791.182) (-1796.832) [-1790.117] * [-1798.675] (-1796.358) (-1795.597) (-1801.518) -- 0:02:45
       6500 -- [-1792.049] (-1793.843) (-1791.035) (-1798.118) * (-1801.384) (-1803.016) (-1800.303) [-1786.922] -- 0:02:32
       7000 -- (-1793.154) (-1803.354) [-1789.610] (-1794.097) * [-1798.491] (-1803.404) (-1797.599) (-1791.249) -- 0:02:21
       7500 -- (-1801.043) (-1790.756) (-1793.220) [-1793.423] * (-1803.512) (-1793.121) [-1793.889] (-1795.035) -- 0:02:12
       8000 -- [-1793.609] (-1801.271) (-1802.200) (-1795.388) * (-1799.413) (-1794.087) [-1801.231] (-1795.944) -- 0:02:04
       8500 -- (-1798.018) (-1792.177) (-1793.033) [-1795.795] * (-1791.552) (-1797.801) [-1789.760] (-1797.409) -- 0:01:56
       9000 -- (-1796.812) (-1793.585) [-1790.131] (-1790.939) * (-1792.384) (-1788.040) (-1798.893) [-1793.004] -- 0:01:50
       9500 -- (-1798.385) (-1800.436) [-1794.143] (-1794.010) * (-1792.110) (-1793.089) (-1802.170) [-1798.808] -- 0:01:44
      10000 -- [-1790.218] (-1793.995) (-1795.893) (-1795.341) * (-1787.238) (-1800.042) (-1791.876) [-1793.557] -- 0:01:39

      Average standard deviation of split frequencies: 0.060265

      10500 -- [-1789.369] (-1793.041) (-1795.751) (-1792.331) * (-1802.628) (-1796.018) [-1790.084] (-1795.060) -- 0:01:34
      11000 -- [-1790.890] (-1789.410) (-1793.217) (-1800.220) * (-1793.878) (-1789.964) [-1798.201] (-1792.502) -- 0:01:29
      11500 -- (-1790.360) (-1794.937) (-1795.202) [-1790.605] * (-1788.293) [-1793.123] (-1796.905) (-1795.879) -- 0:01:25
      12000 -- (-1793.934) (-1791.350) [-1793.738] (-1796.473) * [-1790.468] (-1797.607) (-1792.240) (-1797.667) -- 0:01:22
      12500 -- (-1790.871) (-1798.157) (-1792.220) [-1798.676] * (-1800.860) (-1798.192) (-1794.741) [-1791.781] -- 0:01:19
      13000 -- [-1786.106] (-1796.713) (-1793.810) (-1788.271) * (-1797.457) (-1794.760) (-1790.860) [-1790.434] -- 0:01:15
      13500 -- (-1792.350) [-1791.241] (-1794.777) (-1790.281) * (-1790.302) (-1789.421) [-1795.166] (-1795.853) -- 0:01:13
      14000 -- (-1795.419) (-1798.004) (-1810.447) [-1787.246] * (-1796.757) (-1796.397) [-1795.638] (-1792.601) -- 0:01:10
      14500 -- [-1794.157] (-1795.298) (-1801.208) (-1791.426) * (-1793.039) (-1796.501) [-1793.698] (-1790.504) -- 0:01:07
      15000 -- [-1788.005] (-1790.603) (-1796.027) (-1792.175) * (-1790.900) (-1789.602) [-1790.285] (-1792.721) -- 0:01:05

      Average standard deviation of split frequencies: 0.041868

      15500 -- [-1792.730] (-1793.200) (-1795.037) (-1798.206) * (-1789.833) (-1799.980) [-1797.251] (-1797.028) -- 0:01:03
      16000 -- (-1793.545) (-1794.095) [-1792.855] (-1791.155) * (-1790.111) (-1792.208) (-1798.849) [-1792.121] -- 0:02:03
      16500 -- [-1795.435] (-1783.582) (-1794.357) (-1793.401) * (-1793.783) [-1787.298] (-1790.690) (-1796.401) -- 0:01:59
      17000 -- (-1793.531) [-1784.408] (-1790.143) (-1795.804) * [-1799.181] (-1796.530) (-1798.362) (-1788.259) -- 0:01:55
      17500 -- (-1790.807) (-1785.932) [-1790.186] (-1792.344) * (-1793.426) (-1787.266) (-1790.535) [-1798.072] -- 0:01:52
      18000 -- [-1793.698] (-1789.048) (-1793.025) (-1794.398) * [-1792.410] (-1790.844) (-1799.658) (-1795.668) -- 0:01:49
      18500 -- (-1793.298) (-1783.679) (-1796.572) [-1795.756] * [-1792.534] (-1791.416) (-1792.015) (-1795.623) -- 0:01:46
      19000 -- (-1793.282) (-1784.298) (-1795.547) [-1790.400] * [-1792.781] (-1786.965) (-1789.956) (-1790.187) -- 0:01:43
      19500 -- (-1795.580) [-1783.169] (-1790.630) (-1791.319) * (-1796.186) [-1786.753] (-1790.497) (-1793.924) -- 0:01:40
      20000 -- (-1790.987) (-1785.946) [-1789.163] (-1790.669) * (-1795.147) [-1785.911] (-1786.677) (-1799.208) -- 0:01:38

      Average standard deviation of split frequencies: 0.040253

      20500 -- (-1795.214) [-1783.179] (-1789.165) (-1798.548) * (-1802.159) [-1783.155] (-1787.661) (-1789.601) -- 0:01:35
      21000 -- (-1790.986) [-1783.541] (-1791.746) (-1794.430) * (-1788.202) (-1782.859) [-1786.467] (-1795.455) -- 0:01:33
      21500 -- (-1794.964) (-1783.682) (-1794.873) [-1791.335] * (-1783.016) (-1783.568) (-1784.839) [-1789.329] -- 0:01:31
      22000 -- (-1795.725) (-1783.695) (-1792.184) [-1789.058] * [-1786.352] (-1785.329) (-1785.184) (-1795.038) -- 0:01:28
      22500 -- (-1789.326) (-1785.232) [-1788.121] (-1799.942) * (-1784.134) [-1788.048] (-1790.381) (-1791.720) -- 0:01:26
      23000 -- (-1793.507) (-1784.915) (-1792.353) [-1790.956] * (-1782.521) (-1784.955) (-1787.369) [-1792.274] -- 0:01:24
      23500 -- (-1794.657) (-1784.703) (-1793.491) [-1795.206] * [-1782.905] (-1783.195) (-1785.650) (-1793.217) -- 0:01:23
      24000 -- [-1799.745] (-1782.470) (-1789.886) (-1794.207) * [-1784.724] (-1782.625) (-1784.614) (-1793.355) -- 0:01:21
      24500 -- [-1797.593] (-1784.858) (-1796.277) (-1791.346) * (-1783.240) (-1783.695) [-1783.850] (-1802.779) -- 0:01:19
      25000 -- (-1796.724) [-1784.782] (-1798.435) (-1798.599) * (-1782.862) [-1783.728] (-1785.049) (-1799.387) -- 0:01:18

      Average standard deviation of split frequencies: 0.033789

      25500 -- (-1799.585) [-1784.385] (-1795.578) (-1793.015) * [-1783.239] (-1784.082) (-1787.891) (-1799.913) -- 0:01:16
      26000 -- (-1795.581) (-1782.616) (-1790.122) [-1799.479] * (-1783.170) [-1784.511] (-1786.838) (-1802.663) -- 0:01:14
      26500 -- (-1802.267) (-1785.725) (-1791.027) [-1793.497] * (-1784.189) [-1785.129] (-1788.481) (-1789.438) -- 0:01:13
      27000 -- (-1794.000) [-1783.411] (-1793.272) (-1794.887) * (-1784.818) [-1785.976] (-1791.833) (-1809.791) -- 0:01:48
      27500 -- [-1796.963] (-1783.208) (-1801.385) (-1797.326) * (-1785.845) [-1784.386] (-1788.757) (-1790.709) -- 0:01:46
      28000 -- [-1789.953] (-1786.729) (-1797.203) (-1800.382) * (-1784.191) (-1784.377) [-1784.129] (-1790.582) -- 0:01:44
      28500 -- (-1812.056) (-1784.457) [-1793.576] (-1797.264) * (-1784.963) [-1783.860] (-1784.165) (-1795.388) -- 0:01:42
      29000 -- (-1797.380) (-1785.650) (-1796.818) [-1793.619] * (-1787.666) (-1786.432) (-1784.412) [-1791.320] -- 0:01:40
      29500 -- (-1792.174) (-1786.122) [-1791.868] (-1795.940) * (-1783.490) (-1786.303) [-1783.229] (-1805.621) -- 0:01:38
      30000 -- (-1783.995) (-1785.057) (-1790.362) [-1790.137] * (-1783.859) (-1788.139) [-1784.464] (-1795.916) -- 0:01:37

      Average standard deviation of split frequencies: 0.038796

      30500 -- [-1784.493] (-1784.539) (-1796.110) (-1793.356) * (-1784.884) (-1787.596) [-1787.672] (-1794.798) -- 0:01:35
      31000 -- (-1782.435) (-1784.828) [-1791.687] (-1792.876) * [-1783.100] (-1787.371) (-1783.999) (-1790.209) -- 0:01:33
      31500 -- [-1783.853] (-1784.348) (-1796.026) (-1799.780) * (-1782.592) [-1789.068] (-1783.981) (-1796.360) -- 0:01:32
      32000 -- (-1784.772) (-1785.206) (-1791.617) [-1791.783] * (-1782.680) (-1787.541) (-1783.450) [-1794.656] -- 0:01:30
      32500 -- (-1785.768) (-1786.465) (-1788.301) [-1792.433] * (-1783.002) (-1787.391) (-1785.499) [-1791.180] -- 0:01:29
      33000 -- (-1783.326) (-1784.260) [-1793.556] (-1794.122) * (-1783.002) (-1787.886) (-1784.430) [-1793.319] -- 0:01:27
      33500 -- [-1786.121] (-1783.612) (-1789.944) (-1789.162) * (-1783.461) [-1787.436] (-1787.456) (-1795.623) -- 0:01:26
      34000 -- (-1785.934) (-1784.490) [-1787.472] (-1792.802) * (-1786.557) (-1784.399) [-1784.983] (-1798.256) -- 0:01:25
      34500 -- [-1783.664] (-1785.184) (-1791.321) (-1792.966) * (-1784.846) (-1783.439) [-1783.414] (-1798.491) -- 0:01:23
      35000 -- (-1788.627) [-1784.325] (-1790.227) (-1791.540) * (-1783.894) [-1785.605] (-1783.513) (-1795.266) -- 0:01:22

      Average standard deviation of split frequencies: 0.044896

      35500 -- (-1783.753) (-1785.211) [-1788.772] (-1788.591) * (-1784.504) [-1783.931] (-1783.468) (-1797.611) -- 0:01:21
      36000 -- [-1788.998] (-1785.316) (-1793.382) (-1786.589) * [-1785.398] (-1788.354) (-1785.536) (-1794.789) -- 0:01:20
      36500 -- (-1784.636) (-1790.073) [-1793.074] (-1790.534) * (-1784.898) [-1787.799] (-1784.152) (-1803.465) -- 0:01:19
      37000 -- (-1784.616) (-1787.134) [-1794.459] (-1786.511) * (-1783.848) (-1786.518) (-1784.414) [-1797.260] -- 0:01:18
      37500 -- (-1784.084) (-1786.342) (-1796.587) [-1787.198] * (-1787.299) [-1787.626] (-1787.455) (-1799.207) -- 0:01:17
      38000 -- (-1786.220) [-1783.639] (-1789.224) (-1785.830) * (-1791.708) (-1787.639) [-1784.932] (-1797.898) -- 0:01:15
      38500 -- (-1784.990) (-1784.264) [-1787.888] (-1788.126) * (-1785.159) (-1786.082) [-1784.069] (-1795.675) -- 0:01:14
      39000 -- (-1783.046) (-1782.720) [-1794.440] (-1784.620) * (-1788.889) (-1784.169) [-1784.517] (-1790.906) -- 0:01:13
      39500 -- [-1785.243] (-1784.323) (-1804.300) (-1785.694) * (-1786.737) (-1784.457) (-1784.334) [-1794.382] -- 0:01:12
      40000 -- [-1784.531] (-1782.983) (-1794.093) (-1787.049) * (-1785.404) (-1784.635) [-1783.360] (-1787.013) -- 0:01:12

      Average standard deviation of split frequencies: 0.034224

      40500 -- (-1783.152) (-1784.711) (-1799.203) [-1788.054] * (-1785.668) (-1783.260) [-1784.498] (-1786.231) -- 0:01:34
      41000 -- (-1784.927) (-1785.085) [-1795.324] (-1789.980) * [-1785.228] (-1785.840) (-1784.211) (-1785.612) -- 0:01:33
      41500 -- (-1784.537) [-1784.944] (-1790.537) (-1783.792) * (-1785.904) (-1783.113) (-1783.515) [-1782.453] -- 0:01:32
      42000 -- (-1784.818) (-1785.907) (-1797.065) [-1786.380] * (-1785.464) (-1783.438) [-1784.686] (-1784.207) -- 0:01:31
      42500 -- (-1787.097) (-1785.661) (-1798.361) [-1789.540] * (-1784.550) (-1784.493) [-1784.394] (-1783.935) -- 0:01:30
      43000 -- (-1787.999) (-1784.082) [-1795.804] (-1785.720) * (-1783.531) (-1784.875) (-1784.391) [-1784.104] -- 0:01:29
      43500 -- (-1784.768) (-1784.017) [-1789.117] (-1783.673) * [-1782.575] (-1785.508) (-1784.945) (-1784.619) -- 0:01:27
      44000 -- (-1785.838) (-1784.261) (-1798.263) [-1783.884] * (-1787.987) [-1782.208] (-1785.500) (-1785.646) -- 0:01:26
      44500 -- (-1786.106) (-1787.993) (-1796.977) [-1783.193] * [-1782.682] (-1782.796) (-1786.144) (-1783.420) -- 0:01:25
      45000 -- (-1786.746) (-1791.739) [-1799.789] (-1783.454) * (-1785.211) (-1786.625) [-1784.857] (-1782.296) -- 0:01:24

      Average standard deviation of split frequencies: 0.036799

      45500 -- (-1785.630) [-1787.577] (-1789.290) (-1783.809) * (-1783.952) (-1785.386) [-1785.868] (-1782.287) -- 0:01:23
      46000 -- [-1785.791] (-1783.263) (-1792.525) (-1785.489) * [-1786.897] (-1785.303) (-1787.632) (-1782.293) -- 0:01:22
      46500 -- (-1786.007) (-1784.376) (-1802.402) [-1784.385] * (-1786.740) [-1782.642] (-1783.549) (-1785.622) -- 0:01:22
      47000 -- (-1786.289) (-1784.476) [-1795.322] (-1783.581) * [-1784.571] (-1782.906) (-1784.011) (-1784.006) -- 0:01:21
      47500 -- [-1783.227] (-1785.076) (-1790.004) (-1783.384) * [-1783.156] (-1790.126) (-1783.441) (-1783.329) -- 0:01:20
      48000 -- (-1784.368) (-1786.654) (-1806.806) [-1787.226] * (-1783.156) [-1784.817] (-1782.793) (-1783.836) -- 0:01:19
      48500 -- (-1783.789) [-1784.614] (-1796.271) (-1785.828) * [-1783.084] (-1784.272) (-1783.390) (-1783.952) -- 0:01:18
      49000 -- [-1784.571] (-1786.638) (-1793.949) (-1786.396) * (-1782.954) [-1783.688] (-1786.798) (-1783.513) -- 0:01:17
      49500 -- [-1785.312] (-1784.833) (-1798.281) (-1784.917) * (-1783.747) [-1783.688] (-1785.781) (-1786.965) -- 0:01:16
      50000 -- [-1785.484] (-1785.659) (-1795.303) (-1783.253) * [-1783.604] (-1784.223) (-1783.734) (-1787.006) -- 0:01:16

      Average standard deviation of split frequencies: 0.042879

      50500 -- (-1785.798) (-1786.940) [-1792.560] (-1784.971) * (-1785.335) [-1783.820] (-1785.333) (-1783.949) -- 0:01:15
      51000 -- (-1786.558) (-1786.523) [-1793.626] (-1784.253) * (-1786.112) (-1784.572) (-1787.782) [-1784.023] -- 0:01:14
      51500 -- (-1785.948) (-1784.410) [-1789.717] (-1784.224) * (-1783.782) [-1782.355] (-1789.912) (-1784.621) -- 0:01:13
      52000 -- (-1785.375) [-1784.519] (-1792.902) (-1783.067) * (-1784.172) (-1783.698) (-1787.680) [-1784.055] -- 0:01:12
      52500 -- (-1790.569) (-1783.346) [-1791.177] (-1785.211) * [-1783.649] (-1785.656) (-1787.841) (-1786.191) -- 0:01:12
      53000 -- (-1788.234) (-1788.291) (-1791.068) [-1783.521] * (-1788.760) (-1783.586) (-1790.569) [-1784.917] -- 0:01:11
      53500 -- (-1789.910) (-1784.366) [-1790.168] (-1784.497) * (-1783.664) [-1783.123] (-1783.709) (-1785.025) -- 0:01:10
      54000 -- (-1788.875) (-1783.249) (-1791.402) [-1782.900] * (-1783.274) (-1784.779) (-1784.434) [-1785.451] -- 0:01:27
      54500 -- [-1786.355] (-1785.819) (-1795.341) (-1784.252) * [-1783.977] (-1786.254) (-1785.793) (-1785.208) -- 0:01:26
      55000 -- (-1784.134) (-1785.166) [-1789.579] (-1784.046) * (-1783.053) (-1785.090) (-1786.448) [-1785.844] -- 0:01:25

      Average standard deviation of split frequencies: 0.042472

      55500 -- [-1782.647] (-1784.353) (-1791.820) (-1784.511) * (-1783.110) (-1783.555) [-1786.592] (-1785.724) -- 0:01:25
      56000 -- (-1783.022) (-1783.818) (-1797.371) [-1786.289] * (-1783.475) (-1789.069) [-1787.322] (-1786.646) -- 0:01:24
      56500 -- (-1785.765) (-1790.035) [-1788.618] (-1783.655) * (-1785.592) [-1786.329] (-1785.579) (-1787.121) -- 0:01:23
      57000 -- (-1784.820) (-1790.292) [-1795.876] (-1784.010) * (-1786.562) (-1784.946) (-1787.338) [-1789.101] -- 0:01:22
      57500 -- (-1785.466) (-1790.431) (-1788.118) [-1784.450] * (-1785.174) (-1785.705) [-1785.940] (-1784.152) -- 0:01:21
      58000 -- [-1782.812] (-1787.476) (-1802.683) (-1784.318) * (-1782.953) (-1785.030) (-1784.966) [-1782.521] -- 0:01:21
      58500 -- (-1783.224) [-1785.675] (-1798.710) (-1784.212) * (-1784.169) (-1787.454) [-1783.413] (-1783.890) -- 0:01:20
      59000 -- [-1783.798] (-1787.054) (-1793.992) (-1785.103) * (-1783.497) (-1785.235) [-1782.564] (-1786.186) -- 0:01:19
      59500 -- (-1783.065) (-1787.192) (-1794.509) [-1783.907] * (-1783.221) (-1785.289) [-1784.505] (-1784.950) -- 0:01:19
      60000 -- (-1784.572) (-1786.691) [-1795.661] (-1785.177) * (-1784.360) [-1782.741] (-1785.259) (-1783.123) -- 0:01:18

      Average standard deviation of split frequencies: 0.034782

      60500 -- (-1788.068) [-1785.110] (-1794.676) (-1784.359) * (-1785.876) (-1782.587) [-1783.109] (-1786.232) -- 0:01:17
      61000 -- (-1786.120) (-1783.148) [-1787.015] (-1790.007) * [-1785.638] (-1783.040) (-1788.416) (-1785.144) -- 0:01:16
      61500 -- (-1782.877) (-1783.696) [-1789.897] (-1789.690) * [-1782.744] (-1783.123) (-1783.441) (-1786.557) -- 0:01:16
      62000 -- (-1785.063) (-1783.728) (-1801.848) [-1786.645] * [-1782.780] (-1785.716) (-1783.442) (-1786.878) -- 0:01:15
      62500 -- (-1783.687) (-1785.731) (-1795.101) [-1783.160] * (-1783.195) (-1783.481) [-1784.133] (-1784.028) -- 0:01:15
      63000 -- (-1783.296) (-1782.944) [-1792.252] (-1786.293) * (-1784.963) [-1783.637] (-1785.936) (-1786.352) -- 0:01:14
      63500 -- (-1784.512) (-1784.203) [-1792.492] (-1786.258) * (-1785.268) (-1783.574) [-1783.900] (-1782.819) -- 0:01:13
      64000 -- [-1783.294] (-1786.524) (-1796.564) (-1785.227) * [-1784.598] (-1783.475) (-1784.950) (-1782.925) -- 0:01:13
      64500 -- (-1785.828) (-1786.660) [-1795.997] (-1786.387) * (-1785.169) (-1783.514) (-1783.422) [-1787.158] -- 0:01:12
      65000 -- (-1789.040) (-1787.263) [-1795.067] (-1783.515) * [-1785.044] (-1791.953) (-1786.278) (-1784.365) -- 0:01:11

      Average standard deviation of split frequencies: 0.033849

      65500 -- (-1786.001) (-1785.629) (-1791.317) [-1784.319] * (-1783.844) (-1788.916) (-1785.049) [-1784.013] -- 0:01:11
      66000 -- [-1784.259] (-1785.502) (-1789.739) (-1784.916) * (-1784.655) (-1786.582) [-1785.611] (-1783.359) -- 0:01:10
      66500 -- (-1783.535) (-1786.994) [-1793.734] (-1784.959) * (-1787.270) (-1786.717) (-1784.583) [-1783.569] -- 0:01:10
      67000 -- (-1782.929) [-1784.396] (-1799.723) (-1783.666) * (-1786.180) [-1785.070] (-1783.476) (-1784.488) -- 0:01:09
      67500 -- (-1784.685) [-1784.282] (-1799.010) (-1783.666) * [-1786.259] (-1786.176) (-1783.082) (-1785.076) -- 0:01:09
      68000 -- (-1783.507) (-1783.438) [-1793.863] (-1784.251) * (-1788.541) [-1786.446] (-1783.321) (-1786.416) -- 0:01:08
      68500 -- (-1788.168) (-1783.426) (-1797.647) [-1784.268] * [-1786.906] (-1786.857) (-1783.413) (-1784.486) -- 0:01:07
      69000 -- (-1787.966) (-1783.410) [-1791.533] (-1783.811) * (-1785.222) (-1784.120) (-1783.674) [-1783.433] -- 0:01:20
      69500 -- (-1787.292) (-1785.593) (-1791.341) [-1782.788] * (-1784.795) [-1785.993] (-1783.790) (-1782.896) -- 0:01:20
      70000 -- (-1786.653) [-1785.562] (-1798.982) (-1783.085) * [-1783.168] (-1788.098) (-1783.819) (-1785.021) -- 0:01:19

      Average standard deviation of split frequencies: 0.032401

      70500 -- (-1784.862) [-1786.592] (-1806.324) (-1784.239) * (-1782.862) (-1786.326) (-1784.951) [-1782.913] -- 0:01:19
      71000 -- (-1784.963) (-1784.756) (-1782.792) [-1784.232] * [-1784.451] (-1788.042) (-1786.748) (-1783.136) -- 0:01:18
      71500 -- (-1786.089) (-1785.673) [-1784.059] (-1785.156) * (-1787.588) [-1784.021] (-1786.778) (-1783.469) -- 0:01:17
      72000 -- (-1783.648) (-1783.784) [-1783.063] (-1786.298) * [-1783.564] (-1783.968) (-1785.814) (-1782.781) -- 0:01:17
      72500 -- (-1784.433) (-1783.129) [-1782.948] (-1784.002) * (-1784.334) (-1784.862) (-1784.216) [-1782.884] -- 0:01:16
      73000 -- [-1786.050] (-1784.906) (-1784.053) (-1783.725) * (-1785.841) (-1782.852) [-1783.432] (-1784.089) -- 0:01:16
      73500 -- (-1784.340) (-1784.350) [-1783.100] (-1783.843) * (-1784.562) (-1785.560) [-1783.196] (-1784.645) -- 0:01:15
      74000 -- (-1783.894) (-1784.583) (-1783.100) [-1782.823] * (-1782.673) (-1786.152) (-1783.211) [-1784.371] -- 0:01:15
      74500 -- [-1782.800] (-1784.455) (-1783.695) (-1782.842) * (-1785.999) (-1785.475) (-1784.264) [-1785.704] -- 0:01:14
      75000 -- (-1784.066) [-1783.428] (-1785.522) (-1787.900) * [-1787.183] (-1788.916) (-1787.893) (-1784.953) -- 0:01:14

      Average standard deviation of split frequencies: 0.034262

      75500 -- (-1783.628) [-1783.932] (-1787.239) (-1783.595) * (-1782.924) (-1789.126) (-1785.096) [-1784.125] -- 0:01:13
      76000 -- (-1785.778) (-1784.031) [-1785.939] (-1783.675) * (-1783.688) (-1786.415) (-1783.223) [-1783.482] -- 0:01:12
      76500 -- (-1785.699) (-1783.864) (-1784.349) [-1786.677] * (-1783.203) [-1787.218] (-1786.028) (-1782.869) -- 0:01:12
      77000 -- (-1784.871) (-1783.972) (-1782.608) [-1783.543] * (-1783.493) (-1786.915) (-1783.622) [-1783.037] -- 0:01:11
      77500 -- (-1784.668) (-1782.534) (-1784.742) [-1785.197] * (-1782.866) (-1787.121) [-1783.492] (-1785.777) -- 0:01:11
      78000 -- (-1784.982) (-1782.663) (-1784.441) [-1785.154] * (-1782.834) [-1786.719] (-1787.202) (-1785.989) -- 0:01:10
      78500 -- (-1785.392) [-1782.869] (-1786.068) (-1783.016) * (-1783.666) [-1786.545] (-1785.354) (-1783.610) -- 0:01:10
      79000 -- (-1786.977) (-1783.015) [-1784.512] (-1784.168) * [-1782.994] (-1784.837) (-1785.064) (-1786.073) -- 0:01:09
      79500 -- (-1785.302) [-1784.835] (-1784.985) (-1784.458) * [-1784.128] (-1786.073) (-1785.334) (-1788.432) -- 0:01:09
      80000 -- [-1785.779] (-1783.683) (-1784.519) (-1785.279) * (-1784.936) (-1788.142) [-1783.998] (-1784.115) -- 0:01:09

      Average standard deviation of split frequencies: 0.031849

      80500 -- [-1785.208] (-1782.730) (-1788.455) (-1784.608) * (-1787.024) [-1788.184] (-1785.233) (-1783.889) -- 0:01:08
      81000 -- [-1787.023] (-1785.607) (-1785.174) (-1783.292) * (-1782.982) (-1790.691) (-1787.348) [-1785.079] -- 0:01:08
      81500 -- [-1786.144] (-1785.212) (-1785.012) (-1784.707) * (-1783.290) (-1784.395) (-1783.882) [-1785.527] -- 0:01:07
      82000 -- (-1785.667) (-1786.215) (-1784.010) [-1786.618] * (-1784.620) (-1784.166) [-1784.213] (-1787.712) -- 0:01:07
      82500 -- [-1784.258] (-1785.971) (-1784.382) (-1788.142) * (-1784.293) (-1784.982) (-1783.871) [-1786.452] -- 0:01:06
      83000 -- (-1785.302) (-1785.565) [-1786.099] (-1788.258) * (-1785.896) [-1784.926] (-1785.481) (-1783.379) -- 0:01:06
      83500 -- [-1783.896] (-1785.176) (-1783.616) (-1784.357) * [-1785.216] (-1784.148) (-1785.677) (-1782.935) -- 0:01:05
      84000 -- (-1785.119) (-1788.476) (-1787.002) [-1791.804] * (-1784.572) (-1784.654) (-1786.136) [-1782.947] -- 0:01:16
      84500 -- (-1788.007) (-1784.693) [-1788.273] (-1786.811) * (-1784.309) (-1784.655) (-1787.972) [-1782.722] -- 0:01:15
      85000 -- [-1785.131] (-1783.230) (-1788.547) (-1787.046) * [-1784.284] (-1785.722) (-1784.193) (-1784.156) -- 0:01:15

      Average standard deviation of split frequencies: 0.027407

      85500 -- (-1785.842) [-1782.602] (-1784.198) (-1784.634) * (-1785.229) (-1784.758) [-1786.757] (-1785.231) -- 0:01:14
      86000 -- (-1785.994) (-1783.593) (-1784.181) [-1784.394] * (-1783.077) (-1784.741) [-1785.185] (-1785.670) -- 0:01:14
      86500 -- (-1785.866) (-1784.834) [-1784.016] (-1783.743) * [-1783.149] (-1784.549) (-1784.376) (-1784.133) -- 0:01:13
      87000 -- (-1785.991) (-1784.235) (-1783.837) [-1786.367] * (-1782.625) [-1786.352] (-1786.971) (-1786.876) -- 0:01:13
      87500 -- (-1786.723) [-1784.215] (-1785.854) (-1786.317) * [-1782.458] (-1784.364) (-1783.671) (-1786.930) -- 0:01:13
      88000 -- (-1784.955) (-1786.196) (-1783.255) [-1784.409] * (-1782.553) [-1784.311] (-1783.382) (-1788.184) -- 0:01:12
      88500 -- [-1783.675] (-1783.776) (-1784.441) (-1783.202) * (-1786.624) (-1784.987) [-1783.036] (-1784.134) -- 0:01:12
      89000 -- (-1783.914) (-1782.946) (-1786.279) [-1785.156] * (-1787.103) (-1784.882) (-1787.216) [-1783.031] -- 0:01:11
      89500 -- (-1786.730) (-1785.261) (-1785.839) [-1784.111] * (-1782.811) (-1790.015) (-1785.823) [-1786.601] -- 0:01:11
      90000 -- (-1789.701) (-1782.443) [-1783.007] (-1784.150) * (-1782.825) (-1789.353) [-1784.771] (-1782.636) -- 0:01:10

      Average standard deviation of split frequencies: 0.029116

      90500 -- (-1783.646) (-1783.075) (-1784.674) [-1783.644] * [-1783.734] (-1785.216) (-1783.249) (-1783.217) -- 0:01:10
      91000 -- (-1783.662) [-1786.048] (-1786.092) (-1783.241) * (-1785.293) [-1784.785] (-1786.279) (-1784.000) -- 0:01:09
      91500 -- (-1786.748) (-1785.750) (-1784.984) [-1783.497] * (-1787.156) (-1784.149) (-1786.334) [-1783.685] -- 0:01:09
      92000 -- (-1784.894) [-1783.312] (-1784.920) (-1785.037) * (-1787.848) [-1785.777] (-1786.418) (-1783.705) -- 0:01:09
      92500 -- (-1786.045) (-1786.634) (-1784.005) [-1783.882] * (-1786.454) [-1784.618] (-1785.169) (-1783.416) -- 0:01:08
      93000 -- (-1784.040) [-1784.143] (-1785.010) (-1782.440) * (-1787.411) [-1785.627] (-1787.102) (-1785.029) -- 0:01:08
      93500 -- (-1784.480) (-1783.611) (-1787.581) [-1783.571] * (-1785.186) [-1784.150] (-1784.777) (-1784.014) -- 0:01:07
      94000 -- (-1783.947) [-1783.008] (-1790.393) (-1785.441) * (-1784.205) (-1784.110) (-1783.732) [-1785.429] -- 0:01:07
      94500 -- [-1783.755] (-1783.315) (-1791.393) (-1783.037) * (-1785.877) [-1785.433] (-1783.835) (-1782.497) -- 0:01:07
      95000 -- (-1783.624) (-1783.295) (-1786.151) [-1782.772] * (-1784.297) (-1784.488) (-1783.976) [-1783.223] -- 0:01:06

      Average standard deviation of split frequencies: 0.026271

      95500 -- (-1784.072) (-1784.280) (-1785.947) [-1782.696] * (-1784.808) (-1784.200) [-1783.143] (-1782.668) -- 0:01:06
      96000 -- (-1787.687) (-1785.202) (-1785.974) [-1783.356] * [-1787.531] (-1783.706) (-1787.100) (-1782.712) -- 0:01:05
      96500 -- (-1785.505) (-1783.008) [-1787.569] (-1783.509) * (-1783.924) (-1784.527) (-1788.512) [-1785.961] -- 0:01:05
      97000 -- [-1783.584] (-1782.309) (-1787.311) (-1782.680) * (-1784.023) (-1784.626) (-1787.366) [-1785.857] -- 0:01:05
      97500 -- (-1785.302) (-1782.650) [-1786.856] (-1784.944) * (-1785.850) (-1782.422) (-1788.404) [-1785.183] -- 0:01:04
      98000 -- [-1787.691] (-1782.682) (-1785.962) (-1784.151) * (-1785.197) (-1783.365) [-1788.333] (-1783.324) -- 0:01:04
      98500 -- (-1785.170) [-1782.794] (-1786.196) (-1783.709) * (-1784.449) (-1785.124) (-1792.405) [-1783.783] -- 0:01:04
      99000 -- (-1785.326) (-1784.743) [-1784.996] (-1784.200) * (-1783.625) (-1789.652) [-1786.796] (-1783.400) -- 0:01:12
      99500 -- [-1783.556] (-1785.141) (-1786.291) (-1783.982) * (-1787.660) (-1788.110) [-1785.143] (-1782.459) -- 0:01:12
      100000 -- [-1784.846] (-1784.560) (-1784.430) (-1783.427) * (-1785.566) (-1785.192) [-1783.478] (-1782.278) -- 0:01:12

      Average standard deviation of split frequencies: 0.021541

      100500 -- (-1784.653) (-1788.375) (-1788.551) [-1783.065] * (-1784.199) [-1783.285] (-1783.338) (-1784.968) -- 0:01:11
      101000 -- (-1788.698) (-1785.309) [-1788.072] (-1783.854) * [-1785.787] (-1783.628) (-1783.988) (-1782.809) -- 0:01:11
      101500 -- (-1790.454) [-1784.902] (-1786.063) (-1783.567) * (-1783.905) (-1785.054) (-1783.776) [-1782.552] -- 0:01:10
      102000 -- (-1784.341) (-1783.588) [-1789.305] (-1783.565) * (-1785.510) (-1786.322) (-1783.622) [-1782.563] -- 0:01:10
      102500 -- (-1783.067) (-1783.255) (-1789.605) [-1783.232] * (-1784.577) (-1782.951) (-1782.616) [-1782.827] -- 0:01:10
      103000 -- [-1783.157] (-1782.695) (-1791.071) (-1784.806) * (-1786.052) (-1782.901) (-1782.592) [-1782.829] -- 0:01:09
      103500 -- (-1782.428) (-1784.385) (-1784.893) [-1784.778] * [-1786.109] (-1782.854) (-1783.137) (-1784.857) -- 0:01:09
      104000 -- (-1782.668) (-1783.164) [-1784.859] (-1785.469) * (-1788.342) [-1785.214] (-1783.970) (-1782.804) -- 0:01:08
      104500 -- (-1783.291) [-1785.665] (-1786.783) (-1784.893) * (-1788.981) (-1785.469) [-1783.675] (-1783.787) -- 0:01:08
      105000 -- (-1783.575) [-1786.090] (-1784.544) (-1784.655) * (-1791.628) (-1783.212) [-1782.609] (-1783.721) -- 0:01:08

      Average standard deviation of split frequencies: 0.021569

      105500 -- (-1783.412) (-1788.108) (-1784.006) [-1785.992] * (-1789.780) [-1785.371] (-1782.886) (-1783.064) -- 0:01:07
      106000 -- (-1784.820) (-1793.422) [-1783.927] (-1785.721) * [-1786.139] (-1786.794) (-1782.700) (-1782.583) -- 0:01:07
      106500 -- (-1784.397) (-1787.432) [-1785.606] (-1784.933) * (-1785.776) [-1786.589] (-1782.899) (-1783.016) -- 0:01:07
      107000 -- (-1787.543) (-1786.762) (-1783.896) [-1784.506] * (-1784.426) [-1786.325] (-1785.728) (-1784.287) -- 0:01:06
      107500 -- (-1787.703) (-1786.604) (-1786.954) [-1782.846] * [-1783.279] (-1783.871) (-1784.920) (-1783.545) -- 0:01:06
      108000 -- (-1783.753) (-1787.242) (-1785.608) [-1784.531] * [-1783.933] (-1787.734) (-1787.205) (-1783.432) -- 0:01:06
      108500 -- (-1787.148) [-1784.242] (-1787.477) (-1785.510) * [-1782.645] (-1786.447) (-1785.050) (-1782.916) -- 0:01:05
      109000 -- (-1784.847) (-1782.437) (-1785.801) [-1782.784] * (-1783.138) (-1784.462) (-1783.478) [-1783.035] -- 0:01:05
      109500 -- (-1783.800) (-1782.770) [-1784.181] (-1783.531) * [-1785.336] (-1783.785) (-1783.384) (-1786.221) -- 0:01:05
      110000 -- (-1784.287) (-1785.480) (-1784.776) [-1783.259] * [-1782.812] (-1782.682) (-1783.791) (-1784.893) -- 0:01:04

      Average standard deviation of split frequencies: 0.020020

      110500 -- (-1787.597) (-1784.188) (-1783.479) [-1782.630] * (-1784.021) (-1784.660) (-1784.580) [-1784.829] -- 0:01:04
      111000 -- (-1788.013) [-1785.678] (-1783.636) (-1783.160) * (-1786.234) (-1782.610) (-1782.834) [-1784.436] -- 0:01:04
      111500 -- (-1783.740) (-1783.898) (-1787.363) [-1784.411] * (-1787.693) (-1782.741) [-1782.945] (-1783.576) -- 0:01:03
      112000 -- [-1785.262] (-1782.812) (-1786.435) (-1785.397) * (-1783.442) [-1782.617] (-1782.948) (-1784.453) -- 0:01:03
      112500 -- (-1784.778) [-1785.565] (-1784.370) (-1785.376) * (-1784.453) (-1784.101) (-1783.325) [-1784.780] -- 0:01:03
      113000 -- (-1790.230) (-1785.464) (-1785.074) [-1784.646] * (-1783.916) (-1784.365) (-1782.810) [-1784.488] -- 0:01:02
      113500 -- (-1787.921) [-1784.385] (-1787.068) (-1783.478) * (-1783.862) (-1782.646) (-1783.782) [-1786.098] -- 0:01:10
      114000 -- [-1784.620] (-1784.405) (-1785.137) (-1786.017) * [-1783.963] (-1792.206) (-1784.161) (-1785.777) -- 0:01:09
      114500 -- (-1784.790) (-1787.643) [-1785.304] (-1783.508) * (-1785.183) [-1786.937] (-1785.930) (-1784.336) -- 0:01:09
      115000 -- [-1784.366] (-1783.875) (-1782.850) (-1784.422) * (-1786.277) [-1785.513] (-1786.070) (-1782.614) -- 0:01:09

      Average standard deviation of split frequencies: 0.018965

      115500 -- (-1786.717) (-1786.634) (-1782.616) [-1783.978] * (-1782.778) [-1786.344] (-1785.392) (-1783.501) -- 0:01:08
      116000 -- (-1787.179) (-1787.477) (-1782.531) [-1783.838] * [-1782.690] (-1783.589) (-1783.643) (-1787.055) -- 0:01:08
      116500 -- (-1783.963) (-1784.547) [-1784.250] (-1787.012) * (-1791.130) (-1783.213) [-1783.515] (-1785.731) -- 0:01:08
      117000 -- (-1782.985) [-1783.454] (-1784.133) (-1784.970) * [-1784.202] (-1784.182) (-1783.103) (-1783.580) -- 0:01:07
      117500 -- (-1786.639) [-1783.477] (-1783.431) (-1787.949) * (-1784.043) (-1785.125) (-1785.982) [-1783.099] -- 0:01:07
      118000 -- (-1790.260) (-1783.713) [-1785.055] (-1788.889) * (-1784.315) [-1783.979] (-1787.528) (-1784.523) -- 0:01:07
      118500 -- [-1786.060] (-1783.611) (-1785.866) (-1783.516) * (-1783.395) (-1787.442) [-1786.947] (-1785.845) -- 0:01:06
      119000 -- (-1787.818) (-1784.821) (-1783.186) [-1783.434] * (-1783.084) [-1784.914] (-1788.996) (-1783.484) -- 0:01:06
      119500 -- (-1785.581) (-1787.825) [-1783.827] (-1784.231) * [-1783.690] (-1785.029) (-1787.228) (-1786.481) -- 0:01:06
      120000 -- (-1784.168) (-1786.145) (-1784.041) [-1783.387] * (-1783.978) (-1786.235) [-1787.825] (-1782.512) -- 0:01:06

      Average standard deviation of split frequencies: 0.017797

      120500 -- [-1786.437] (-1786.280) (-1782.611) (-1784.711) * [-1783.565] (-1784.634) (-1783.083) (-1787.805) -- 0:01:05
      121000 -- (-1784.402) (-1783.081) [-1782.402] (-1786.291) * (-1783.995) (-1785.597) [-1784.856] (-1783.754) -- 0:01:05
      121500 -- (-1787.546) (-1785.153) [-1782.292] (-1788.177) * (-1783.105) (-1783.721) [-1788.650] (-1783.693) -- 0:01:05
      122000 -- (-1785.187) (-1785.889) (-1782.292) [-1787.129] * [-1783.234] (-1783.776) (-1784.318) (-1783.609) -- 0:01:04
      122500 -- (-1785.292) (-1786.737) (-1783.346) [-1786.206] * [-1784.530] (-1784.061) (-1784.439) (-1782.518) -- 0:01:04
      123000 -- (-1784.201) (-1783.567) [-1783.761] (-1784.058) * (-1783.791) (-1783.715) (-1786.160) [-1782.677] -- 0:01:04
      123500 -- [-1784.431] (-1785.381) (-1782.820) (-1789.675) * (-1786.069) (-1783.983) [-1783.713] (-1783.563) -- 0:01:03
      124000 -- (-1785.186) [-1784.865] (-1782.821) (-1785.867) * (-1785.726) (-1783.827) [-1783.792] (-1783.543) -- 0:01:03
      124500 -- (-1784.487) (-1782.444) (-1785.277) [-1782.416] * (-1784.932) [-1784.035] (-1783.936) (-1783.481) -- 0:01:03
      125000 -- (-1784.634) (-1782.694) [-1787.534] (-1783.096) * (-1782.544) (-1782.995) [-1783.260] (-1782.891) -- 0:01:03

      Average standard deviation of split frequencies: 0.017525

      125500 -- [-1785.820] (-1784.754) (-1782.997) (-1788.268) * (-1782.964) [-1784.443] (-1783.701) (-1783.512) -- 0:01:02
      126000 -- [-1788.030] (-1784.062) (-1785.263) (-1786.593) * [-1782.964] (-1784.437) (-1784.050) (-1783.276) -- 0:01:02
      126500 -- [-1785.602] (-1784.062) (-1784.902) (-1785.714) * (-1782.964) (-1784.776) (-1783.781) [-1783.248] -- 0:01:02
      127000 -- (-1783.807) (-1783.871) [-1784.147] (-1785.585) * (-1782.810) (-1785.910) [-1784.238] (-1784.929) -- 0:01:01
      127500 -- (-1783.968) [-1784.040] (-1785.946) (-1784.310) * (-1782.810) [-1783.660] (-1784.092) (-1784.160) -- 0:01:01
      128000 -- (-1784.661) (-1784.239) [-1783.474] (-1784.588) * [-1785.469] (-1784.973) (-1786.631) (-1787.070) -- 0:01:01
      128500 -- (-1784.086) (-1785.657) [-1783.773] (-1783.558) * (-1784.309) (-1784.588) (-1784.234) [-1783.236] -- 0:01:01
      129000 -- (-1785.042) [-1782.565] (-1784.128) (-1783.853) * (-1785.225) (-1783.437) [-1782.799] (-1782.974) -- 0:01:07
      129500 -- [-1790.371] (-1782.842) (-1784.321) (-1783.131) * (-1783.685) (-1783.439) (-1787.730) [-1783.103] -- 0:01:07
      130000 -- (-1789.973) [-1786.595] (-1783.572) (-1783.570) * (-1783.797) (-1784.229) (-1786.577) [-1785.930] -- 0:01:06

      Average standard deviation of split frequencies: 0.018760

      130500 -- (-1786.937) (-1783.725) (-1783.786) [-1783.195] * [-1784.388] (-1783.163) (-1784.079) (-1787.213) -- 0:01:06
      131000 -- (-1788.808) (-1782.382) [-1783.298] (-1785.039) * (-1783.873) (-1789.362) [-1782.744] (-1788.126) -- 0:01:06
      131500 -- (-1787.163) [-1783.018] (-1783.662) (-1784.856) * (-1783.191) (-1788.674) (-1783.802) [-1786.806] -- 0:01:06
      132000 -- (-1784.547) (-1783.722) [-1785.128] (-1794.846) * (-1785.997) (-1788.875) (-1786.062) [-1783.562] -- 0:01:05
      132500 -- (-1786.099) (-1783.097) (-1784.431) [-1789.476] * (-1785.572) (-1784.190) [-1784.276] (-1785.018) -- 0:01:05
      133000 -- [-1783.978] (-1783.706) (-1783.122) (-1788.839) * (-1787.203) (-1786.863) [-1782.869] (-1784.817) -- 0:01:05
      133500 -- (-1785.918) (-1783.858) [-1783.818] (-1784.746) * [-1787.347] (-1786.656) (-1782.876) (-1785.230) -- 0:01:04
      134000 -- (-1785.504) [-1784.146] (-1783.665) (-1787.541) * [-1783.770] (-1783.111) (-1782.876) (-1786.073) -- 0:01:04
      134500 -- (-1783.752) [-1784.710] (-1783.010) (-1785.645) * (-1784.893) [-1784.626] (-1782.752) (-1790.144) -- 0:01:04
      135000 -- (-1784.579) [-1783.197] (-1783.325) (-1787.378) * (-1783.868) (-1783.425) (-1784.348) [-1786.096] -- 0:01:04

      Average standard deviation of split frequencies: 0.017716

      135500 -- (-1782.819) (-1783.770) [-1783.734] (-1786.640) * (-1784.646) (-1787.832) [-1783.455] (-1783.398) -- 0:01:03
      136000 -- (-1785.842) (-1786.215) [-1784.435] (-1794.977) * (-1783.143) (-1785.436) [-1783.432] (-1784.520) -- 0:01:03
      136500 -- [-1782.925] (-1787.159) (-1783.358) (-1785.290) * [-1786.870] (-1784.456) (-1783.208) (-1783.923) -- 0:01:03
      137000 -- (-1785.588) (-1783.057) [-1783.672] (-1784.606) * (-1786.544) (-1786.116) [-1786.285] (-1783.902) -- 0:01:02
      137500 -- [-1789.581] (-1783.519) (-1783.673) (-1784.841) * (-1785.619) (-1791.096) (-1787.435) [-1782.767] -- 0:01:02
      138000 -- (-1790.617) (-1783.188) [-1783.483] (-1784.714) * (-1784.442) (-1787.604) (-1789.161) [-1785.589] -- 0:01:02
      138500 -- [-1784.239] (-1784.015) (-1783.177) (-1782.370) * (-1785.792) (-1788.161) (-1790.326) [-1783.109] -- 0:01:02
      139000 -- [-1785.055] (-1784.009) (-1785.691) (-1782.474) * (-1784.536) (-1784.519) (-1787.881) [-1782.921] -- 0:01:01
      139500 -- (-1784.210) (-1791.642) (-1784.341) [-1786.612] * (-1789.260) (-1785.113) (-1786.184) [-1785.047] -- 0:01:01
      140000 -- [-1783.294] (-1786.847) (-1782.567) (-1786.107) * (-1784.475) [-1783.371] (-1785.958) (-1783.210) -- 0:01:01

      Average standard deviation of split frequencies: 0.016570

      140500 -- (-1784.161) (-1783.387) (-1785.756) [-1786.012] * (-1787.106) (-1784.613) (-1784.364) [-1783.316] -- 0:01:01
      141000 -- (-1782.837) [-1784.239] (-1791.273) (-1783.917) * [-1787.748] (-1784.629) (-1784.662) (-1786.988) -- 0:01:00
      141500 -- [-1785.265] (-1783.035) (-1794.625) (-1784.137) * (-1786.998) (-1786.390) [-1786.519] (-1784.194) -- 0:01:00
      142000 -- (-1785.733) (-1783.050) (-1790.091) [-1783.642] * (-1785.649) [-1783.614] (-1785.242) (-1782.460) -- 0:01:00
      142500 -- (-1793.786) (-1786.648) [-1785.679] (-1783.619) * [-1785.319] (-1783.700) (-1784.366) (-1790.362) -- 0:01:00
      143000 -- [-1794.966] (-1790.025) (-1786.095) (-1783.148) * (-1785.382) (-1783.911) [-1783.768] (-1785.444) -- 0:00:59
      143500 -- (-1788.561) (-1786.461) [-1784.895] (-1783.584) * (-1785.621) (-1784.062) [-1784.053] (-1785.819) -- 0:00:59
      144000 -- (-1785.174) (-1782.633) [-1784.168] (-1784.631) * (-1784.740) [-1785.221] (-1784.315) (-1784.561) -- 0:01:05
      144500 -- (-1784.771) (-1783.806) (-1783.934) [-1783.919] * (-1787.456) (-1785.826) [-1784.733] (-1786.036) -- 0:01:05
      145000 -- (-1783.405) (-1784.160) (-1784.609) [-1782.914] * (-1787.345) (-1784.159) [-1783.689] (-1785.324) -- 0:01:04

      Average standard deviation of split frequencies: 0.014615

      145500 -- (-1783.468) (-1785.568) [-1785.992] (-1783.227) * (-1785.098) (-1787.667) (-1783.306) [-1789.146] -- 0:01:04
      146000 -- (-1784.306) (-1783.853) [-1787.536] (-1786.719) * (-1782.929) [-1784.519] (-1787.268) (-1789.014) -- 0:01:04
      146500 -- [-1785.132] (-1783.611) (-1784.552) (-1789.826) * (-1784.398) [-1785.045] (-1784.921) (-1783.786) -- 0:01:04
      147000 -- [-1784.378] (-1785.081) (-1783.854) (-1792.329) * (-1784.590) (-1785.045) (-1787.676) [-1786.007] -- 0:01:03
      147500 -- (-1783.477) (-1786.998) (-1784.368) [-1791.862] * [-1787.100] (-1787.808) (-1785.192) (-1786.982) -- 0:01:03
      148000 -- (-1783.464) (-1789.280) (-1787.538) [-1790.675] * (-1784.440) (-1785.733) (-1784.134) [-1785.928] -- 0:01:03
      148500 -- (-1784.383) [-1783.322] (-1785.790) (-1786.523) * (-1783.252) (-1784.589) [-1784.570] (-1787.233) -- 0:01:03
      149000 -- [-1783.850] (-1783.992) (-1785.517) (-1786.041) * (-1783.574) [-1783.277] (-1784.737) (-1786.162) -- 0:01:02
      149500 -- (-1784.656) (-1783.566) (-1783.991) [-1784.091] * (-1783.037) (-1788.409) [-1785.113] (-1786.810) -- 0:01:02
      150000 -- (-1784.241) (-1783.383) (-1785.732) [-1785.014] * (-1789.566) (-1784.989) [-1786.274] (-1785.891) -- 0:01:02

      Average standard deviation of split frequencies: 0.016564

      150500 -- (-1783.677) [-1783.121] (-1786.250) (-1787.541) * (-1789.607) [-1783.529] (-1786.983) (-1784.679) -- 0:01:02
      151000 -- (-1783.657) (-1784.748) [-1784.521] (-1787.791) * (-1786.514) [-1786.125] (-1782.575) (-1786.517) -- 0:01:01
      151500 -- (-1784.461) (-1782.580) [-1785.623] (-1787.777) * (-1786.371) (-1785.433) [-1786.851] (-1788.279) -- 0:01:01
      152000 -- (-1783.358) (-1788.914) (-1782.744) [-1783.447] * [-1789.118] (-1783.189) (-1784.028) (-1783.465) -- 0:01:01
      152500 -- (-1783.344) (-1786.778) [-1783.743] (-1783.130) * (-1784.114) [-1784.977] (-1784.355) (-1783.995) -- 0:01:01
      153000 -- [-1783.946] (-1786.555) (-1783.703) (-1785.341) * (-1783.843) (-1783.967) [-1784.144] (-1783.042) -- 0:01:00
      153500 -- (-1783.843) (-1783.613) [-1785.143] (-1784.577) * (-1786.781) (-1787.734) (-1786.398) [-1785.067] -- 0:01:00
      154000 -- (-1783.851) (-1784.132) (-1784.905) [-1784.169] * [-1784.189] (-1786.727) (-1783.802) (-1785.391) -- 0:01:00
      154500 -- [-1784.663] (-1784.236) (-1786.972) (-1787.019) * (-1786.734) (-1785.690) [-1784.540] (-1785.609) -- 0:01:00
      155000 -- (-1783.235) (-1784.262) [-1787.676] (-1786.600) * (-1785.283) (-1787.902) [-1787.734] (-1785.013) -- 0:00:59

      Average standard deviation of split frequencies: 0.015277

      155500 -- [-1784.106] (-1785.350) (-1785.390) (-1782.814) * (-1785.178) (-1788.624) (-1785.799) [-1785.994] -- 0:00:59
      156000 -- [-1783.753] (-1789.659) (-1784.502) (-1782.839) * (-1783.054) (-1786.192) (-1786.462) [-1783.575] -- 0:00:59
      156500 -- [-1785.465] (-1782.612) (-1788.579) (-1788.590) * (-1783.477) (-1789.042) [-1782.576] (-1785.337) -- 0:00:59
      157000 -- [-1784.370] (-1784.002) (-1786.644) (-1784.871) * (-1784.770) (-1792.532) (-1783.606) [-1784.822] -- 0:00:59
      157500 -- [-1784.792] (-1783.724) (-1786.533) (-1783.897) * (-1784.833) (-1786.098) (-1784.746) [-1784.804] -- 0:00:58
      158000 -- (-1784.034) [-1783.301] (-1785.096) (-1784.152) * (-1783.679) (-1787.928) (-1782.446) [-1784.166] -- 0:00:58
      158500 -- [-1784.398] (-1782.278) (-1784.666) (-1785.784) * (-1783.285) (-1788.803) (-1782.446) [-1783.488] -- 0:00:58
      159000 -- (-1783.414) [-1782.346] (-1785.037) (-1783.417) * [-1783.139] (-1788.356) (-1783.341) (-1785.278) -- 0:01:03
      159500 -- (-1782.696) (-1784.820) (-1785.144) [-1783.271] * [-1783.168] (-1784.977) (-1783.035) (-1784.871) -- 0:01:03
      160000 -- (-1784.291) (-1786.892) [-1784.953] (-1786.747) * (-1783.087) (-1783.799) (-1783.582) [-1784.054] -- 0:01:02

      Average standard deviation of split frequencies: 0.015878

      160500 -- [-1784.514] (-1786.417) (-1783.390) (-1786.032) * (-1784.472) (-1782.803) (-1782.639) [-1782.887] -- 0:01:02
      161000 -- (-1785.243) (-1787.125) [-1785.251] (-1786.643) * (-1784.049) (-1783.624) [-1783.019] (-1782.901) -- 0:01:02
      161500 -- [-1783.138] (-1786.756) (-1785.596) (-1782.995) * (-1785.373) [-1783.233] (-1783.054) (-1782.899) -- 0:01:02
      162000 -- (-1785.184) (-1784.935) (-1785.668) [-1782.579] * (-1785.373) (-1783.142) (-1783.703) [-1784.987] -- 0:01:02
      162500 -- [-1785.525] (-1784.947) (-1783.341) (-1782.850) * (-1782.669) (-1782.391) [-1784.024] (-1786.361) -- 0:01:01
      163000 -- [-1785.016] (-1786.281) (-1783.483) (-1782.850) * (-1787.014) [-1783.202] (-1787.688) (-1784.426) -- 0:01:01
      163500 -- (-1786.039) (-1786.884) (-1785.074) [-1783.902] * (-1786.825) (-1782.652) (-1786.214) [-1786.162] -- 0:01:01
      164000 -- (-1783.518) (-1786.319) (-1783.584) [-1783.699] * [-1786.836] (-1782.942) (-1784.474) (-1784.866) -- 0:01:01
      164500 -- (-1785.019) [-1782.501] (-1783.607) (-1786.870) * (-1786.673) (-1783.187) (-1787.076) [-1785.434] -- 0:01:00
      165000 -- (-1782.172) (-1782.501) (-1784.099) [-1784.978] * [-1787.283] (-1782.887) (-1786.262) (-1784.565) -- 0:01:00

      Average standard deviation of split frequencies: 0.014700

      165500 -- (-1782.769) (-1782.501) (-1784.284) [-1783.903] * (-1787.599) [-1782.700] (-1786.097) (-1787.986) -- 0:01:00
      166000 -- [-1782.165] (-1782.411) (-1784.376) (-1784.163) * [-1784.411] (-1782.644) (-1788.743) (-1784.858) -- 0:01:00
      166500 -- (-1783.201) [-1783.617] (-1788.944) (-1784.336) * (-1786.790) [-1785.687] (-1786.189) (-1785.793) -- 0:01:00
      167000 -- [-1783.549] (-1782.888) (-1790.938) (-1785.488) * (-1784.446) [-1784.032] (-1784.383) (-1782.563) -- 0:00:59
      167500 -- (-1785.670) [-1783.419] (-1788.972) (-1784.485) * [-1784.955] (-1783.145) (-1782.854) (-1782.912) -- 0:00:59
      168000 -- (-1785.311) (-1783.479) (-1789.322) [-1784.697] * [-1783.088] (-1783.893) (-1788.264) (-1787.155) -- 0:00:59
      168500 -- [-1784.499] (-1786.558) (-1790.553) (-1786.345) * (-1782.418) [-1784.614] (-1785.490) (-1787.665) -- 0:00:59
      169000 -- (-1785.220) (-1785.448) (-1790.449) [-1787.183] * (-1784.444) (-1784.036) [-1786.267] (-1785.735) -- 0:00:59
      169500 -- (-1783.512) [-1785.506] (-1785.760) (-1784.172) * (-1784.252) (-1785.522) (-1786.943) [-1785.925] -- 0:00:58
      170000 -- [-1784.373] (-1787.877) (-1785.730) (-1783.298) * (-1786.084) (-1787.639) [-1784.428] (-1782.903) -- 0:00:58

      Average standard deviation of split frequencies: 0.015111

      170500 -- (-1785.109) [-1784.072] (-1784.781) (-1785.310) * (-1785.220) (-1785.824) (-1783.495) [-1784.500] -- 0:00:58
      171000 -- (-1788.559) (-1784.846) [-1782.627] (-1782.563) * (-1783.602) (-1785.054) [-1782.435] (-1785.806) -- 0:00:58
      171500 -- (-1785.848) [-1784.289] (-1784.351) (-1783.873) * [-1784.481] (-1783.056) (-1784.767) (-1783.888) -- 0:00:57
      172000 -- (-1783.284) (-1784.298) [-1784.970] (-1786.784) * (-1785.039) [-1784.088] (-1783.335) (-1783.582) -- 0:00:57
      172500 -- (-1783.047) (-1784.455) [-1783.797] (-1784.810) * (-1782.991) (-1783.916) (-1783.637) [-1784.464] -- 0:00:57
      173000 -- (-1783.754) (-1782.883) (-1786.019) [-1783.258] * [-1782.787] (-1785.831) (-1783.595) (-1783.904) -- 0:00:57
      173500 -- (-1784.586) [-1783.217] (-1786.255) (-1784.929) * (-1783.711) [-1784.622] (-1787.165) (-1783.820) -- 0:00:57
      174000 -- [-1785.483] (-1783.218) (-1785.989) (-1785.981) * [-1785.612] (-1784.623) (-1782.551) (-1787.169) -- 0:00:56
      174500 -- [-1787.093] (-1783.068) (-1783.370) (-1784.050) * (-1785.622) (-1783.911) [-1783.887] (-1785.241) -- 0:01:01
      175000 -- (-1784.469) [-1783.497] (-1784.111) (-1784.408) * (-1787.679) (-1784.915) [-1786.454] (-1784.438) -- 0:01:01

      Average standard deviation of split frequencies: 0.016815

      175500 -- (-1783.251) (-1784.104) [-1783.365] (-1783.269) * (-1788.915) (-1784.765) (-1790.194) [-1783.561] -- 0:01:01
      176000 -- (-1787.034) (-1784.104) (-1783.797) [-1784.644] * (-1787.918) (-1786.922) (-1787.862) [-1786.176] -- 0:01:00
      176500 -- (-1786.064) (-1786.018) [-1784.961] (-1784.576) * (-1783.772) [-1785.557] (-1783.129) (-1783.317) -- 0:01:00
      177000 -- (-1783.553) (-1787.278) [-1787.501] (-1782.976) * (-1783.144) (-1791.268) [-1783.055] (-1783.321) -- 0:01:00
      177500 -- (-1784.766) [-1784.592] (-1788.064) (-1782.999) * (-1786.193) (-1790.400) [-1784.414] (-1784.084) -- 0:01:00
      178000 -- [-1786.103] (-1787.919) (-1786.269) (-1787.243) * (-1783.539) [-1785.825] (-1784.310) (-1782.998) -- 0:01:00
      178500 -- [-1783.987] (-1788.083) (-1783.670) (-1790.203) * (-1783.522) (-1785.023) (-1784.310) [-1783.735] -- 0:00:59
      179000 -- (-1787.135) (-1788.596) (-1783.948) [-1788.387] * (-1785.779) (-1784.021) (-1787.038) [-1787.755] -- 0:00:59
      179500 -- [-1790.374] (-1788.112) (-1783.842) (-1784.596) * (-1785.763) (-1784.959) [-1787.408] (-1785.679) -- 0:00:59
      180000 -- (-1788.718) [-1785.082] (-1786.104) (-1783.315) * (-1784.567) (-1789.075) [-1783.655] (-1784.967) -- 0:00:59

      Average standard deviation of split frequencies: 0.015809

      180500 -- [-1787.185] (-1785.029) (-1789.908) (-1783.232) * [-1782.913] (-1786.944) (-1789.408) (-1790.054) -- 0:00:59
      181000 -- (-1783.018) [-1785.516] (-1787.618) (-1783.635) * (-1782.430) (-1784.426) (-1787.191) [-1783.282] -- 0:00:58
      181500 -- [-1783.825] (-1790.189) (-1787.378) (-1787.882) * [-1782.628] (-1782.695) (-1784.823) (-1788.771) -- 0:00:58
      182000 -- [-1785.360] (-1788.242) (-1786.370) (-1788.013) * [-1783.307] (-1782.705) (-1782.439) (-1785.617) -- 0:00:58
      182500 -- (-1785.558) (-1786.336) [-1783.362] (-1789.290) * (-1784.474) [-1783.911] (-1783.902) (-1785.005) -- 0:00:58
      183000 -- [-1784.089] (-1783.930) (-1786.482) (-1784.590) * [-1783.009] (-1783.965) (-1784.214) (-1784.889) -- 0:00:58
      183500 -- (-1783.832) [-1785.275] (-1790.849) (-1786.783) * (-1782.627) [-1782.625] (-1784.762) (-1788.045) -- 0:00:57
      184000 -- (-1783.491) (-1783.272) (-1785.386) [-1783.643] * [-1784.828] (-1782.481) (-1785.537) (-1783.042) -- 0:00:57
      184500 -- (-1783.443) (-1784.375) [-1784.011] (-1784.132) * (-1783.121) (-1783.028) (-1783.452) [-1783.170] -- 0:00:57
      185000 -- [-1783.131] (-1786.715) (-1783.503) (-1784.429) * (-1786.905) [-1783.294] (-1783.909) (-1782.707) -- 0:00:57

      Average standard deviation of split frequencies: 0.016847

      185500 -- (-1783.498) [-1783.914] (-1788.413) (-1784.931) * (-1783.834) (-1782.527) [-1783.266] (-1782.694) -- 0:00:57
      186000 -- [-1784.813] (-1783.234) (-1789.492) (-1791.856) * (-1782.343) (-1784.961) (-1784.353) [-1784.375] -- 0:00:56
      186500 -- (-1783.596) [-1783.254] (-1786.278) (-1783.341) * [-1783.683] (-1783.622) (-1784.965) (-1783.481) -- 0:00:56
      187000 -- (-1783.467) (-1786.334) (-1786.483) [-1784.330] * (-1783.593) [-1784.075] (-1795.907) (-1783.129) -- 0:00:56
      187500 -- (-1785.884) (-1784.418) (-1784.413) [-1784.009] * (-1783.256) [-1783.426] (-1786.778) (-1789.414) -- 0:00:56
      188000 -- (-1782.659) (-1784.418) (-1785.208) [-1784.066] * (-1785.158) (-1784.249) [-1784.066] (-1784.683) -- 0:00:56
      188500 -- [-1783.252] (-1784.084) (-1784.712) (-1785.285) * [-1783.121] (-1784.145) (-1788.248) (-1783.748) -- 0:00:55
      189000 -- [-1783.444] (-1784.625) (-1783.285) (-1786.709) * (-1786.787) [-1788.643] (-1784.684) (-1785.377) -- 0:00:55
      189500 -- (-1783.090) (-1785.949) (-1783.560) [-1785.148] * (-1785.424) (-1784.985) [-1784.522] (-1782.530) -- 0:00:59
      190000 -- (-1783.006) [-1786.679] (-1783.132) (-1788.769) * (-1785.290) (-1784.660) (-1785.052) [-1783.949] -- 0:00:59

      Average standard deviation of split frequencies: 0.016725

      190500 -- (-1784.936) (-1785.053) [-1783.530] (-1786.715) * (-1785.114) (-1784.991) (-1790.842) [-1784.417] -- 0:00:59
      191000 -- (-1785.050) (-1785.021) [-1783.949] (-1786.049) * (-1784.352) (-1785.175) [-1785.279] (-1784.273) -- 0:00:59
      191500 -- (-1785.282) (-1785.290) [-1783.818] (-1785.047) * (-1786.565) (-1785.062) [-1783.558] (-1783.673) -- 0:00:59
      192000 -- (-1786.165) (-1785.056) [-1786.753] (-1783.540) * (-1787.975) (-1785.768) (-1783.192) [-1784.383] -- 0:00:58
      192500 -- (-1784.595) [-1785.149] (-1787.681) (-1786.884) * (-1784.646) (-1788.855) [-1785.403] (-1785.361) -- 0:00:58
      193000 -- [-1786.223] (-1784.084) (-1785.709) (-1783.831) * (-1786.844) [-1784.313] (-1784.563) (-1784.985) -- 0:00:58
      193500 -- (-1785.676) (-1783.877) (-1786.730) [-1783.601] * (-1787.008) (-1784.415) (-1784.619) [-1785.351] -- 0:00:58
      194000 -- (-1784.094) [-1784.083] (-1784.933) (-1783.366) * [-1786.557] (-1783.756) (-1786.301) (-1785.607) -- 0:00:58
      194500 -- (-1783.668) [-1785.957] (-1784.933) (-1784.579) * (-1786.616) [-1784.986] (-1786.926) (-1786.286) -- 0:00:57
      195000 -- (-1785.190) [-1784.380] (-1785.153) (-1785.590) * (-1788.080) [-1783.532] (-1785.377) (-1786.940) -- 0:00:57

      Average standard deviation of split frequencies: 0.015421

      195500 -- (-1786.322) (-1785.354) [-1785.030] (-1784.461) * (-1785.359) [-1784.664] (-1787.583) (-1785.100) -- 0:00:57
      196000 -- (-1783.728) [-1784.968] (-1786.180) (-1787.300) * (-1784.119) (-1785.455) (-1784.377) [-1785.645] -- 0:00:57
      196500 -- (-1784.293) [-1783.886] (-1784.007) (-1786.268) * (-1784.433) (-1787.243) [-1783.215] (-1787.354) -- 0:00:57
      197000 -- (-1783.583) [-1788.217] (-1783.527) (-1785.390) * (-1784.605) (-1786.717) [-1783.571] (-1784.227) -- 0:00:57
      197500 -- (-1783.084) (-1783.997) (-1788.105) [-1785.427] * (-1785.496) (-1786.608) (-1783.047) [-1783.735] -- 0:00:56
      198000 -- (-1783.448) (-1783.914) [-1782.813] (-1783.852) * (-1783.360) (-1785.214) [-1783.227] (-1783.884) -- 0:00:56
      198500 -- [-1783.284] (-1783.964) (-1782.806) (-1783.956) * [-1784.025] (-1786.692) (-1783.235) (-1784.682) -- 0:00:56
      199000 -- [-1783.607] (-1785.747) (-1788.482) (-1783.907) * (-1784.254) (-1786.142) [-1784.423] (-1784.979) -- 0:00:56
      199500 -- (-1785.715) [-1784.844] (-1786.386) (-1783.243) * (-1783.869) [-1783.940] (-1784.595) (-1786.156) -- 0:00:56
      200000 -- (-1783.521) (-1786.684) (-1784.718) [-1784.182] * [-1783.972] (-1782.936) (-1786.999) (-1786.440) -- 0:00:55

      Average standard deviation of split frequencies: 0.016306

      200500 -- (-1783.147) [-1784.540] (-1789.530) (-1784.182) * [-1783.273] (-1783.930) (-1785.793) (-1784.464) -- 0:00:55
      201000 -- (-1783.419) (-1785.223) (-1783.810) [-1783.790] * [-1782.650] (-1783.641) (-1785.416) (-1785.199) -- 0:00:55
      201500 -- (-1784.633) [-1782.800] (-1783.455) (-1784.128) * [-1783.742] (-1783.066) (-1787.452) (-1786.737) -- 0:00:55
      202000 -- [-1783.952] (-1782.614) (-1788.087) (-1785.642) * (-1783.575) (-1784.823) (-1785.122) [-1784.619] -- 0:00:55
      202500 -- (-1787.523) (-1782.571) (-1784.519) [-1783.070] * [-1785.705] (-1788.003) (-1789.781) (-1787.667) -- 0:00:55
      203000 -- (-1784.806) (-1782.569) [-1784.726] (-1783.070) * (-1783.308) (-1788.305) (-1786.682) [-1786.439] -- 0:00:54
      203500 -- (-1784.981) [-1783.537] (-1785.276) (-1784.696) * (-1783.296) (-1787.986) [-1785.144] (-1786.398) -- 0:00:54
      204000 -- (-1782.815) (-1791.751) [-1786.201] (-1783.102) * [-1783.293] (-1786.499) (-1786.999) (-1788.142) -- 0:00:58
      204500 -- [-1783.684] (-1784.957) (-1792.117) (-1783.103) * (-1785.878) [-1787.056] (-1783.890) (-1785.984) -- 0:00:58
      205000 -- [-1784.307] (-1786.903) (-1783.452) (-1783.119) * [-1784.256] (-1787.469) (-1783.813) (-1785.297) -- 0:00:58

      Average standard deviation of split frequencies: 0.015076

      205500 -- (-1783.592) [-1784.577] (-1783.269) (-1782.463) * (-1784.578) (-1783.474) (-1783.444) [-1784.709] -- 0:00:57
      206000 -- (-1790.430) (-1783.213) [-1784.254] (-1784.468) * [-1783.633] (-1783.474) (-1783.259) (-1786.641) -- 0:00:57
      206500 -- [-1783.052] (-1783.116) (-1785.502) (-1783.762) * [-1785.478] (-1782.831) (-1784.512) (-1784.560) -- 0:00:57
      207000 -- [-1784.149] (-1783.204) (-1783.309) (-1782.423) * (-1783.532) (-1784.790) [-1784.360] (-1785.564) -- 0:00:57
      207500 -- (-1782.835) (-1784.611) [-1786.575] (-1782.972) * (-1785.491) (-1785.137) [-1788.929] (-1786.950) -- 0:00:57
      208000 -- (-1782.369) [-1786.076] (-1787.518) (-1782.541) * (-1784.135) [-1784.607] (-1786.371) (-1786.435) -- 0:00:57
      208500 -- (-1786.654) (-1783.459) [-1784.711] (-1782.864) * (-1783.604) (-1783.935) (-1784.075) [-1787.635] -- 0:00:56
      209000 -- (-1786.491) (-1783.536) (-1788.220) [-1785.829] * (-1783.708) (-1782.981) [-1785.040] (-1784.271) -- 0:00:56
      209500 -- [-1784.589] (-1784.566) (-1784.998) (-1785.853) * (-1783.743) (-1782.926) [-1786.043] (-1783.923) -- 0:00:56
      210000 -- (-1784.589) (-1783.280) [-1783.940] (-1785.083) * (-1785.319) (-1782.851) (-1783.111) [-1784.723] -- 0:00:56

      Average standard deviation of split frequencies: 0.013923

      210500 -- [-1783.406] (-1783.323) (-1783.481) (-1784.795) * (-1784.791) (-1782.631) (-1782.686) [-1784.699] -- 0:00:56
      211000 -- (-1783.899) (-1783.276) (-1783.455) [-1784.140] * (-1785.757) [-1783.902] (-1783.801) (-1786.808) -- 0:00:56
      211500 -- [-1784.919] (-1784.645) (-1787.329) (-1783.721) * [-1783.322] (-1785.632) (-1783.950) (-1784.291) -- 0:00:55
      212000 -- [-1787.396] (-1785.350) (-1789.536) (-1784.027) * (-1785.670) [-1785.106] (-1786.308) (-1784.677) -- 0:00:55
      212500 -- [-1788.188] (-1786.813) (-1786.475) (-1783.182) * (-1785.673) [-1784.332] (-1786.319) (-1783.986) -- 0:00:55
      213000 -- (-1786.125) (-1785.983) (-1789.128) [-1784.306] * (-1783.000) (-1783.357) [-1786.247] (-1786.423) -- 0:00:55
      213500 -- (-1785.031) [-1785.807] (-1789.282) (-1784.642) * (-1785.302) [-1784.905] (-1783.569) (-1785.891) -- 0:00:55
      214000 -- (-1786.721) (-1787.560) [-1786.602] (-1785.079) * (-1785.070) [-1783.494] (-1783.416) (-1783.452) -- 0:00:55
      214500 -- (-1783.457) [-1782.495] (-1784.437) (-1786.059) * (-1785.892) [-1783.494] (-1782.587) (-1786.258) -- 0:00:54
      215000 -- (-1784.216) (-1782.496) (-1784.591) [-1782.567] * [-1784.494] (-1784.051) (-1783.036) (-1789.805) -- 0:00:54

      Average standard deviation of split frequencies: 0.014671

      215500 -- (-1783.010) (-1785.944) [-1784.449] (-1782.546) * (-1784.444) (-1785.690) [-1782.841] (-1785.928) -- 0:00:54
      216000 -- (-1784.065) (-1783.433) [-1787.301] (-1783.300) * [-1784.275] (-1785.369) (-1782.948) (-1789.220) -- 0:00:54
      216500 -- (-1783.113) (-1782.601) (-1784.040) [-1782.683] * (-1786.847) (-1788.273) [-1783.745] (-1783.780) -- 0:00:54
      217000 -- (-1782.609) (-1785.389) [-1786.878] (-1782.877) * (-1783.692) (-1783.186) (-1783.071) [-1783.991] -- 0:00:54
      217500 -- (-1783.575) (-1784.753) [-1785.880] (-1783.192) * (-1784.657) [-1782.425] (-1789.522) (-1784.211) -- 0:00:53
      218000 -- [-1787.261] (-1782.955) (-1785.846) (-1786.019) * (-1784.089) [-1785.004] (-1786.027) (-1785.437) -- 0:00:53
      218500 -- [-1783.908] (-1782.736) (-1786.927) (-1785.581) * [-1784.025] (-1783.325) (-1788.427) (-1785.863) -- 0:00:53
      219000 -- [-1786.559] (-1783.417) (-1786.740) (-1787.092) * (-1786.153) (-1788.085) [-1783.619] (-1785.813) -- 0:00:57
      219500 -- (-1787.572) (-1785.135) (-1784.024) [-1785.963] * (-1787.148) (-1784.347) (-1783.835) [-1785.037] -- 0:00:56
      220000 -- (-1788.326) [-1782.822] (-1786.760) (-1784.806) * (-1787.037) (-1783.982) (-1786.481) [-1784.841] -- 0:00:56

      Average standard deviation of split frequencies: 0.013886

      220500 -- (-1786.304) [-1783.438] (-1787.663) (-1787.423) * (-1785.288) (-1786.295) (-1786.419) [-1785.321] -- 0:00:56
      221000 -- (-1784.015) (-1783.466) (-1782.861) [-1784.466] * (-1783.856) [-1790.067] (-1784.219) (-1785.676) -- 0:00:56
      221500 -- (-1784.701) (-1784.314) (-1782.938) [-1787.389] * (-1783.713) (-1787.342) [-1783.966] (-1783.859) -- 0:00:56
      222000 -- (-1786.703) [-1784.624] (-1784.120) (-1788.279) * (-1783.525) [-1783.453] (-1783.632) (-1785.217) -- 0:00:56
      222500 -- (-1784.640) (-1783.300) [-1783.869] (-1783.159) * [-1783.688] (-1783.555) (-1782.801) (-1784.104) -- 0:00:55
      223000 -- (-1787.283) (-1786.433) (-1784.814) [-1782.945] * (-1784.598) [-1782.779] (-1783.449) (-1783.408) -- 0:00:55
      223500 -- (-1784.224) (-1783.741) [-1783.394] (-1782.822) * (-1783.937) (-1785.631) [-1784.338] (-1784.418) -- 0:00:55
      224000 -- (-1784.230) [-1783.233] (-1785.995) (-1784.607) * (-1784.957) (-1785.706) [-1783.495] (-1783.527) -- 0:00:55
      224500 -- (-1787.468) [-1782.912] (-1789.530) (-1786.118) * [-1785.839] (-1783.641) (-1783.479) (-1784.437) -- 0:00:55
      225000 -- (-1787.540) (-1785.542) (-1787.308) [-1783.274] * [-1783.261] (-1782.596) (-1790.550) (-1783.960) -- 0:00:55

      Average standard deviation of split frequencies: 0.013674

      225500 -- (-1783.926) (-1783.334) (-1785.774) [-1783.111] * [-1788.415] (-1783.179) (-1788.655) (-1784.158) -- 0:00:54
      226000 -- (-1783.775) (-1783.029) (-1784.012) [-1783.310] * (-1783.841) (-1784.244) [-1782.845] (-1785.200) -- 0:00:54
      226500 -- (-1784.114) (-1786.213) (-1784.250) [-1783.303] * [-1783.832] (-1783.761) (-1787.169) (-1784.224) -- 0:00:54
      227000 -- (-1783.837) (-1786.457) [-1785.282] (-1783.985) * (-1787.428) [-1785.556] (-1787.198) (-1785.167) -- 0:00:54
      227500 -- (-1786.394) (-1784.279) (-1784.461) [-1783.475] * [-1784.431] (-1784.844) (-1784.590) (-1785.153) -- 0:00:54
      228000 -- [-1783.766] (-1783.135) (-1785.200) (-1786.160) * (-1783.904) (-1784.347) (-1787.451) [-1784.412] -- 0:00:54
      228500 -- (-1787.748) [-1784.268] (-1787.441) (-1783.433) * (-1784.083) (-1782.851) (-1787.234) [-1786.324] -- 0:00:54
      229000 -- (-1784.412) (-1785.614) [-1784.383] (-1782.734) * [-1784.437] (-1782.516) (-1786.521) (-1786.527) -- 0:00:53
      229500 -- [-1783.948] (-1782.834) (-1785.459) (-1782.875) * (-1784.455) (-1784.291) [-1785.961] (-1786.524) -- 0:00:53
      230000 -- (-1784.877) (-1782.895) [-1787.569] (-1783.616) * (-1784.793) (-1785.464) [-1784.676] (-1786.947) -- 0:00:53

      Average standard deviation of split frequencies: 0.013705

      230500 -- (-1785.073) (-1784.195) [-1783.642] (-1786.455) * (-1787.393) [-1783.365] (-1784.011) (-1783.961) -- 0:00:53
      231000 -- (-1784.849) [-1783.358] (-1783.903) (-1782.730) * (-1784.871) [-1787.555] (-1783.613) (-1783.932) -- 0:00:53
      231500 -- (-1785.749) [-1783.376] (-1784.672) (-1782.790) * (-1785.015) [-1786.317] (-1783.441) (-1783.564) -- 0:00:53
      232000 -- (-1786.521) (-1783.446) [-1784.936] (-1783.493) * (-1783.104) (-1784.367) (-1786.181) [-1785.888] -- 0:00:52
      232500 -- (-1786.795) (-1783.607) [-1784.345] (-1785.015) * (-1785.479) (-1783.789) (-1786.218) [-1783.765] -- 0:00:52
      233000 -- [-1789.693] (-1787.660) (-1782.504) (-1785.883) * (-1784.562) [-1785.218] (-1782.487) (-1782.683) -- 0:00:52
      233500 -- [-1783.843] (-1784.701) (-1783.704) (-1782.910) * [-1784.897] (-1786.231) (-1784.665) (-1782.673) -- 0:00:52
      234000 -- (-1784.611) (-1783.893) [-1783.375] (-1784.211) * (-1785.077) (-1783.266) (-1787.010) [-1787.987] -- 0:00:55
      234500 -- [-1784.446] (-1783.624) (-1782.887) (-1783.927) * [-1783.908] (-1783.406) (-1784.985) (-1784.607) -- 0:00:55
      235000 -- (-1788.370) [-1782.742] (-1784.749) (-1782.698) * (-1783.171) (-1784.836) [-1784.465] (-1784.626) -- 0:00:55

      Average standard deviation of split frequencies: 0.013747

      235500 -- (-1786.479) (-1783.024) (-1783.905) [-1784.912] * (-1784.675) (-1785.756) (-1784.692) [-1784.383] -- 0:00:55
      236000 -- (-1784.024) (-1783.068) (-1787.383) [-1783.209] * (-1783.986) (-1785.743) (-1785.215) [-1785.471] -- 0:00:55
      236500 -- (-1787.683) (-1783.207) (-1787.057) [-1784.167] * [-1782.706] (-1784.742) (-1790.103) (-1787.725) -- 0:00:54
      237000 -- (-1785.141) [-1784.773] (-1784.123) (-1785.804) * (-1783.774) (-1786.761) [-1784.820] (-1788.932) -- 0:00:54
      237500 -- (-1785.306) [-1785.628] (-1783.939) (-1787.175) * (-1782.820) [-1785.330] (-1784.513) (-1789.205) -- 0:00:54
      238000 -- (-1784.855) [-1786.483] (-1783.939) (-1785.734) * [-1782.820] (-1784.831) (-1783.596) (-1784.543) -- 0:00:54
      238500 -- (-1785.249) (-1786.483) [-1786.628] (-1784.116) * (-1784.419) (-1787.193) [-1783.623] (-1784.585) -- 0:00:54
      239000 -- (-1785.701) (-1785.029) [-1787.415] (-1783.144) * (-1782.622) [-1782.692] (-1784.558) (-1784.936) -- 0:00:54
      239500 -- (-1789.146) (-1787.673) [-1786.492] (-1789.926) * (-1782.683) [-1783.085] (-1784.237) (-1787.508) -- 0:00:53
      240000 -- (-1789.472) (-1785.592) [-1784.693] (-1788.375) * [-1783.272] (-1782.557) (-1784.942) (-1788.718) -- 0:00:53

      Average standard deviation of split frequencies: 0.014748

      240500 -- (-1786.052) [-1785.786] (-1783.786) (-1790.269) * [-1784.584] (-1784.573) (-1784.111) (-1788.637) -- 0:00:53
      241000 -- (-1785.423) (-1786.267) [-1786.131] (-1783.604) * (-1784.392) [-1785.668] (-1784.539) (-1788.742) -- 0:00:53
      241500 -- [-1787.448] (-1789.499) (-1790.794) (-1782.651) * [-1783.223] (-1785.008) (-1784.298) (-1791.744) -- 0:00:53
      242000 -- (-1787.440) (-1783.969) (-1785.173) [-1782.801] * [-1783.066] (-1783.394) (-1783.387) (-1790.626) -- 0:00:53
      242500 -- (-1788.759) [-1783.735] (-1789.274) (-1784.819) * (-1786.452) (-1783.862) (-1783.228) [-1783.960] -- 0:00:53
      243000 -- (-1787.250) [-1782.448] (-1790.053) (-1783.856) * (-1787.711) (-1783.818) (-1787.254) [-1784.336] -- 0:00:52
      243500 -- (-1788.256) (-1782.867) (-1787.893) [-1783.991] * (-1786.118) [-1784.733] (-1785.087) (-1784.474) -- 0:00:52
      244000 -- (-1788.014) (-1782.924) (-1784.241) [-1783.488] * [-1783.414] (-1784.847) (-1783.700) (-1785.300) -- 0:00:52
      244500 -- (-1789.327) [-1783.156] (-1786.268) (-1782.799) * (-1783.085) (-1784.130) (-1784.377) [-1784.967] -- 0:00:52
      245000 -- (-1789.906) [-1783.170] (-1783.035) (-1782.887) * [-1783.340] (-1782.535) (-1788.186) (-1784.765) -- 0:00:52

      Average standard deviation of split frequencies: 0.015668

      245500 -- (-1790.220) [-1786.453] (-1785.098) (-1784.092) * (-1784.879) [-1783.972] (-1786.766) (-1782.858) -- 0:00:52
      246000 -- (-1785.058) [-1786.270] (-1785.147) (-1783.522) * (-1789.040) (-1783.167) (-1785.288) [-1782.632] -- 0:00:52
      246500 -- (-1785.816) [-1784.813] (-1786.406) (-1784.386) * [-1787.672] (-1784.323) (-1783.685) (-1787.236) -- 0:00:51
      247000 -- (-1785.764) (-1786.360) [-1784.857] (-1788.064) * (-1785.990) [-1782.390] (-1783.240) (-1787.685) -- 0:00:51
      247500 -- (-1787.843) (-1784.908) [-1785.705] (-1782.649) * (-1788.517) (-1782.633) [-1784.808] (-1787.328) -- 0:00:51
      248000 -- (-1787.518) [-1784.346] (-1787.013) (-1787.882) * [-1785.788] (-1783.983) (-1785.837) (-1784.449) -- 0:00:51
      248500 -- [-1783.035] (-1784.731) (-1784.279) (-1787.622) * (-1787.092) (-1782.975) [-1786.322] (-1787.443) -- 0:00:51
      249000 -- (-1786.539) (-1782.611) [-1786.201] (-1786.003) * (-1785.339) (-1784.822) (-1785.591) [-1784.457] -- 0:00:54
      249500 -- (-1786.017) (-1783.347) (-1783.891) [-1782.888] * (-1783.245) (-1786.270) [-1785.135] (-1784.604) -- 0:00:54
      250000 -- (-1788.508) (-1785.875) (-1785.344) [-1784.220] * [-1783.886] (-1790.993) (-1783.839) (-1784.601) -- 0:00:54

      Average standard deviation of split frequencies: 0.015598

      250500 -- (-1786.662) [-1784.108] (-1785.415) (-1784.295) * (-1784.354) (-1785.536) (-1783.390) [-1784.625] -- 0:00:53
      251000 -- (-1787.497) (-1783.623) (-1783.561) [-1789.514] * (-1783.890) (-1783.608) [-1783.291] (-1787.880) -- 0:00:53
      251500 -- (-1784.307) (-1787.986) [-1784.247] (-1784.235) * (-1784.479) [-1783.688] (-1784.468) (-1787.602) -- 0:00:53
      252000 -- [-1783.277] (-1784.771) (-1784.523) (-1784.416) * (-1785.919) (-1783.389) [-1783.299] (-1783.001) -- 0:00:53
      252500 -- (-1783.255) [-1784.703] (-1783.383) (-1783.821) * (-1782.659) (-1783.391) (-1783.440) [-1783.431] -- 0:00:53
      253000 -- [-1782.893] (-1787.784) (-1785.934) (-1787.482) * (-1783.124) (-1785.395) (-1784.965) [-1783.990] -- 0:00:53
      253500 -- [-1782.725] (-1785.466) (-1784.629) (-1786.699) * (-1783.247) (-1785.259) [-1783.519] (-1787.417) -- 0:00:53
      254000 -- (-1782.833) (-1785.720) [-1783.061] (-1783.444) * [-1783.535] (-1782.596) (-1783.175) (-1788.917) -- 0:00:52
      254500 -- (-1784.008) (-1785.315) [-1782.240] (-1785.650) * (-1783.812) (-1783.807) (-1783.599) [-1785.896] -- 0:00:52
      255000 -- (-1782.738) (-1786.609) [-1783.935] (-1786.561) * [-1784.225] (-1788.445) (-1784.132) (-1782.350) -- 0:00:52

      Average standard deviation of split frequencies: 0.015652

      255500 -- [-1784.311] (-1786.246) (-1783.316) (-1785.040) * (-1783.729) (-1784.136) [-1785.736] (-1782.755) -- 0:00:52
      256000 -- (-1787.264) (-1791.086) (-1785.554) [-1784.272] * (-1783.716) [-1784.136] (-1785.736) (-1786.726) -- 0:00:52
      256500 -- (-1786.223) (-1785.843) (-1782.896) [-1783.352] * (-1784.781) [-1784.011] (-1784.855) (-1785.445) -- 0:00:52
      257000 -- [-1785.694] (-1784.567) (-1785.766) (-1786.922) * [-1785.995] (-1784.668) (-1787.806) (-1788.477) -- 0:00:52
      257500 -- (-1784.581) (-1788.798) [-1784.234] (-1784.233) * (-1784.929) [-1782.801] (-1786.993) (-1786.217) -- 0:00:51
      258000 -- (-1784.310) (-1786.363) [-1784.039] (-1783.809) * [-1786.038] (-1782.807) (-1787.380) (-1787.060) -- 0:00:51
      258500 -- (-1783.638) (-1789.290) [-1785.379] (-1785.006) * (-1784.434) [-1783.324] (-1789.357) (-1785.441) -- 0:00:51
      259000 -- (-1792.813) (-1791.538) [-1783.636] (-1785.643) * (-1784.023) (-1784.181) [-1787.143] (-1785.245) -- 0:00:51
      259500 -- [-1788.392] (-1788.533) (-1783.384) (-1784.642) * [-1783.507] (-1783.365) (-1788.384) (-1790.720) -- 0:00:51
      260000 -- (-1785.476) (-1789.178) [-1782.849] (-1784.877) * (-1783.506) [-1783.672] (-1784.309) (-1783.852) -- 0:00:51

      Average standard deviation of split frequencies: 0.014361

      260500 -- [-1784.712] (-1788.921) (-1782.831) (-1784.671) * (-1787.933) (-1783.170) [-1788.409] (-1789.890) -- 0:00:51
      261000 -- (-1783.140) (-1788.346) (-1782.774) [-1787.416] * (-1785.262) [-1783.170] (-1789.476) (-1787.553) -- 0:00:50
      261500 -- (-1783.193) [-1786.284] (-1783.333) (-1787.293) * (-1786.483) [-1785.681] (-1783.713) (-1784.578) -- 0:00:50
      262000 -- (-1782.689) (-1784.470) [-1784.371] (-1786.012) * (-1783.832) (-1785.470) [-1783.274] (-1787.888) -- 0:00:50
      262500 -- (-1784.677) [-1783.500] (-1787.006) (-1790.949) * (-1784.534) (-1783.993) [-1783.338] (-1789.235) -- 0:00:50
      263000 -- [-1787.285] (-1784.112) (-1782.547) (-1785.808) * [-1783.101] (-1783.472) (-1790.943) (-1786.690) -- 0:00:50
      263500 -- (-1788.300) [-1787.164] (-1784.103) (-1785.975) * (-1782.660) [-1785.059] (-1787.019) (-1785.736) -- 0:00:53
      264000 -- (-1786.532) (-1785.075) [-1784.714] (-1783.398) * [-1784.747] (-1782.533) (-1787.553) (-1785.883) -- 0:00:52
      264500 -- [-1786.158] (-1788.411) (-1789.424) (-1787.477) * [-1784.893] (-1782.544) (-1789.125) (-1785.662) -- 0:00:52
      265000 -- (-1785.679) (-1784.324) (-1785.744) [-1786.849] * (-1783.599) [-1782.569] (-1784.729) (-1787.084) -- 0:00:52

      Average standard deviation of split frequencies: 0.014670

      265500 -- (-1788.109) [-1791.450] (-1785.619) (-1786.206) * (-1783.536) (-1788.368) (-1785.030) [-1785.762] -- 0:00:52
      266000 -- (-1783.591) (-1786.715) (-1784.792) [-1787.881] * (-1785.486) (-1788.686) (-1784.445) [-1789.041] -- 0:00:52
      266500 -- [-1784.564] (-1784.770) (-1785.982) (-1784.729) * (-1782.995) [-1788.744] (-1785.886) (-1787.103) -- 0:00:52
      267000 -- (-1786.788) (-1784.104) [-1785.239] (-1783.923) * [-1785.679] (-1786.205) (-1784.435) (-1784.869) -- 0:00:52
      267500 -- (-1788.243) (-1784.029) [-1787.062] (-1783.734) * (-1790.518) [-1784.205] (-1785.302) (-1783.678) -- 0:00:52
      268000 -- [-1786.648] (-1784.712) (-1787.003) (-1783.753) * (-1785.657) (-1786.234) (-1785.643) [-1785.952] -- 0:00:51
      268500 -- (-1787.848) (-1784.106) [-1784.141] (-1788.370) * (-1786.203) (-1789.612) [-1785.703] (-1790.563) -- 0:00:51
      269000 -- (-1785.929) (-1790.144) (-1787.595) [-1790.499] * (-1784.714) [-1783.410] (-1784.550) (-1791.293) -- 0:00:51
      269500 -- (-1787.705) (-1790.508) (-1782.664) [-1787.410] * (-1784.395) (-1786.218) [-1784.346] (-1787.234) -- 0:00:51
      270000 -- [-1785.559] (-1791.457) (-1783.135) (-1787.136) * (-1786.503) (-1786.105) [-1783.868] (-1787.312) -- 0:00:51

      Average standard deviation of split frequencies: 0.015060

      270500 -- (-1786.480) (-1788.773) [-1783.637] (-1786.532) * (-1788.329) (-1782.691) [-1785.354] (-1783.778) -- 0:00:51
      271000 -- [-1783.148] (-1791.490) (-1783.645) (-1785.626) * (-1784.283) [-1782.593] (-1784.928) (-1786.222) -- 0:00:51
      271500 -- (-1786.715) [-1785.371] (-1784.109) (-1785.891) * [-1786.245] (-1782.310) (-1785.418) (-1784.737) -- 0:00:50
      272000 -- (-1784.670) (-1792.641) [-1784.413] (-1784.436) * [-1786.923] (-1782.594) (-1785.854) (-1784.099) -- 0:00:50
      272500 -- (-1784.544) (-1786.043) (-1785.719) [-1783.618] * (-1786.816) (-1786.820) (-1786.570) [-1782.897] -- 0:00:50
      273000 -- [-1784.549] (-1784.695) (-1785.125) (-1785.222) * (-1783.665) [-1784.376] (-1784.314) (-1782.961) -- 0:00:50
      273500 -- (-1784.816) (-1783.076) (-1787.090) [-1786.174] * (-1783.559) (-1785.944) (-1783.625) [-1783.795] -- 0:00:50
      274000 -- (-1783.195) (-1783.645) (-1790.154) [-1783.825] * (-1783.757) (-1790.255) (-1784.559) [-1783.686] -- 0:00:50
      274500 -- (-1786.063) (-1783.543) (-1783.433) [-1782.912] * (-1783.019) [-1785.305] (-1784.471) (-1783.604) -- 0:00:50
      275000 -- (-1784.842) (-1782.950) [-1782.492] (-1783.574) * (-1785.507) [-1784.629] (-1786.732) (-1783.710) -- 0:00:50

      Average standard deviation of split frequencies: 0.015070

      275500 -- (-1782.635) (-1784.326) (-1782.493) [-1784.323] * (-1788.095) (-1785.034) (-1785.154) [-1782.857] -- 0:00:49
      276000 -- (-1782.868) (-1783.291) [-1782.899] (-1784.695) * (-1787.116) (-1784.391) (-1788.443) [-1782.965] -- 0:00:49
      276500 -- [-1784.190] (-1783.506) (-1782.977) (-1785.509) * (-1785.876) (-1784.676) [-1785.968] (-1783.496) -- 0:00:49
      277000 -- (-1784.514) [-1784.268] (-1784.640) (-1785.818) * (-1784.947) (-1784.507) [-1785.684] (-1783.949) -- 0:00:49
      277500 -- (-1783.396) (-1784.094) (-1785.128) [-1785.640] * (-1785.498) [-1783.584] (-1785.402) (-1784.817) -- 0:00:49
      278000 -- [-1784.825] (-1786.687) (-1785.654) (-1787.323) * (-1785.416) (-1784.051) (-1789.992) [-1784.356] -- 0:00:49
      278500 -- (-1783.922) [-1786.583] (-1791.594) (-1786.903) * (-1788.020) (-1784.738) (-1784.913) [-1783.554] -- 0:00:51
      279000 -- [-1783.132] (-1783.480) (-1788.257) (-1783.315) * (-1783.289) (-1783.063) (-1785.171) [-1784.343] -- 0:00:51
      279500 -- [-1784.898] (-1783.253) (-1786.050) (-1785.939) * (-1784.744) (-1782.957) [-1787.801] (-1787.490) -- 0:00:51
      280000 -- (-1787.060) (-1783.246) [-1788.349] (-1784.715) * (-1784.281) (-1783.057) [-1789.310] (-1783.536) -- 0:00:51

      Average standard deviation of split frequencies: 0.014030

      280500 -- (-1786.145) (-1784.290) (-1784.053) [-1784.661] * (-1783.929) [-1785.481] (-1788.915) (-1782.678) -- 0:00:51
      281000 -- [-1787.070] (-1790.804) (-1784.918) (-1784.524) * (-1786.069) (-1783.097) (-1785.741) [-1782.963] -- 0:00:51
      281500 -- (-1783.848) [-1786.711] (-1784.778) (-1784.799) * (-1784.571) (-1782.529) [-1785.987] (-1782.702) -- 0:00:51
      282000 -- (-1784.194) (-1783.251) [-1784.657] (-1784.147) * (-1785.821) (-1782.770) (-1786.691) [-1783.050] -- 0:00:50
      282500 -- (-1783.598) (-1784.226) [-1784.828] (-1787.032) * [-1784.837] (-1784.719) (-1787.137) (-1786.026) -- 0:00:50
      283000 -- [-1787.312] (-1784.961) (-1783.210) (-1786.696) * [-1783.880] (-1784.169) (-1788.347) (-1782.763) -- 0:00:50
      283500 -- (-1792.379) (-1784.005) [-1782.341] (-1784.802) * [-1782.409] (-1789.459) (-1786.601) (-1783.149) -- 0:00:50
      284000 -- [-1783.851] (-1783.895) (-1782.452) (-1782.542) * (-1782.834) (-1786.111) [-1787.432] (-1785.255) -- 0:00:50
      284500 -- (-1782.856) [-1783.994] (-1782.572) (-1786.514) * (-1789.132) [-1784.477] (-1783.433) (-1785.072) -- 0:00:50
      285000 -- (-1783.509) (-1785.494) (-1783.521) [-1784.389] * (-1786.374) (-1783.909) (-1786.748) [-1785.275] -- 0:00:50

      Average standard deviation of split frequencies: 0.014447

      285500 -- [-1783.895] (-1783.600) (-1784.235) (-1783.834) * (-1785.020) (-1784.178) [-1786.048] (-1786.409) -- 0:00:50
      286000 -- [-1783.256] (-1783.756) (-1783.879) (-1787.110) * (-1785.201) (-1785.675) (-1783.429) [-1784.030] -- 0:00:49
      286500 -- (-1786.142) [-1784.992] (-1784.594) (-1787.244) * (-1786.096) (-1785.099) (-1787.367) [-1782.778] -- 0:00:49
      287000 -- (-1786.531) [-1784.597] (-1784.091) (-1785.882) * (-1786.589) (-1787.339) (-1783.462) [-1783.457] -- 0:00:49
      287500 -- [-1784.409] (-1783.163) (-1783.733) (-1785.712) * [-1784.537] (-1784.840) (-1783.115) (-1783.276) -- 0:00:49
      288000 -- (-1786.141) [-1785.151] (-1786.149) (-1786.651) * [-1783.919] (-1783.809) (-1782.923) (-1783.585) -- 0:00:49
      288500 -- (-1784.286) (-1785.370) [-1782.844] (-1784.656) * [-1783.290] (-1784.705) (-1784.751) (-1785.473) -- 0:00:49
      289000 -- (-1786.635) (-1787.069) [-1782.527] (-1788.619) * (-1784.636) (-1783.677) (-1785.725) [-1784.943] -- 0:00:49
      289500 -- (-1783.506) (-1785.075) (-1782.761) [-1786.410] * (-1788.448) (-1784.702) (-1785.697) [-1784.358] -- 0:00:49
      290000 -- (-1783.788) (-1786.561) [-1788.513] (-1790.498) * (-1784.748) [-1784.641] (-1784.332) (-1783.777) -- 0:00:48

      Average standard deviation of split frequencies: 0.014596

      290500 -- (-1785.349) (-1782.865) [-1786.449] (-1790.655) * [-1784.320] (-1787.808) (-1782.676) (-1783.958) -- 0:00:48
      291000 -- (-1786.236) (-1784.476) [-1784.444] (-1787.055) * (-1785.079) [-1784.459] (-1782.356) (-1786.124) -- 0:00:48
      291500 -- (-1788.441) (-1787.382) (-1784.506) [-1784.822] * (-1784.741) (-1786.383) [-1785.480] (-1783.439) -- 0:00:48
      292000 -- [-1785.304] (-1785.065) (-1788.798) (-1785.245) * (-1785.877) (-1787.514) [-1782.950] (-1786.939) -- 0:00:48
      292500 -- (-1783.872) [-1783.981] (-1786.786) (-1783.963) * (-1785.226) (-1784.399) [-1782.502] (-1787.152) -- 0:00:48
      293000 -- [-1784.763] (-1784.234) (-1788.049) (-1784.211) * (-1785.124) (-1784.225) [-1782.478] (-1789.425) -- 0:00:50
      293500 -- [-1786.851] (-1786.028) (-1785.646) (-1783.578) * [-1784.452] (-1782.777) (-1783.455) (-1787.090) -- 0:00:50
      294000 -- [-1787.748] (-1782.650) (-1784.753) (-1785.865) * [-1782.891] (-1784.218) (-1782.467) (-1785.326) -- 0:00:50
      294500 -- (-1785.681) (-1790.481) [-1784.309] (-1785.338) * (-1784.036) (-1785.654) [-1782.879] (-1786.249) -- 0:00:50
      295000 -- (-1786.299) (-1785.880) [-1784.143] (-1782.480) * (-1785.097) [-1786.942] (-1784.818) (-1785.157) -- 0:00:50

      Average standard deviation of split frequencies: 0.015176

      295500 -- (-1784.129) (-1788.638) (-1783.244) [-1783.016] * (-1783.334) (-1782.860) (-1784.596) [-1785.527] -- 0:00:50
      296000 -- [-1784.917] (-1789.720) (-1783.093) (-1782.865) * (-1786.026) (-1782.738) [-1785.206] (-1784.415) -- 0:00:49
      296500 -- (-1782.758) [-1788.815] (-1784.451) (-1783.321) * (-1785.712) [-1787.019] (-1784.151) (-1784.331) -- 0:00:49
      297000 -- (-1782.758) (-1787.426) [-1783.601] (-1783.701) * (-1787.873) (-1786.341) (-1789.678) [-1785.779] -- 0:00:49
      297500 -- (-1785.543) [-1786.202] (-1785.669) (-1784.640) * (-1783.430) (-1785.035) [-1786.499] (-1783.225) -- 0:00:49
      298000 -- (-1783.429) (-1785.937) (-1783.817) [-1785.715] * (-1783.525) (-1784.415) (-1785.495) [-1782.906] -- 0:00:49
      298500 -- [-1783.448] (-1789.313) (-1789.274) (-1786.502) * (-1783.564) [-1782.564] (-1785.334) (-1783.127) -- 0:00:49
      299000 -- (-1782.618) (-1782.995) [-1783.888] (-1786.284) * [-1786.268] (-1782.743) (-1788.152) (-1787.153) -- 0:00:49
      299500 -- (-1782.554) [-1783.600] (-1784.372) (-1784.001) * [-1783.823] (-1785.534) (-1784.403) (-1788.664) -- 0:00:49
      300000 -- (-1784.811) [-1784.392] (-1784.785) (-1785.184) * (-1785.727) (-1785.802) [-1783.714] (-1787.085) -- 0:00:48

      Average standard deviation of split frequencies: 0.013926

      300500 -- (-1786.063) (-1783.200) (-1787.591) [-1783.523] * (-1783.455) (-1784.691) [-1783.864] (-1785.446) -- 0:00:48
      301000 -- (-1786.212) (-1784.277) [-1784.079] (-1782.910) * (-1784.432) (-1783.876) (-1783.372) [-1783.698] -- 0:00:48
      301500 -- (-1784.260) (-1783.727) [-1784.119] (-1782.829) * (-1785.360) [-1784.196] (-1785.792) (-1784.043) -- 0:00:48
      302000 -- [-1784.212] (-1783.172) (-1783.765) (-1783.497) * [-1787.896] (-1784.443) (-1784.882) (-1783.655) -- 0:00:48
      302500 -- (-1784.268) (-1783.913) [-1785.326] (-1784.230) * (-1785.528) (-1784.543) (-1784.003) [-1790.420] -- 0:00:48
      303000 -- [-1785.591] (-1783.050) (-1783.871) (-1785.968) * (-1783.549) [-1786.026] (-1783.970) (-1783.570) -- 0:00:48
      303500 -- (-1784.781) (-1784.394) (-1782.870) [-1785.778] * [-1785.646] (-1784.757) (-1787.538) (-1783.379) -- 0:00:48
      304000 -- (-1783.325) [-1785.233] (-1782.840) (-1782.769) * (-1786.234) (-1786.261) (-1788.439) [-1783.379] -- 0:00:48
      304500 -- [-1783.368] (-1783.935) (-1784.983) (-1782.803) * (-1784.605) (-1786.168) [-1784.709] (-1783.503) -- 0:00:47
      305000 -- (-1782.750) (-1784.476) [-1784.981] (-1785.726) * (-1784.010) (-1786.265) (-1784.560) [-1783.571] -- 0:00:47

      Average standard deviation of split frequencies: 0.014409

      305500 -- (-1786.325) (-1782.838) [-1785.107] (-1784.591) * (-1788.265) [-1787.180] (-1784.759) (-1784.697) -- 0:00:47
      306000 -- (-1783.463) (-1782.493) [-1786.970] (-1784.387) * (-1786.254) (-1786.391) [-1784.180] (-1784.950) -- 0:00:47
      306500 -- (-1782.859) [-1782.470] (-1784.689) (-1786.045) * (-1786.314) [-1784.558] (-1784.386) (-1783.430) -- 0:00:47
      307000 -- (-1784.953) (-1785.265) (-1785.408) [-1784.555] * [-1782.869] (-1785.782) (-1786.695) (-1785.488) -- 0:00:47
      307500 -- (-1783.394) (-1789.005) [-1784.855] (-1788.648) * (-1783.432) (-1785.949) (-1788.199) [-1782.456] -- 0:00:49
      308000 -- [-1785.926] (-1784.669) (-1784.771) (-1784.425) * (-1789.056) (-1784.538) (-1784.534) [-1782.483] -- 0:00:49
      308500 -- [-1786.516] (-1784.038) (-1784.227) (-1786.654) * (-1787.602) [-1787.550] (-1784.512) (-1782.446) -- 0:00:49
      309000 -- (-1786.763) (-1783.331) [-1783.316] (-1786.507) * (-1784.826) [-1784.132] (-1784.585) (-1782.458) -- 0:00:49
      309500 -- (-1786.434) [-1784.126] (-1784.993) (-1784.403) * [-1786.542] (-1782.652) (-1783.849) (-1783.706) -- 0:00:49
      310000 -- (-1784.678) (-1783.236) [-1784.561] (-1783.843) * [-1785.846] (-1783.615) (-1783.855) (-1782.978) -- 0:00:48

      Average standard deviation of split frequencies: 0.014103

      310500 -- [-1789.022] (-1783.760) (-1787.036) (-1783.797) * (-1785.121) (-1785.594) [-1783.840] (-1784.320) -- 0:00:48
      311000 -- (-1787.476) (-1784.894) [-1784.228] (-1787.936) * [-1789.951] (-1783.534) (-1784.676) (-1784.634) -- 0:00:48
      311500 -- [-1783.347] (-1785.610) (-1789.436) (-1784.035) * (-1786.835) (-1783.296) (-1783.134) [-1784.459] -- 0:00:48
      312000 -- [-1785.079] (-1785.142) (-1789.498) (-1784.149) * (-1782.652) (-1784.315) (-1783.134) [-1783.315] -- 0:00:48
      312500 -- (-1784.577) [-1784.892] (-1786.061) (-1783.465) * (-1784.418) (-1783.348) [-1784.999] (-1783.469) -- 0:00:48
      313000 -- (-1789.408) (-1785.154) [-1783.803] (-1783.193) * (-1783.135) (-1787.795) (-1785.161) [-1783.039] -- 0:00:48
      313500 -- (-1785.942) [-1786.038] (-1785.662) (-1784.549) * (-1784.752) (-1785.542) [-1787.100] (-1782.679) -- 0:00:48
      314000 -- (-1784.842) (-1783.816) (-1783.833) [-1784.227] * [-1783.487] (-1786.292) (-1788.406) (-1782.750) -- 0:00:48
      314500 -- (-1784.487) (-1783.289) (-1783.056) [-1783.921] * (-1782.925) (-1786.167) [-1784.930] (-1785.688) -- 0:00:47
      315000 -- (-1785.010) [-1784.439] (-1785.172) (-1785.128) * (-1786.579) (-1788.659) (-1784.030) [-1786.349] -- 0:00:47

      Average standard deviation of split frequencies: 0.013426

      315500 -- (-1783.247) (-1782.539) [-1782.952] (-1784.233) * (-1786.376) (-1786.798) (-1784.194) [-1785.978] -- 0:00:47
      316000 -- (-1784.731) [-1783.239] (-1783.490) (-1783.729) * (-1786.938) (-1783.756) (-1788.982) [-1784.577] -- 0:00:47
      316500 -- (-1785.352) (-1783.239) [-1784.107] (-1784.006) * (-1785.212) (-1786.562) [-1785.833] (-1784.305) -- 0:00:47
      317000 -- (-1782.733) [-1783.991] (-1782.935) (-1786.295) * (-1787.209) (-1785.055) (-1788.219) [-1787.468] -- 0:00:47
      317500 -- (-1782.442) (-1788.937) (-1782.946) [-1786.047] * (-1786.199) [-1783.352] (-1786.099) (-1784.865) -- 0:00:47
      318000 -- (-1782.438) (-1783.918) (-1783.854) [-1785.160] * (-1787.333) (-1784.285) [-1783.448] (-1786.549) -- 0:00:47
      318500 -- (-1782.233) (-1788.046) (-1785.949) [-1786.312] * (-1784.257) (-1785.248) [-1783.036] (-1788.180) -- 0:00:47
      319000 -- [-1782.239] (-1785.190) (-1784.401) (-1786.806) * (-1784.382) (-1785.062) (-1787.051) [-1786.105] -- 0:00:46
      319500 -- (-1786.112) [-1783.397] (-1788.158) (-1790.825) * (-1784.414) (-1786.444) [-1783.792] (-1789.429) -- 0:00:46
      320000 -- (-1786.324) (-1782.402) (-1784.933) [-1787.628] * (-1783.715) [-1783.920] (-1784.030) (-1787.693) -- 0:00:46

      Average standard deviation of split frequencies: 0.013490

      320500 -- (-1785.777) (-1786.233) [-1784.240] (-1784.988) * (-1783.060) (-1783.876) [-1788.319] (-1786.397) -- 0:00:46
      321000 -- (-1785.558) (-1787.748) (-1784.487) [-1785.303] * (-1786.826) [-1784.907] (-1784.905) (-1791.617) -- 0:00:46
      321500 -- (-1785.623) (-1782.814) [-1783.641] (-1786.617) * [-1783.589] (-1784.217) (-1787.149) (-1792.513) -- 0:00:46
      322000 -- (-1788.116) (-1786.414) [-1782.801] (-1784.086) * (-1783.380) (-1783.723) [-1787.403] (-1787.728) -- 0:00:46
      322500 -- (-1786.048) [-1785.526] (-1783.049) (-1784.002) * (-1783.117) [-1789.029] (-1801.054) (-1785.191) -- 0:00:48
      323000 -- (-1786.238) (-1786.027) [-1783.312] (-1784.746) * (-1789.411) [-1784.143] (-1792.086) (-1786.093) -- 0:00:48
      323500 -- (-1785.264) (-1785.511) (-1783.243) [-1784.169] * [-1785.808] (-1786.704) (-1783.750) (-1785.047) -- 0:00:48
      324000 -- (-1786.396) [-1783.870] (-1785.802) (-1786.943) * (-1785.967) [-1787.996] (-1784.504) (-1784.415) -- 0:00:47
      324500 -- (-1788.599) (-1784.263) [-1783.441] (-1785.083) * (-1785.948) (-1787.888) [-1784.598] (-1785.113) -- 0:00:47
      325000 -- (-1784.855) (-1783.216) [-1784.822] (-1788.102) * (-1799.498) (-1788.977) [-1785.270] (-1786.060) -- 0:00:47

      Average standard deviation of split frequencies: 0.013416

      325500 -- (-1787.811) (-1783.578) [-1783.682] (-1784.596) * (-1784.538) [-1784.389] (-1786.072) (-1790.396) -- 0:00:47
      326000 -- (-1787.811) (-1786.316) (-1785.342) [-1783.692] * (-1784.301) [-1782.998] (-1783.471) (-1790.312) -- 0:00:47
      326500 -- (-1783.482) [-1785.785] (-1784.535) (-1787.173) * (-1784.406) (-1783.896) (-1783.800) [-1785.007] -- 0:00:47
      327000 -- (-1783.211) [-1783.727] (-1784.679) (-1786.754) * (-1787.057) (-1783.721) [-1784.348] (-1783.875) -- 0:00:47
      327500 -- [-1784.336] (-1783.744) (-1785.917) (-1788.559) * (-1784.327) [-1786.775] (-1784.217) (-1784.523) -- 0:00:47
      328000 -- (-1787.227) (-1783.343) [-1785.129] (-1784.971) * (-1785.417) (-1786.286) (-1786.107) [-1785.574] -- 0:00:47
      328500 -- [-1783.548] (-1782.719) (-1784.047) (-1784.290) * [-1782.925] (-1785.288) (-1785.574) (-1784.177) -- 0:00:47
      329000 -- [-1784.879] (-1784.764) (-1783.779) (-1784.635) * [-1783.532] (-1785.040) (-1783.342) (-1784.160) -- 0:00:46
      329500 -- (-1784.718) (-1782.908) (-1783.876) [-1784.303] * (-1782.849) (-1785.380) (-1783.636) [-1784.151] -- 0:00:46
      330000 -- (-1787.164) (-1782.555) [-1783.651] (-1785.304) * (-1784.750) [-1784.932] (-1783.269) (-1786.317) -- 0:00:46

      Average standard deviation of split frequencies: 0.013068

      330500 -- (-1784.406) [-1783.495] (-1784.436) (-1787.882) * (-1783.298) (-1784.475) (-1784.381) [-1783.014] -- 0:00:46
      331000 -- (-1783.533) [-1782.789] (-1784.205) (-1784.775) * (-1783.900) [-1783.140] (-1784.264) (-1782.851) -- 0:00:46
      331500 -- [-1783.974] (-1783.083) (-1785.912) (-1784.823) * (-1784.046) (-1783.267) (-1785.817) [-1782.865] -- 0:00:46
      332000 -- (-1785.249) [-1782.969] (-1788.213) (-1786.257) * (-1787.702) (-1786.803) (-1786.647) [-1787.752] -- 0:00:46
      332500 -- [-1784.827] (-1782.652) (-1786.436) (-1789.158) * (-1783.844) (-1787.754) (-1785.670) [-1788.936] -- 0:00:46
      333000 -- (-1784.444) (-1784.977) [-1783.203] (-1785.447) * [-1783.197] (-1784.092) (-1784.985) (-1786.109) -- 0:00:46
      333500 -- (-1786.547) [-1782.387] (-1783.077) (-1784.842) * [-1783.184] (-1782.731) (-1784.076) (-1784.138) -- 0:00:45
      334000 -- [-1785.387] (-1782.387) (-1783.353) (-1788.044) * (-1783.729) (-1783.834) (-1784.377) [-1783.241] -- 0:00:45
      334500 -- (-1786.863) (-1782.387) (-1787.279) [-1784.508] * (-1783.749) (-1784.647) [-1788.113] (-1783.101) -- 0:00:45
      335000 -- (-1784.847) [-1783.277] (-1783.652) (-1788.695) * (-1784.912) (-1785.420) (-1782.833) [-1784.729] -- 0:00:45

      Average standard deviation of split frequencies: 0.012627

      335500 -- (-1783.995) (-1783.374) [-1784.214] (-1788.017) * (-1785.815) (-1784.036) (-1783.112) [-1785.246] -- 0:00:45
      336000 -- [-1783.995] (-1784.212) (-1787.912) (-1784.886) * (-1783.091) (-1785.683) [-1785.212] (-1785.608) -- 0:00:45
      336500 -- (-1785.575) (-1783.095) (-1783.258) [-1783.742] * (-1786.477) [-1786.703] (-1785.953) (-1784.082) -- 0:00:45
      337000 -- (-1786.190) [-1783.313] (-1783.781) (-1784.313) * (-1784.690) (-1786.783) (-1783.566) [-1783.835] -- 0:00:45
      337500 -- (-1786.697) (-1782.970) (-1787.227) [-1785.052] * (-1785.003) (-1783.819) [-1783.606] (-1787.725) -- 0:00:47
      338000 -- [-1788.341] (-1782.608) (-1784.499) (-1784.469) * (-1784.303) (-1785.333) [-1783.283] (-1791.406) -- 0:00:47
      338500 -- (-1786.723) (-1783.595) (-1783.065) [-1783.546] * (-1784.297) [-1784.265] (-1784.116) (-1783.699) -- 0:00:46
      339000 -- (-1782.792) (-1783.595) (-1785.452) [-1784.190] * (-1784.013) [-1786.398] (-1783.153) (-1792.531) -- 0:00:46
      339500 -- [-1782.664] (-1785.569) (-1783.471) (-1784.014) * [-1783.848] (-1786.398) (-1785.472) (-1783.300) -- 0:00:46
      340000 -- (-1783.571) (-1785.574) [-1783.105] (-1783.848) * (-1784.802) (-1784.380) [-1785.874] (-1785.046) -- 0:00:46

      Average standard deviation of split frequencies: 0.011993

      340500 -- (-1784.039) [-1785.314] (-1782.718) (-1783.833) * [-1783.724] (-1782.931) (-1784.284) (-1784.788) -- 0:00:46
      341000 -- [-1785.619] (-1788.766) (-1784.594) (-1783.740) * [-1783.724] (-1784.562) (-1783.275) (-1782.847) -- 0:00:46
      341500 -- [-1782.908] (-1784.980) (-1784.679) (-1784.969) * [-1783.755] (-1784.966) (-1783.628) (-1783.119) -- 0:00:46
      342000 -- (-1785.432) (-1785.597) [-1786.819] (-1784.666) * (-1782.450) (-1786.941) [-1783.902] (-1783.420) -- 0:00:46
      342500 -- (-1786.709) [-1783.687] (-1785.712) (-1791.156) * [-1783.535] (-1785.620) (-1783.462) (-1784.827) -- 0:00:46
      343000 -- (-1785.246) (-1784.181) [-1783.827] (-1787.167) * [-1783.241] (-1784.871) (-1786.095) (-1783.790) -- 0:00:45
      343500 -- [-1783.879] (-1784.447) (-1782.847) (-1785.015) * (-1782.985) (-1784.941) [-1783.154] (-1783.986) -- 0:00:45
      344000 -- (-1783.024) (-1782.498) [-1782.900] (-1783.950) * (-1783.626) (-1782.729) (-1786.615) [-1783.997] -- 0:00:45
      344500 -- [-1783.049] (-1785.447) (-1784.011) (-1783.747) * [-1784.707] (-1784.062) (-1783.817) (-1786.941) -- 0:00:45
      345000 -- (-1782.738) [-1788.021] (-1783.832) (-1783.781) * (-1786.210) [-1783.505] (-1786.328) (-1788.228) -- 0:00:45

      Average standard deviation of split frequencies: 0.011354

      345500 -- (-1784.006) (-1787.340) (-1784.967) [-1783.710] * (-1786.416) [-1783.479] (-1783.672) (-1784.209) -- 0:00:45
      346000 -- [-1785.497] (-1786.504) (-1785.477) (-1783.820) * (-1786.259) (-1786.150) [-1788.088] (-1785.736) -- 0:00:45
      346500 -- (-1782.563) (-1785.725) [-1784.341] (-1782.950) * [-1785.886] (-1785.390) (-1783.660) (-1782.578) -- 0:00:45
      347000 -- (-1783.436) (-1784.429) [-1784.072] (-1783.504) * (-1784.936) [-1784.943] (-1784.141) (-1782.578) -- 0:00:45
      347500 -- (-1784.440) [-1784.187] (-1783.871) (-1785.405) * (-1783.970) [-1786.407] (-1784.064) (-1783.617) -- 0:00:45
      348000 -- (-1785.059) (-1784.787) [-1785.277] (-1784.828) * [-1783.815] (-1786.254) (-1783.784) (-1784.843) -- 0:00:44
      348500 -- (-1783.165) [-1785.591] (-1785.337) (-1787.214) * (-1782.736) (-1785.480) [-1784.710] (-1785.818) -- 0:00:44
      349000 -- (-1783.305) [-1785.873] (-1784.044) (-1786.298) * (-1784.160) [-1784.760] (-1786.730) (-1784.976) -- 0:00:44
      349500 -- (-1783.332) (-1783.175) [-1785.151] (-1784.875) * (-1787.133) (-1784.447) (-1783.990) [-1787.071] -- 0:00:44
      350000 -- (-1783.747) [-1783.570] (-1784.481) (-1782.737) * (-1790.004) [-1783.115] (-1791.037) (-1783.563) -- 0:00:44

      Average standard deviation of split frequencies: 0.012173

      350500 -- [-1783.250] (-1787.258) (-1786.928) (-1785.051) * (-1784.416) (-1786.145) (-1786.371) [-1782.816] -- 0:00:44
      351000 -- (-1786.384) (-1787.307) (-1784.578) [-1788.114] * [-1786.383] (-1784.285) (-1785.308) (-1783.924) -- 0:00:44
      351500 -- (-1783.432) [-1783.995] (-1788.002) (-1789.084) * (-1787.472) (-1785.097) [-1785.908] (-1784.179) -- 0:00:44
      352000 -- [-1783.071] (-1783.279) (-1787.600) (-1785.625) * [-1783.717] (-1785.876) (-1784.185) (-1785.546) -- 0:00:44
      352500 -- (-1784.454) [-1783.599] (-1787.211) (-1783.911) * (-1788.156) (-1785.910) [-1783.049] (-1784.994) -- 0:00:45
      353000 -- (-1784.650) [-1783.432] (-1785.833) (-1785.297) * (-1782.252) (-1782.826) (-1784.296) [-1784.487] -- 0:00:45
      353500 -- [-1785.557] (-1785.128) (-1788.265) (-1783.692) * (-1782.375) (-1782.813) (-1783.206) [-1787.403] -- 0:00:45
      354000 -- (-1785.405) (-1784.918) (-1786.089) [-1783.984] * [-1783.193] (-1786.998) (-1782.844) (-1786.909) -- 0:00:45
      354500 -- (-1784.596) (-1784.551) (-1786.132) [-1783.610] * [-1783.193] (-1786.030) (-1785.957) (-1785.414) -- 0:00:45
      355000 -- (-1787.066) (-1784.569) [-1786.308] (-1785.669) * (-1789.829) [-1782.721] (-1784.591) (-1783.588) -- 0:00:45

      Average standard deviation of split frequencies: 0.012874

      355500 -- (-1784.507) (-1785.454) [-1784.311] (-1784.839) * (-1788.554) (-1787.439) [-1783.469] (-1783.670) -- 0:00:45
      356000 -- (-1783.454) (-1785.277) [-1782.901] (-1782.560) * (-1782.611) (-1784.151) (-1787.537) [-1783.552] -- 0:00:45
      356500 -- (-1785.840) (-1785.694) (-1783.102) [-1786.186] * (-1782.747) (-1785.996) (-1784.264) [-1785.143] -- 0:00:45
      357000 -- (-1789.555) [-1786.318] (-1784.371) (-1784.060) * (-1785.771) (-1784.611) [-1789.178] (-1785.983) -- 0:00:45
      357500 -- [-1783.873] (-1784.850) (-1783.843) (-1784.642) * (-1784.778) (-1784.608) [-1784.701] (-1786.875) -- 0:00:44
      358000 -- (-1786.101) (-1787.643) (-1784.619) [-1784.725] * (-1783.766) [-1784.375] (-1785.073) (-1784.456) -- 0:00:44
      358500 -- (-1788.033) [-1785.489] (-1785.061) (-1786.189) * (-1785.645) [-1783.044] (-1784.626) (-1785.239) -- 0:00:44
      359000 -- (-1787.611) (-1784.706) [-1784.374] (-1784.809) * (-1786.167) (-1782.889) [-1785.837] (-1783.585) -- 0:00:44
      359500 -- (-1785.712) [-1784.188] (-1783.061) (-1785.154) * (-1784.914) [-1782.467] (-1785.728) (-1786.058) -- 0:00:44
      360000 -- (-1784.164) (-1784.075) [-1783.361] (-1785.429) * (-1785.015) (-1783.175) (-1789.463) [-1785.966] -- 0:00:44

      Average standard deviation of split frequencies: 0.012917

      360500 -- (-1783.665) (-1783.336) [-1787.943] (-1785.315) * (-1784.537) [-1783.832] (-1784.929) (-1788.443) -- 0:00:44
      361000 -- (-1783.250) [-1782.850] (-1784.869) (-1787.991) * (-1785.201) [-1783.266] (-1783.169) (-1787.313) -- 0:00:44
      361500 -- (-1788.624) (-1784.239) (-1785.372) [-1783.448] * (-1784.123) (-1784.485) (-1784.482) [-1784.206] -- 0:00:44
      362000 -- (-1784.047) (-1785.605) (-1789.375) [-1783.613] * (-1783.167) (-1783.418) [-1784.387] (-1785.994) -- 0:00:44
      362500 -- (-1787.709) (-1785.884) (-1784.351) [-1783.915] * (-1782.783) (-1782.358) [-1784.432] (-1787.908) -- 0:00:43
      363000 -- (-1786.517) [-1785.581] (-1783.346) (-1784.801) * (-1783.794) [-1783.863] (-1784.515) (-1785.020) -- 0:00:43
      363500 -- (-1784.936) (-1783.123) (-1789.381) [-1783.772] * (-1784.282) [-1783.642] (-1785.419) (-1784.780) -- 0:00:43
      364000 -- (-1784.673) (-1783.597) [-1787.125] (-1785.915) * (-1783.584) (-1785.828) [-1784.340] (-1783.162) -- 0:00:43
      364500 -- (-1784.446) (-1786.241) (-1785.548) [-1786.108] * (-1788.026) (-1788.476) [-1784.186] (-1782.995) -- 0:00:43
      365000 -- (-1783.676) (-1784.513) [-1784.640] (-1785.814) * (-1792.293) (-1783.631) [-1786.677] (-1782.932) -- 0:00:43

      Average standard deviation of split frequencies: 0.011365

      365500 -- (-1783.655) [-1785.482] (-1785.371) (-1784.274) * (-1783.929) (-1784.759) (-1785.073) [-1783.104] -- 0:00:43
      366000 -- (-1783.573) [-1784.987] (-1786.531) (-1784.700) * (-1791.459) (-1785.987) [-1786.262] (-1786.486) -- 0:00:43
      366500 -- (-1787.176) (-1783.065) [-1783.982] (-1784.253) * [-1787.662] (-1785.548) (-1786.531) (-1784.307) -- 0:00:43
      367000 -- (-1785.416) [-1783.691] (-1787.068) (-1786.350) * (-1784.900) (-1785.132) (-1787.304) [-1787.472] -- 0:00:43
      367500 -- [-1786.056] (-1786.508) (-1787.801) (-1783.328) * (-1786.265) [-1782.494] (-1784.949) (-1786.721) -- 0:00:44
      368000 -- (-1786.305) [-1786.167] (-1783.239) (-1785.701) * (-1783.341) (-1784.279) [-1786.258] (-1784.812) -- 0:00:44
      368500 -- [-1785.715] (-1785.879) (-1784.089) (-1785.122) * (-1788.270) [-1784.244] (-1784.320) (-1785.867) -- 0:00:44
      369000 -- (-1784.456) (-1786.817) (-1784.025) [-1788.568] * [-1784.623] (-1782.494) (-1785.002) (-1789.167) -- 0:00:44
      369500 -- (-1783.109) [-1785.569] (-1783.995) (-1783.561) * (-1784.457) (-1786.821) (-1784.902) [-1783.544] -- 0:00:44
      370000 -- [-1784.444] (-1787.061) (-1783.141) (-1784.184) * (-1783.163) (-1785.159) (-1784.518) [-1784.036] -- 0:00:44

      Average standard deviation of split frequencies: 0.012559

      370500 -- [-1784.411] (-1785.457) (-1783.261) (-1783.747) * (-1782.842) (-1786.142) (-1785.064) [-1783.442] -- 0:00:44
      371000 -- (-1784.485) [-1784.001] (-1787.267) (-1782.956) * (-1784.011) (-1784.991) [-1785.922] (-1784.198) -- 0:00:44
      371500 -- (-1784.865) (-1784.148) (-1789.225) [-1783.912] * (-1784.762) [-1786.296] (-1785.148) (-1785.502) -- 0:00:43
      372000 -- [-1784.650] (-1785.111) (-1784.492) (-1783.992) * (-1785.449) [-1784.023] (-1789.145) (-1789.299) -- 0:00:43
      372500 -- (-1788.059) (-1785.170) [-1784.479] (-1786.581) * (-1786.193) (-1783.043) [-1785.111] (-1788.003) -- 0:00:43
      373000 -- (-1789.492) (-1784.324) [-1782.980] (-1787.251) * [-1785.789] (-1782.588) (-1786.081) (-1786.412) -- 0:00:43
      373500 -- [-1785.204] (-1782.985) (-1783.109) (-1786.068) * (-1790.087) (-1785.470) [-1782.821] (-1784.024) -- 0:00:43
      374000 -- [-1784.977] (-1782.777) (-1782.847) (-1783.960) * (-1786.564) (-1790.140) (-1782.959) [-1783.197] -- 0:00:43
      374500 -- (-1784.476) (-1783.318) (-1788.542) [-1783.512] * (-1785.503) [-1783.994] (-1782.699) (-1784.215) -- 0:00:43
      375000 -- (-1785.367) (-1784.097) (-1786.220) [-1784.102] * (-1783.541) (-1782.499) (-1785.079) [-1783.633] -- 0:00:43

      Average standard deviation of split frequencies: 0.012772

      375500 -- [-1785.353] (-1785.191) (-1785.568) (-1783.225) * (-1782.900) (-1782.378) [-1784.572] (-1783.804) -- 0:00:43
      376000 -- (-1784.599) (-1784.411) (-1784.860) [-1782.730] * (-1782.982) [-1782.406] (-1783.961) (-1783.443) -- 0:00:43
      376500 -- (-1782.568) (-1784.711) (-1784.860) [-1782.736] * [-1783.344] (-1784.769) (-1783.945) (-1783.290) -- 0:00:43
      377000 -- (-1784.485) (-1783.615) (-1784.241) [-1783.450] * [-1783.070] (-1783.575) (-1787.625) (-1784.908) -- 0:00:42
      377500 -- (-1783.787) [-1783.475] (-1782.723) (-1783.084) * (-1784.110) [-1784.655] (-1784.835) (-1784.242) -- 0:00:42
      378000 -- (-1785.592) [-1784.260] (-1782.644) (-1783.125) * (-1784.163) (-1783.843) [-1783.547] (-1785.247) -- 0:00:42
      378500 -- [-1783.008] (-1787.200) (-1782.573) (-1782.394) * (-1785.254) (-1785.057) (-1784.889) [-1790.750] -- 0:00:42
      379000 -- (-1783.112) [-1784.730] (-1782.855) (-1784.928) * (-1784.991) [-1783.514] (-1784.149) (-1788.949) -- 0:00:42
      379500 -- (-1783.866) (-1784.963) [-1783.106] (-1787.178) * [-1784.555] (-1782.916) (-1785.015) (-1784.365) -- 0:00:42
      380000 -- (-1783.957) [-1783.826] (-1783.197) (-1785.823) * (-1783.950) (-1783.053) (-1782.826) [-1785.456] -- 0:00:42

      Average standard deviation of split frequencies: 0.012538

      380500 -- (-1785.281) (-1785.975) (-1783.278) [-1787.673] * (-1783.177) [-1782.722] (-1787.239) (-1785.977) -- 0:00:42
      381000 -- [-1786.490] (-1786.032) (-1784.567) (-1786.368) * (-1784.202) (-1783.049) (-1782.752) [-1785.353] -- 0:00:42
      381500 -- [-1783.233] (-1786.007) (-1785.442) (-1783.677) * (-1784.874) [-1785.082] (-1790.481) (-1785.519) -- 0:00:42
      382000 -- [-1786.045] (-1784.503) (-1785.670) (-1783.569) * (-1782.476) [-1785.386] (-1784.410) (-1784.411) -- 0:00:42
      382500 -- (-1784.308) (-1783.100) [-1783.823] (-1783.441) * (-1782.234) (-1785.296) [-1784.098] (-1784.409) -- 0:00:43
      383000 -- (-1786.929) (-1784.808) (-1784.117) [-1784.625] * [-1782.440] (-1787.575) (-1786.123) (-1784.444) -- 0:00:43
      383500 -- (-1786.611) [-1785.093] (-1786.480) (-1783.081) * [-1782.429] (-1784.542) (-1786.187) (-1787.592) -- 0:00:43
      384000 -- [-1783.113] (-1785.019) (-1784.773) (-1784.091) * (-1783.621) (-1783.324) [-1787.276] (-1789.364) -- 0:00:43
      384500 -- [-1782.947] (-1784.622) (-1785.904) (-1783.547) * (-1787.971) (-1783.342) [-1788.142] (-1793.532) -- 0:00:43
      385000 -- (-1783.107) (-1784.421) (-1785.700) [-1783.368] * (-1786.057) (-1785.899) [-1789.109] (-1785.875) -- 0:00:43

      Average standard deviation of split frequencies: 0.012289

      385500 -- (-1782.810) (-1784.739) [-1784.191] (-1784.650) * (-1784.463) (-1786.258) (-1791.913) [-1783.867] -- 0:00:43
      386000 -- [-1782.420] (-1783.525) (-1786.481) (-1785.207) * [-1784.650] (-1783.205) (-1784.741) (-1782.934) -- 0:00:42
      386500 -- (-1785.852) (-1783.792) [-1787.158] (-1785.439) * (-1785.545) (-1783.413) [-1786.514] (-1787.224) -- 0:00:42
      387000 -- (-1788.196) [-1784.205] (-1784.807) (-1787.857) * (-1791.120) [-1783.293] (-1789.951) (-1788.049) -- 0:00:42
      387500 -- (-1786.123) (-1783.841) [-1783.868] (-1787.858) * [-1782.400] (-1784.296) (-1784.645) (-1786.082) -- 0:00:42
      388000 -- (-1788.315) [-1783.069] (-1783.487) (-1783.796) * (-1782.399) (-1784.167) [-1783.769] (-1786.080) -- 0:00:42
      388500 -- (-1783.421) [-1783.381] (-1782.875) (-1782.835) * [-1785.656] (-1783.861) (-1786.646) (-1787.571) -- 0:00:42
      389000 -- (-1783.421) [-1783.475] (-1782.810) (-1786.249) * (-1787.466) [-1784.516] (-1786.057) (-1785.751) -- 0:00:42
      389500 -- (-1787.492) [-1783.525] (-1784.541) (-1782.969) * (-1787.353) [-1788.785] (-1783.699) (-1784.794) -- 0:00:42
      390000 -- (-1786.434) [-1783.680] (-1783.873) (-1786.878) * (-1791.458) (-1785.511) [-1784.936] (-1784.042) -- 0:00:42

      Average standard deviation of split frequencies: 0.013424

      390500 -- (-1784.948) (-1783.839) [-1784.111] (-1782.876) * (-1783.914) [-1785.975] (-1783.409) (-1787.053) -- 0:00:42
      391000 -- (-1785.208) (-1782.951) (-1786.329) [-1785.435] * (-1783.841) [-1783.563] (-1787.880) (-1784.600) -- 0:00:42
      391500 -- (-1796.545) [-1786.096] (-1784.227) (-1786.892) * (-1785.219) [-1784.207] (-1788.102) (-1784.841) -- 0:00:41
      392000 -- (-1785.175) (-1784.009) (-1785.874) [-1788.154] * (-1785.651) [-1786.079] (-1784.218) (-1784.929) -- 0:00:41
      392500 -- (-1784.299) (-1785.669) (-1785.012) [-1790.613] * (-1782.822) (-1785.027) [-1783.211] (-1784.928) -- 0:00:41
      393000 -- (-1783.307) (-1786.360) [-1784.537] (-1787.807) * [-1786.130] (-1787.181) (-1783.544) (-1785.366) -- 0:00:41
      393500 -- [-1783.476] (-1784.393) (-1784.071) (-1786.575) * (-1784.911) (-1784.767) [-1783.842] (-1784.321) -- 0:00:41
      394000 -- (-1784.318) [-1785.827] (-1784.677) (-1784.688) * (-1783.597) [-1782.967] (-1784.706) (-1787.935) -- 0:00:41
      394500 -- (-1785.156) (-1784.140) [-1783.640] (-1784.356) * (-1783.197) (-1783.296) (-1784.493) [-1784.664] -- 0:00:41
      395000 -- (-1783.827) [-1784.943] (-1786.273) (-1784.356) * (-1784.400) (-1783.939) (-1784.751) [-1784.584] -- 0:00:41

      Average standard deviation of split frequencies: 0.013095

      395500 -- (-1783.923) [-1786.793] (-1784.798) (-1783.329) * (-1787.048) [-1783.893] (-1786.057) (-1791.102) -- 0:00:41
      396000 -- (-1785.330) (-1786.882) (-1783.794) [-1783.452] * (-1784.940) [-1784.332] (-1784.938) (-1789.147) -- 0:00:41
      396500 -- [-1786.478] (-1785.275) (-1786.992) (-1783.611) * (-1784.411) (-1783.567) (-1785.360) [-1787.561] -- 0:00:41
      397000 -- (-1784.187) (-1785.509) [-1783.520] (-1784.496) * (-1785.409) (-1786.118) (-1785.876) [-1784.072] -- 0:00:42
      397500 -- (-1782.441) [-1783.996] (-1785.27