--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:42:59 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/gltX/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2064.49 -2073.19 2 -2064.50 -2067.87 -------------------------------------- TOTAL -2064.50 -2072.50 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.903035 0.092350 0.371333 1.493480 0.869378 1359.75 1430.37 1.000 r(A<->C){all} 0.169816 0.019996 0.000222 0.448385 0.136149 160.45 246.77 1.001 r(A<->G){all} 0.162000 0.019495 0.000003 0.450249 0.124716 176.34 194.77 1.000 r(A<->T){all} 0.163142 0.018319 0.000002 0.417828 0.128494 232.67 266.33 1.000 r(C<->G){all} 0.165378 0.020868 0.000093 0.452958 0.124463 173.02 304.20 1.026 r(C<->T){all} 0.165372 0.018883 0.000083 0.437381 0.129120 95.00 164.03 1.005 r(G<->T){all} 0.174292 0.019680 0.000072 0.448572 0.141613 324.47 334.99 1.010 pi(A){all} 0.194750 0.000098 0.176574 0.214719 0.194725 1149.74 1243.41 1.001 pi(C){all} 0.284586 0.000133 0.262961 0.308323 0.284659 1276.27 1292.74 1.002 pi(G){all} 0.303436 0.000139 0.282093 0.327961 0.303233 1245.17 1336.51 1.000 pi(T){all} 0.217228 0.000107 0.196565 0.237174 0.217116 1254.13 1331.74 1.000 alpha{1,2} 0.419140 0.225994 0.000225 1.396845 0.250992 1184.66 1214.14 1.001 alpha{3} 0.465196 0.242204 0.000267 1.454254 0.302289 1076.36 1175.12 1.000 pinvar{all} 0.998988 0.000001 0.996743 0.999999 0.999385 922.76 1038.77 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1997.645934 Model 2: PositiveSelection -1997.646327 Model 0: one-ratio -1997.646604 Model 7: beta -1997.645934 Model 8: beta&w>1 -1997.645934 Model 0 vs 1 0.001340000000254804 Model 2 vs 1 7.860000000619038E-4 Model 8 vs 7 0.0
>C1 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C2 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C3 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C4 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C5 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C6 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=502 C1 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C2 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C3 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C4 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C5 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C6 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV ************************************************** C1 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C2 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C3 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C4 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C5 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C6 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD ************************************************** C1 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C2 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C3 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C4 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C5 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C6 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA ************************************************** C1 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C2 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C3 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C4 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C5 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C6 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG ************************************************** C1 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C2 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C3 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C4 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C5 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C6 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP ************************************************** C1 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C2 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C3 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C4 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C5 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C6 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA ************************************************** C1 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C2 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C3 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C4 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C5 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C6 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG ************************************************** C1 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C2 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C3 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C4 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C5 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C6 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND ************************************************** C1 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C2 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C3 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C4 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C5 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C6 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE ************************************************** C1 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C2 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C3 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C4 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C5 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C6 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT ************************************************** C1 SA C2 SA C3 SA C4 SA C5 SA C6 SA ** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 502 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 502 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [15060] Library Relaxation: Multi_proc [96] Relaxation Summary: [15060]--->[15060] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.550 Mb, Max= 31.091 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C2 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C3 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C4 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C5 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV C6 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV ************************************************** C1 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C2 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C3 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C4 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C5 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD C6 LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD ************************************************** C1 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C2 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C3 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C4 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C5 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA C6 IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA ************************************************** C1 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C2 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C3 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C4 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C5 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG C6 QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG ************************************************** C1 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C2 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C3 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C4 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C5 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP C6 DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP ************************************************** C1 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C2 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C3 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C4 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C5 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA C6 EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA ************************************************** C1 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C2 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C3 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C4 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C5 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG C6 DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG ************************************************** C1 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C2 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C3 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C4 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C5 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND C6 RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND ************************************************** C1 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C2 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C3 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C4 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C5 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE C6 DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE ************************************************** C1 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C2 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C3 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C4 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C5 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT C6 GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT ************************************************** C1 SA C2 SA C3 SA C4 SA C5 SA C6 SA ** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT C2 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT C3 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT C4 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT C5 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT C6 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT ************************************************** C1 ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA C2 ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA C3 ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA C4 ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA C5 ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA C6 ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA ************************************************** C1 CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC C2 CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC C3 CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC C4 CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC C5 CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC C6 CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC ************************************************** C1 TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT C2 TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT C3 TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT C4 TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT C5 TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT C6 TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT ************************************************** C1 GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC C2 GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC C3 GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC C4 GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC C5 GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC C6 GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC ************************************************** C1 CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC C2 CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC C3 CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC C4 CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC C5 CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC C6 CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC ************************************************** C1 ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA C2 ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA C3 ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA C4 ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA C5 ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA C6 ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA ************************************************** C1 CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC C2 CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC C3 CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC C4 CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC C5 CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC C6 CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC ************************************************** C1 GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG C2 GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG C3 GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG C4 GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG C5 GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG C6 GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG ************************************************** C1 CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG C2 CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG C3 CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG C4 CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG C5 CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG C6 CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG ************************************************** C1 GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA C2 GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA C3 GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA C4 GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA C5 GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA C6 GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA ************************************************** C1 CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA C2 CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA C3 CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA C4 CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA C5 CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA C6 CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA ************************************************** C1 GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT C2 GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT C3 GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT C4 GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT C5 GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT C6 GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT ************************************************** C1 CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG C2 CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG C3 CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG C4 CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG C5 CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG C6 CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG ************************************************** C1 TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC C2 TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC C3 TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC C4 TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC C5 TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC C6 TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC ************************************************** C1 GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC C2 GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC C3 GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC C4 GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC C5 GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC C6 GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC ************************************************** C1 GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA C2 GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA C3 GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA C4 GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA C5 GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA C6 GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA ************************************************** C1 TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC C2 TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC C3 TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC C4 TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC C5 TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC C6 TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC ************************************************** C1 GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT C2 GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT C3 GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT C4 GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT C5 GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT C6 GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT ************************************************** C1 GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG C2 GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG C3 GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG C4 GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG C5 GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG C6 GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG ************************************************** C1 CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC C2 CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC C3 CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC C4 CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC C5 CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC C6 CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC ************************************************** C1 AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC C2 AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC C3 AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC C4 AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC C5 AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC C6 AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC ************************************************** C1 CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC C2 CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC C3 CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC C4 CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC C5 CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC C6 CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC ************************************************** C1 GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT C2 GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT C3 GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT C4 GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT C5 GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT C6 GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT ************************************************** C1 GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA C2 GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA C3 GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA C4 GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA C5 GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA C6 GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA ************************************************** C1 TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG C2 TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG C3 TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG C4 TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG C5 TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG C6 TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG ************************************************** C1 ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA C2 ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA C3 ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA C4 ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA C5 ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA C6 ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA ************************************************** C1 GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC C2 GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC C3 GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC C4 GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC C5 GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC C6 GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC ************************************************** C1 CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG C2 CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG C3 CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG C4 CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG C5 CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG C6 CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG ************************************************** C1 GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC C2 GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC C3 GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC C4 GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC C5 GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC C6 GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC ************************************************** C1 TCGGCC C2 TCGGCC C3 TCGGCC C4 TCGGCC C5 TCGGCC C6 TCGGCC ****** >C1 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC TCGGCC >C2 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC TCGGCC >C3 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC TCGGCC >C4 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC TCGGCC >C5 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC TCGGCC >C6 GTGACTGCAGTAACCTCTGATGGTACCCCGCAAGCAGCAAAAGTCAGGGT ACGATTCTGCCCATCGCCCACTGGTGTTCCGCACGTCGGGATGGTTCGCA CGGCCCTGTTCAACTGGGCTTACGCTCGACATACTGGAGGCACCTTCGTC TTACGCATCGAGGACACCGACGCCGACCGCGACAGTGAAGAAAGCTACCT GGCCCTGCTCGATGCGTTGCGCTGGCTCGGCCTGAACTGGGACGAGGGTC CCGAGGTTGGAGGACCTTACGGTCCGTACCGGCAGTCGCAGCGCACTGAC ATCTACCGCGAGGTGGTGGCAAAGTTGCTTGCTACAGGAGAGGCCTATTA CGCTTTCTCCACACCGGAGGAAGTCGAGAACCGCCATCTTGCTGCTGGAC GCAATCCCAAGCTGGGTTATGACAACTTTGACCGCGATCTTACCGATGCG CAGTTCTCAGCGTACTTGGCGGAAGGCCGTAAGCCTGTAGTTCGGCTGCG GATGCCCGACGAGGATATCAGTTGGGATGACCTGGTGCGCGGGACAACTA CCTTTGCTGTGGGCACTGTGCCCGATTACGTGTTGACCCGAGCAAGCGGA GATCCGTTGTACACTTTGGTCAACCCGTGCGATGACGCGCTGATGAAGAT CACGCATGTACTGCGGGGCGAAGACTTACTATCGTCGACTCCGCGACAGG TGGCGCTATACCAGGCGTTGATCCGAATCGGGATGGCTGAGCGTATTCCC GAATTCGGTCATTTCCCATCGGTATTGGGGGAGGGAACCAAGAAACTCTC GAAGCGAGAACCGCAGTCGAATTTGTTTGCCCACCGTGACCGGGGCTTTA TCCCCGAAGGTCTGCTGAACTACCTTGCCTTGCTGGGGTGGGCGATCGCC GATGACCACGACTTGTTCAGTCTCGATGAGATGGTAGCCGCGTTCGATGT GGTCGACGTCAACTCCAATCCGGCGCGATTCGATCAGAAGAAGGCCGATG CGGTTAACGCCGAGCACATCCGAATGCTCGACTCCGAGGATTTCGCTGGC AGGCTACGCGACTACTTCACCACACACGGCTACCACATCGCTTTGGATCC CGCTAATTACGAAGCTGGTTTCGTTGCCGCGGCGCAGTTGGTGCAGACCC GCATCGTTGTGCTTGGTGACGCTTGGGACCTGTTGAAATTCCTCAACGAT GACGAGTACTCTATCGACTCTAAGGCCGCTGCCAAAGAACTGGATGCCGA TGCCGGGCCGGTGCTTGATGTTGCCTGTGCCGTGCTGGACAGCCTGGTGG ATTGGACCACTGCGAGTATCGAGGACGTCCTCAAGGTTGCACTCATCGAA GGTCTTGGTCTTAAACCGCGCAAAGTGTTTGGCCCGATCCGGGTCGCCGC CACGGGGGCATTGGTCAGCCCGCCGCTGTTCGAATCGCTGGAGCTACTCG GCCGTGCTCGCAGTCTGCAGCGGCTGAGTGCTGCGCGAGCGCGAGTCACC TCGGCC >C1 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C2 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C3 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C4 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C5 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA >C6 VTAVTSDGTPQAAKVRVRFCPSPTGVPHVGMVRTALFNWAYARHTGGTFV LRIEDTDADRDSEESYLALLDALRWLGLNWDEGPEVGGPYGPYRQSQRTD IYREVVAKLLATGEAYYAFSTPEEVENRHLAAGRNPKLGYDNFDRDLTDA QFSAYLAEGRKPVVRLRMPDEDISWDDLVRGTTTFAVGTVPDYVLTRASG DPLYTLVNPCDDALMKITHVLRGEDLLSSTPRQVALYQALIRIGMAERIP EFGHFPSVLGEGTKKLSKREPQSNLFAHRDRGFIPEGLLNYLALLGWAIA DDHDLFSLDEMVAAFDVVDVNSNPARFDQKKADAVNAEHIRMLDSEDFAG RLRDYFTTHGYHIALDPANYEAGFVAAAQLVQTRIVVLGDAWDLLKFLND DEYSIDSKAAAKELDADAGPVLDVACAVLDSLVDWTTASIEDVLKVALIE GLGLKPRKVFGPIRVAATGALVSPPLFESLELLGRARSLQRLSAARARVT SA MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1506 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579790499 Setting output file names to "/data/2res/gltX/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 631096445 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0997827894 Seed = 2128462824 Swapseed = 1579790499 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3370.500002 -- -24.965149 Chain 2 -- -3370.500197 -- -24.965149 Chain 3 -- -3370.500002 -- -24.965149 Chain 4 -- -3370.500197 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3370.500197 -- -24.965149 Chain 2 -- -3370.500002 -- -24.965149 Chain 3 -- -3370.500197 -- -24.965149 Chain 4 -- -3370.500197 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3370.500] (-3370.500) (-3370.500) (-3370.500) * [-3370.500] (-3370.500) (-3370.500) (-3370.500) 500 -- (-2069.511) (-2081.886) (-2070.981) [-2083.773] * (-2079.651) [-2073.134] (-2076.295) (-2074.132) -- 0:00:00 1000 -- (-2074.696) (-2076.438) [-2076.103] (-2075.957) * (-2078.321) (-2082.674) [-2072.221] (-2076.307) -- 0:00:00 1500 -- (-2076.068) (-2082.095) [-2072.812] (-2073.340) * (-2072.313) (-2079.660) (-2071.687) [-2075.324] -- 0:00:00 2000 -- (-2087.117) (-2081.097) (-2074.049) [-2071.003] * (-2069.041) [-2079.241] (-2074.937) (-2080.983) -- 0:00:00 2500 -- (-2076.824) (-2075.791) [-2073.565] (-2077.328) * (-2076.468) (-2074.180) [-2070.840] (-2072.882) -- 0:00:00 3000 -- (-2076.880) (-2074.112) (-2067.958) [-2071.686] * (-2079.611) [-2075.805] (-2069.806) (-2077.710) -- 0:00:00 3500 -- [-2074.150] (-2074.472) (-2070.572) (-2073.263) * (-2080.213) [-2072.567] (-2077.504) (-2071.211) -- 0:00:00 4000 -- (-2081.188) (-2068.580) (-2079.408) [-2075.716] * (-2078.248) (-2074.769) [-2071.859] (-2073.531) -- 0:00:00 4500 -- [-2072.926] (-2076.245) (-2077.498) (-2074.473) * (-2074.269) [-2072.479] (-2073.646) (-2072.613) -- 0:03:41 5000 -- [-2071.031] (-2069.199) (-2071.396) (-2073.228) * [-2074.482] (-2078.583) (-2078.227) (-2073.082) -- 0:03:19 Average standard deviation of split frequencies: 0.086424 5500 -- (-2079.142) (-2079.210) (-2081.436) [-2071.017] * (-2074.141) (-2077.722) [-2071.613] (-2078.795) -- 0:03:00 6000 -- (-2070.636) (-2078.665) (-2074.797) [-2085.730] * (-2071.220) (-2077.236) [-2071.475] (-2072.981) -- 0:02:45 6500 -- [-2076.706] (-2072.729) (-2073.822) (-2077.826) * (-2075.920) [-2067.086] (-2074.391) (-2073.987) -- 0:02:32 7000 -- (-2078.774) (-2069.448) (-2073.894) [-2076.825] * (-2073.126) [-2077.098] (-2073.974) (-2080.373) -- 0:02:21 7500 -- (-2073.292) (-2080.421) [-2074.118] (-2076.959) * (-2075.267) (-2072.929) [-2074.990] (-2085.736) -- 0:02:12 8000 -- (-2080.129) [-2074.796] (-2082.991) (-2079.654) * (-2073.717) [-2075.891] (-2070.640) (-2077.597) -- 0:02:04 8500 -- (-2078.343) (-2084.776) [-2076.019] (-2069.021) * (-2067.718) (-2074.588) (-2069.739) [-2070.451] -- 0:01:56 9000 -- (-2074.562) (-2087.004) (-2073.887) [-2074.228] * (-2072.310) (-2076.825) (-2071.637) [-2070.337] -- 0:01:50 9500 -- (-2075.302) [-2070.253] (-2078.522) (-2073.256) * [-2068.634] (-2067.788) (-2074.123) (-2073.988) -- 0:01:44 10000 -- (-2069.061) [-2073.917] (-2078.729) (-2076.010) * (-2073.567) (-2077.522) (-2080.495) [-2073.538] -- 0:01:39 Average standard deviation of split frequencies: 0.083969 10500 -- (-2079.358) (-2074.358) (-2070.933) [-2073.116] * (-2079.046) (-2080.812) (-2078.152) [-2075.537] -- 0:01:34 11000 -- [-2076.831] (-2067.815) (-2083.435) (-2073.709) * (-2070.849) [-2069.003] (-2073.132) (-2067.652) -- 0:01:29 11500 -- (-2074.281) (-2067.547) (-2073.308) [-2073.089] * [-2071.905] (-2066.059) (-2079.172) (-2070.883) -- 0:01:25 12000 -- (-2073.705) [-2071.886] (-2073.812) (-2079.260) * (-2075.898) (-2065.336) (-2070.080) [-2071.391] -- 0:01:22 12500 -- (-2070.560) [-2076.824] (-2074.658) (-2080.230) * [-2075.779] (-2067.318) (-2081.436) (-2076.994) -- 0:01:19 13000 -- (-2071.979) (-2077.539) [-2070.835] (-2076.702) * (-2075.160) (-2066.484) (-2075.802) [-2072.718] -- 0:01:15 13500 -- [-2073.439] (-2083.706) (-2080.007) (-2077.440) * [-2079.853] (-2066.733) (-2071.941) (-2071.883) -- 0:01:13 14000 -- [-2069.374] (-2071.107) (-2071.341) (-2081.220) * (-2073.682) (-2066.023) [-2070.604] (-2066.912) -- 0:01:10 14500 -- (-2073.752) [-2072.012] (-2072.691) (-2071.518) * (-2077.823) [-2065.302] (-2073.423) (-2070.415) -- 0:01:07 15000 -- (-2076.018) (-2076.023) (-2081.790) [-2072.437] * [-2074.069] (-2065.299) (-2082.845) (-2072.221) -- 0:01:05 Average standard deviation of split frequencies: 0.046794 15500 -- (-2077.929) (-2072.763) (-2083.675) [-2072.123] * (-2075.296) (-2064.733) (-2073.216) [-2071.355] -- 0:01:03 16000 -- [-2069.998] (-2078.216) (-2083.267) (-2075.679) * (-2081.999) (-2064.859) [-2074.034] (-2079.088) -- 0:01:01 16500 -- [-2074.205] (-2070.660) (-2076.654) (-2072.750) * [-2071.368] (-2066.224) (-2070.172) (-2071.840) -- 0:00:59 17000 -- (-2075.109) (-2074.812) [-2070.255] (-2076.756) * (-2072.134) [-2069.008] (-2077.697) (-2082.126) -- 0:00:57 17500 -- (-2073.100) [-2073.581] (-2072.310) (-2076.567) * (-2079.137) (-2065.808) [-2071.619] (-2072.776) -- 0:00:56 18000 -- (-2077.951) (-2075.118) [-2070.875] (-2075.375) * (-2074.177) [-2066.818] (-2073.649) (-2078.791) -- 0:01:49 18500 -- (-2074.441) [-2076.420] (-2075.774) (-2076.507) * (-2076.601) (-2067.452) [-2072.727] (-2069.123) -- 0:01:46 19000 -- [-2071.427] (-2074.729) (-2077.414) (-2074.874) * (-2082.235) [-2069.045] (-2068.463) (-2073.812) -- 0:01:43 19500 -- (-2073.079) (-2068.856) [-2073.604] (-2077.474) * [-2068.550] (-2069.565) (-2069.093) (-2067.379) -- 0:01:40 20000 -- (-2073.395) (-2072.510) [-2068.700] (-2081.411) * [-2079.031] (-2069.584) (-2064.829) (-2076.489) -- 0:01:38 Average standard deviation of split frequencies: 0.055224 20500 -- (-2074.665) [-2075.074] (-2069.956) (-2078.068) * (-2074.859) (-2069.858) [-2064.114] (-2068.208) -- 0:01:35 21000 -- [-2070.965] (-2080.935) (-2068.345) (-2080.956) * (-2081.196) (-2068.362) [-2064.912] (-2074.460) -- 0:01:33 21500 -- (-2074.260) (-2076.004) [-2065.628] (-2073.757) * (-2064.134) (-2068.412) [-2066.089] (-2073.760) -- 0:01:31 22000 -- (-2075.264) (-2073.174) [-2065.526] (-2077.962) * (-2064.856) (-2069.573) (-2065.162) [-2068.522] -- 0:01:28 22500 -- (-2075.002) [-2074.714] (-2065.112) (-2072.825) * (-2064.460) (-2067.445) (-2063.838) [-2069.190] -- 0:01:26 23000 -- (-2070.848) (-2082.053) (-2065.261) [-2068.006] * [-2063.813] (-2063.769) (-2063.806) (-2068.233) -- 0:01:24 23500 -- (-2071.685) (-2082.439) [-2065.235] (-2075.723) * (-2064.086) (-2063.596) [-2063.675] (-2079.601) -- 0:01:23 24000 -- [-2075.078] (-2073.636) (-2065.062) (-2078.656) * (-2064.361) (-2063.562) [-2064.067] (-2073.383) -- 0:01:21 24500 -- (-2078.027) (-2072.921) [-2064.594] (-2079.214) * (-2063.184) (-2066.429) [-2064.648] (-2072.915) -- 0:01:19 25000 -- [-2073.408] (-2073.719) (-2064.042) (-2081.261) * (-2063.882) (-2064.203) (-2068.890) [-2072.665] -- 0:01:18 Average standard deviation of split frequencies: 0.055256 25500 -- [-2069.183] (-2074.524) (-2066.856) (-2079.978) * (-2065.597) (-2063.741) [-2063.729] (-2078.696) -- 0:01:16 26000 -- [-2072.413] (-2079.952) (-2064.218) (-2076.597) * (-2064.242) (-2065.613) (-2067.318) [-2076.856] -- 0:01:14 26500 -- [-2075.926] (-2075.637) (-2064.123) (-2076.809) * (-2067.789) (-2067.014) (-2067.699) [-2070.707] -- 0:01:13 27000 -- (-2079.358) (-2077.331) [-2063.947] (-2082.351) * [-2069.481] (-2066.670) (-2065.175) (-2072.648) -- 0:01:12 27500 -- (-2078.014) (-2078.110) [-2063.534] (-2071.116) * (-2066.336) [-2065.931] (-2065.457) (-2075.730) -- 0:01:10 28000 -- (-2080.192) (-2073.866) [-2063.532] (-2072.873) * (-2065.054) [-2065.048] (-2066.301) (-2068.389) -- 0:01:09 28500 -- (-2068.949) (-2076.866) (-2067.800) [-2071.688] * (-2064.255) (-2066.878) (-2066.066) [-2071.572] -- 0:01:08 29000 -- [-2074.863] (-2073.245) (-2064.370) (-2071.389) * (-2063.968) [-2067.018] (-2064.140) (-2075.575) -- 0:01:06 29500 -- (-2071.797) (-2075.743) [-2064.604] (-2072.078) * (-2065.600) (-2065.157) (-2063.912) [-2071.982] -- 0:01:05 30000 -- (-2072.545) (-2076.356) (-2068.386) [-2079.034] * (-2065.977) (-2066.269) [-2063.518] (-2081.160) -- 0:01:04 Average standard deviation of split frequencies: 0.046884 30500 -- [-2069.283] (-2075.756) (-2066.983) (-2088.968) * (-2068.055) (-2065.339) (-2063.476) [-2072.107] -- 0:01:03 31000 -- (-2084.227) [-2073.808] (-2069.995) (-2078.044) * (-2069.748) (-2065.804) [-2065.955] (-2076.761) -- 0:01:02 31500 -- [-2070.343] (-2074.155) (-2065.003) (-2084.185) * (-2067.792) [-2066.166] (-2063.637) (-2076.511) -- 0:01:01 32000 -- [-2077.610] (-2072.124) (-2063.958) (-2073.313) * [-2065.666] (-2065.030) (-2064.797) (-2070.710) -- 0:01:00 32500 -- (-2072.774) (-2080.099) (-2064.334) [-2071.126] * (-2065.657) [-2065.389] (-2066.445) (-2070.487) -- 0:01:29 33000 -- (-2071.372) (-2072.679) (-2074.871) [-2070.389] * (-2064.892) [-2065.186] (-2066.443) (-2082.993) -- 0:01:27 33500 -- (-2073.153) (-2074.247) (-2067.337) [-2071.926] * (-2067.718) (-2063.486) (-2067.166) [-2073.893] -- 0:01:26 34000 -- (-2074.046) [-2069.097] (-2066.118) (-2071.496) * (-2064.137) (-2066.294) (-2065.658) [-2074.066] -- 0:01:25 34500 -- (-2073.370) (-2077.849) [-2063.384] (-2080.099) * (-2064.137) [-2064.004] (-2064.904) (-2073.753) -- 0:01:23 35000 -- [-2071.566] (-2071.685) (-2063.448) (-2069.536) * [-2063.433] (-2064.939) (-2067.623) (-2077.834) -- 0:01:22 Average standard deviation of split frequencies: 0.045176 35500 -- [-2073.846] (-2076.573) (-2063.448) (-2068.790) * (-2063.417) (-2064.978) [-2066.583] (-2076.508) -- 0:01:21 36000 -- (-2072.017) (-2070.403) (-2063.448) [-2077.635] * [-2066.408] (-2064.618) (-2066.195) (-2077.140) -- 0:01:20 36500 -- [-2072.238] (-2078.186) (-2063.448) (-2074.766) * (-2064.971) (-2064.148) (-2075.398) [-2076.521] -- 0:01:19 37000 -- (-2073.008) (-2067.855) (-2064.955) [-2071.854] * [-2065.262] (-2063.810) (-2071.654) (-2081.483) -- 0:01:18 37500 -- (-2082.016) [-2067.080] (-2063.387) (-2075.596) * (-2064.307) (-2063.704) [-2071.100] (-2084.539) -- 0:01:17 38000 -- (-2080.955) (-2069.002) (-2066.317) [-2080.660] * [-2066.083] (-2063.499) (-2068.192) (-2075.052) -- 0:01:15 38500 -- (-2080.424) (-2065.588) (-2064.771) [-2076.527] * [-2066.586] (-2063.576) (-2066.729) (-2069.118) -- 0:01:14 39000 -- (-2076.548) (-2068.992) (-2064.779) [-2069.098] * (-2064.934) (-2063.494) (-2067.288) [-2067.216] -- 0:01:13 39500 -- (-2070.431) (-2069.089) [-2065.079] (-2080.589) * [-2065.238] (-2063.199) (-2069.808) (-2065.020) -- 0:01:12 40000 -- (-2070.951) [-2072.364] (-2065.040) (-2079.989) * (-2065.489) [-2065.276] (-2063.866) (-2068.325) -- 0:01:12 Average standard deviation of split frequencies: 0.050876 40500 -- (-2076.996) [-2071.589] (-2062.975) (-2076.176) * (-2067.340) (-2065.006) (-2064.267) [-2063.537] -- 0:01:11 41000 -- (-2088.316) (-2066.337) [-2063.351] (-2072.906) * (-2065.163) (-2065.641) [-2063.956] (-2069.067) -- 0:01:10 41500 -- (-2065.937) [-2064.653] (-2063.373) (-2069.778) * (-2064.264) (-2065.426) [-2065.626] (-2066.649) -- 0:01:09 42000 -- [-2068.661] (-2063.805) (-2066.066) (-2071.481) * [-2066.524] (-2065.394) (-2070.488) (-2065.863) -- 0:01:08 42500 -- (-2063.740) (-2069.337) (-2065.515) [-2074.305] * [-2065.693] (-2064.830) (-2067.457) (-2066.091) -- 0:01:07 43000 -- (-2064.350) (-2067.065) (-2065.653) [-2071.681] * (-2065.261) [-2064.974] (-2066.949) (-2064.443) -- 0:01:06 43500 -- (-2065.348) (-2066.921) (-2063.889) [-2078.884] * (-2065.426) [-2065.690] (-2066.439) (-2065.005) -- 0:01:05 44000 -- (-2064.059) (-2068.495) (-2064.145) [-2072.684] * (-2065.241) [-2064.691] (-2064.487) (-2065.106) -- 0:01:05 44500 -- (-2068.725) (-2067.348) [-2064.787] (-2075.508) * (-2065.168) (-2064.864) (-2065.655) [-2065.231] -- 0:01:04 45000 -- [-2064.600] (-2067.030) (-2063.591) (-2084.647) * (-2066.240) [-2066.825] (-2064.088) (-2065.220) -- 0:01:03 Average standard deviation of split frequencies: 0.043041 45500 -- (-2069.345) [-2066.780] (-2064.021) (-2082.409) * (-2066.270) (-2065.096) [-2064.123] (-2065.171) -- 0:01:02 46000 -- (-2064.670) (-2066.979) [-2066.255] (-2084.515) * (-2065.800) (-2065.359) (-2066.610) [-2066.204] -- 0:01:02 46500 -- [-2064.945] (-2068.532) (-2065.180) (-2091.105) * (-2067.400) (-2068.222) [-2066.580] (-2066.190) -- 0:01:01 47000 -- (-2065.362) (-2067.842) [-2063.410] (-2082.022) * [-2065.347] (-2065.917) (-2063.431) (-2068.553) -- 0:01:21 47500 -- (-2066.973) (-2070.202) [-2065.043] (-2066.736) * (-2068.292) [-2064.768] (-2067.077) (-2067.505) -- 0:01:20 48000 -- (-2065.408) [-2067.911] (-2065.212) (-2067.887) * (-2066.034) (-2065.450) (-2064.422) [-2064.367] -- 0:01:19 48500 -- (-2067.414) (-2066.288) (-2065.823) [-2067.880] * (-2066.750) (-2069.012) (-2064.237) [-2064.096] -- 0:01:18 49000 -- (-2064.621) (-2064.636) [-2065.228] (-2065.983) * [-2065.695] (-2065.622) (-2063.452) (-2065.455) -- 0:01:17 49500 -- (-2064.620) [-2064.595] (-2065.339) (-2065.172) * (-2067.144) [-2064.315] (-2064.764) (-2065.411) -- 0:01:16 50000 -- (-2066.505) (-2065.042) [-2065.427] (-2063.290) * [-2067.655] (-2063.963) (-2064.764) (-2066.501) -- 0:01:16 Average standard deviation of split frequencies: 0.039953 50500 -- (-2065.657) [-2065.436] (-2065.205) (-2063.560) * (-2065.861) [-2063.689] (-2062.905) (-2067.558) -- 0:01:15 51000 -- (-2066.352) (-2067.118) (-2066.582) [-2065.791] * [-2064.998] (-2068.283) (-2063.106) (-2068.367) -- 0:01:14 51500 -- (-2065.614) (-2065.529) [-2068.058] (-2065.429) * (-2065.898) (-2067.198) (-2063.102) [-2064.454] -- 0:01:13 52000 -- (-2066.822) [-2065.692] (-2063.780) (-2066.107) * (-2065.583) (-2065.601) [-2063.582] (-2063.303) -- 0:01:12 52500 -- (-2065.714) [-2064.809] (-2063.673) (-2066.735) * (-2065.843) [-2064.321] (-2064.070) (-2066.122) -- 0:01:12 53000 -- (-2070.520) [-2065.580] (-2063.733) (-2065.156) * (-2066.643) (-2066.366) (-2063.161) [-2063.951] -- 0:01:11 53500 -- [-2064.578] (-2063.500) (-2066.403) (-2067.238) * (-2065.065) (-2067.043) (-2064.575) [-2063.029] -- 0:01:10 54000 -- [-2063.305] (-2063.366) (-2065.052) (-2066.329) * (-2065.566) (-2067.398) [-2063.182] (-2065.572) -- 0:01:10 54500 -- [-2063.288] (-2064.622) (-2064.629) (-2067.977) * (-2063.923) [-2065.637] (-2063.339) (-2065.250) -- 0:01:09 55000 -- (-2063.849) [-2064.128] (-2064.629) (-2066.436) * (-2064.734) (-2069.256) [-2063.409] (-2063.526) -- 0:01:08 Average standard deviation of split frequencies: 0.036945 55500 -- [-2063.242] (-2066.232) (-2066.187) (-2064.665) * (-2067.199) (-2068.892) [-2063.304] (-2063.780) -- 0:01:08 56000 -- [-2063.545] (-2064.895) (-2064.574) (-2067.008) * [-2064.445] (-2064.202) (-2063.301) (-2065.176) -- 0:01:07 56500 -- (-2063.929) [-2063.767] (-2064.597) (-2065.418) * (-2064.122) (-2063.888) [-2064.933] (-2065.641) -- 0:01:06 57000 -- (-2063.898) (-2064.956) (-2065.353) [-2063.395] * (-2063.765) (-2064.249) (-2063.549) [-2065.745] -- 0:01:06 57500 -- [-2065.774] (-2064.926) (-2064.226) (-2063.468) * [-2063.968] (-2064.522) (-2064.218) (-2064.507) -- 0:01:05 58000 -- (-2065.661) (-2064.359) [-2063.775] (-2063.599) * (-2063.402) (-2065.326) [-2065.343] (-2064.943) -- 0:01:04 58500 -- (-2065.545) (-2064.720) (-2066.203) [-2063.729] * (-2063.398) (-2067.016) [-2067.220] (-2067.175) -- 0:01:04 59000 -- (-2066.360) (-2066.561) [-2064.241] (-2063.995) * [-2064.164] (-2067.847) (-2066.751) (-2065.762) -- 0:01:03 59500 -- (-2065.914) (-2064.029) [-2063.147] (-2069.968) * (-2064.773) (-2065.291) (-2066.150) [-2066.500] -- 0:01:03 60000 -- (-2066.203) (-2064.821) [-2063.064] (-2069.958) * (-2065.109) (-2064.928) [-2067.483] (-2065.546) -- 0:01:02 Average standard deviation of split frequencies: 0.037024 60500 -- (-2066.551) [-2064.434] (-2063.188) (-2065.979) * [-2064.784] (-2065.089) (-2065.970) (-2064.189) -- 0:01:02 61000 -- (-2067.670) (-2066.621) (-2063.617) [-2064.822] * (-2063.414) [-2063.290] (-2065.036) (-2067.551) -- 0:01:01 61500 -- (-2065.637) [-2063.267] (-2063.447) (-2065.726) * (-2063.315) (-2063.353) [-2068.457] (-2065.937) -- 0:01:01 62000 -- (-2064.338) (-2064.254) [-2063.832] (-2065.812) * (-2063.286) (-2063.292) (-2067.339) [-2066.713] -- 0:01:15 62500 -- [-2064.487] (-2064.672) (-2063.143) (-2069.861) * [-2068.296] (-2063.236) (-2066.693) (-2064.617) -- 0:01:15 63000 -- (-2064.601) (-2066.446) (-2064.172) [-2067.179] * [-2063.735] (-2066.840) (-2065.212) (-2063.394) -- 0:01:14 63500 -- [-2067.236] (-2064.024) (-2071.075) (-2067.651) * (-2063.806) [-2065.565] (-2066.417) (-2063.393) -- 0:01:13 64000 -- (-2064.395) [-2068.466] (-2067.661) (-2067.309) * (-2066.651) (-2065.489) [-2064.120] (-2066.119) -- 0:01:13 64500 -- (-2064.246) (-2065.202) (-2066.346) [-2068.227] * (-2065.604) (-2063.592) (-2065.096) [-2064.346] -- 0:01:12 65000 -- [-2064.974] (-2064.971) (-2068.705) (-2068.982) * (-2062.985) (-2064.548) (-2066.511) [-2064.589] -- 0:01:11 Average standard deviation of split frequencies: 0.033192 65500 -- (-2069.640) (-2075.667) [-2064.957] (-2064.924) * (-2063.472) [-2065.055] (-2065.130) (-2065.016) -- 0:01:11 66000 -- [-2063.954] (-2071.268) (-2068.805) (-2064.092) * [-2064.323] (-2064.780) (-2064.440) (-2066.598) -- 0:01:10 66500 -- [-2065.482] (-2066.589) (-2065.581) (-2065.195) * (-2064.324) [-2064.993] (-2064.235) (-2066.516) -- 0:01:10 67000 -- [-2064.026] (-2066.951) (-2065.315) (-2064.823) * [-2063.429] (-2066.302) (-2064.473) (-2066.267) -- 0:01:09 67500 -- [-2064.050] (-2067.516) (-2064.692) (-2064.049) * [-2063.091] (-2067.512) (-2062.996) (-2065.139) -- 0:01:09 68000 -- (-2064.872) [-2063.085] (-2064.237) (-2065.355) * (-2063.053) [-2067.516] (-2066.866) (-2065.436) -- 0:01:08 68500 -- (-2064.949) (-2063.095) (-2064.065) [-2065.839] * (-2063.161) [-2067.264] (-2066.806) (-2064.223) -- 0:01:07 69000 -- (-2065.448) (-2065.725) [-2065.385] (-2065.180) * (-2063.418) (-2067.387) (-2066.514) [-2063.188] -- 0:01:07 69500 -- (-2067.509) (-2066.592) [-2064.575] (-2067.308) * (-2063.874) (-2069.284) (-2066.643) [-2063.775] -- 0:01:06 70000 -- [-2064.349] (-2066.170) (-2064.573) (-2064.038) * (-2063.919) [-2067.442] (-2065.587) (-2063.723) -- 0:01:06 Average standard deviation of split frequencies: 0.033354 70500 -- (-2064.440) (-2065.689) (-2068.589) [-2065.894] * (-2063.856) (-2063.224) (-2063.339) [-2063.818] -- 0:01:05 71000 -- (-2064.440) [-2067.572] (-2066.727) (-2065.893) * (-2067.098) [-2063.434] (-2063.208) (-2067.913) -- 0:01:05 71500 -- (-2064.419) (-2066.979) [-2066.799] (-2066.586) * (-2066.370) (-2063.434) [-2064.439] (-2067.709) -- 0:01:04 72000 -- (-2063.783) [-2064.265] (-2065.604) (-2066.447) * (-2064.114) (-2063.771) [-2064.439] (-2067.437) -- 0:01:04 72500 -- [-2064.075] (-2066.107) (-2065.613) (-2064.762) * (-2063.525) (-2063.788) (-2064.411) [-2066.576] -- 0:01:03 73000 -- [-2064.926] (-2065.311) (-2065.070) (-2065.621) * [-2066.661] (-2063.804) (-2066.476) (-2064.661) -- 0:01:03 73500 -- (-2065.424) (-2066.703) (-2065.939) [-2065.926] * (-2065.145) [-2063.811] (-2066.064) (-2066.945) -- 0:01:03 74000 -- [-2066.275] (-2066.222) (-2065.676) (-2064.094) * (-2064.441) [-2063.946] (-2066.911) (-2063.731) -- 0:01:02 74500 -- (-2063.910) (-2065.339) [-2065.825] (-2063.834) * [-2064.039] (-2066.208) (-2068.856) (-2063.807) -- 0:01:02 75000 -- (-2066.056) [-2067.566] (-2065.769) (-2064.509) * (-2066.568) (-2064.546) [-2066.081] (-2068.398) -- 0:01:01 Average standard deviation of split frequencies: 0.030324 75500 -- [-2066.017] (-2067.491) (-2065.137) (-2067.429) * [-2065.537] (-2066.749) (-2065.187) (-2064.198) -- 0:01:01 76000 -- (-2064.632) (-2065.351) (-2067.532) [-2064.384] * (-2063.822) (-2066.075) (-2067.752) [-2066.105] -- 0:01:00 76500 -- [-2064.639] (-2065.885) (-2066.081) (-2064.508) * (-2064.134) (-2063.544) (-2067.346) [-2064.446] -- 0:01:00 77000 -- (-2066.024) (-2065.764) (-2064.297) [-2065.561] * (-2065.831) [-2064.304] (-2066.454) (-2064.327) -- 0:00:59 77500 -- [-2066.068] (-2065.868) (-2067.417) (-2064.936) * [-2067.527] (-2064.306) (-2065.854) (-2064.231) -- 0:01:11 78000 -- (-2064.744) (-2063.730) (-2069.379) [-2065.267] * [-2065.720] (-2063.647) (-2068.376) (-2065.551) -- 0:01:10 78500 -- (-2068.132) (-2063.880) (-2066.652) [-2065.895] * [-2064.501] (-2063.296) (-2066.671) (-2065.474) -- 0:01:10 79000 -- (-2067.425) [-2064.054] (-2067.358) (-2064.514) * (-2063.617) [-2063.204] (-2066.567) (-2063.467) -- 0:01:09 79500 -- [-2067.493] (-2065.772) (-2064.026) (-2065.338) * [-2063.617] (-2065.973) (-2065.468) (-2071.576) -- 0:01:09 80000 -- (-2069.169) [-2065.183] (-2067.083) (-2068.158) * (-2064.690) (-2066.859) [-2064.895] (-2063.963) -- 0:01:09 Average standard deviation of split frequencies: 0.025094 80500 -- (-2068.171) (-2064.593) [-2065.151] (-2067.420) * (-2064.365) (-2068.246) (-2065.366) [-2064.267] -- 0:01:08 81000 -- (-2070.627) [-2067.687] (-2068.506) (-2065.193) * (-2064.598) (-2063.580) (-2069.090) [-2064.628] -- 0:01:08 81500 -- (-2067.177) (-2063.112) (-2068.505) [-2066.553] * (-2064.152) (-2067.820) [-2069.540] (-2064.375) -- 0:01:07 82000 -- (-2065.453) [-2066.085] (-2065.174) (-2065.834) * (-2070.568) (-2063.364) (-2067.407) [-2063.925] -- 0:01:07 82500 -- (-2065.900) (-2066.381) [-2064.333] (-2066.205) * (-2065.095) (-2063.364) [-2065.668] (-2066.148) -- 0:01:06 83000 -- (-2068.232) (-2066.652) [-2063.420] (-2066.079) * (-2064.039) [-2063.381] (-2064.452) (-2065.278) -- 0:01:06 83500 -- (-2066.356) (-2068.943) (-2063.609) [-2064.940] * (-2065.905) (-2063.329) (-2063.532) [-2064.950] -- 0:01:05 84000 -- (-2065.982) (-2064.932) [-2065.566] (-2066.281) * (-2063.239) [-2064.341] (-2066.213) (-2063.916) -- 0:01:05 84500 -- (-2065.252) (-2063.927) [-2064.230] (-2069.598) * (-2063.239) (-2064.391) (-2066.746) [-2063.397] -- 0:01:05 85000 -- (-2066.030) (-2065.077) [-2063.574] (-2065.195) * (-2063.239) [-2064.112] (-2063.192) (-2063.402) -- 0:01:04 Average standard deviation of split frequencies: 0.017662 85500 -- (-2066.999) (-2065.327) [-2065.958] (-2065.714) * (-2063.320) (-2064.775) [-2063.800] (-2063.533) -- 0:01:04 86000 -- [-2065.563] (-2063.336) (-2067.470) (-2068.901) * (-2063.273) (-2064.141) [-2064.489] (-2067.173) -- 0:01:03 86500 -- (-2063.868) (-2063.288) (-2067.355) [-2063.806] * (-2063.065) [-2064.976] (-2064.553) (-2066.113) -- 0:01:03 87000 -- (-2065.646) (-2063.554) [-2063.795] (-2068.068) * (-2070.485) (-2065.160) (-2064.589) [-2065.367] -- 0:01:02 87500 -- (-2066.665) [-2063.701] (-2063.791) (-2064.953) * (-2063.841) (-2063.750) (-2064.464) [-2064.495] -- 0:01:02 88000 -- (-2067.588) (-2063.882) [-2063.825] (-2067.161) * [-2063.838] (-2066.516) (-2064.102) (-2064.280) -- 0:01:02 88500 -- (-2066.997) (-2066.252) [-2065.092] (-2065.974) * (-2063.759) (-2065.397) (-2063.691) [-2064.616] -- 0:01:01 89000 -- (-2066.925) (-2063.514) [-2063.820] (-2064.965) * [-2064.482] (-2067.743) (-2063.304) (-2068.773) -- 0:01:01 89500 -- [-2070.164] (-2064.377) (-2064.969) (-2070.896) * [-2063.921] (-2066.551) (-2063.340) (-2064.000) -- 0:01:01 90000 -- (-2066.725) [-2065.461] (-2069.709) (-2065.081) * [-2063.968] (-2067.936) (-2065.564) (-2064.398) -- 0:01:00 Average standard deviation of split frequencies: 0.017787 90500 -- [-2067.678] (-2064.710) (-2065.694) (-2065.309) * (-2065.312) [-2064.492] (-2064.417) (-2065.822) -- 0:01:00 91000 -- (-2064.225) (-2064.302) (-2066.427) [-2065.172] * (-2065.846) [-2064.466] (-2064.597) (-2065.878) -- 0:00:59 91500 -- [-2065.377] (-2064.126) (-2066.639) (-2064.459) * (-2066.251) (-2065.645) [-2065.491] (-2066.355) -- 0:00:59 92000 -- (-2065.378) (-2063.411) (-2064.163) [-2064.096] * (-2066.398) [-2068.525] (-2066.574) (-2065.661) -- 0:00:59 92500 -- (-2066.652) [-2066.356] (-2064.122) (-2064.336) * [-2067.133] (-2065.157) (-2063.934) (-2065.699) -- 0:00:58 93000 -- (-2065.696) [-2064.301] (-2063.730) (-2064.827) * (-2066.113) [-2065.067] (-2063.701) (-2071.351) -- 0:01:08 93500 -- (-2065.676) (-2064.747) (-2063.967) [-2066.724] * (-2065.306) (-2064.613) (-2064.895) [-2069.630] -- 0:01:07 94000 -- [-2065.717] (-2064.119) (-2065.607) (-2067.830) * (-2066.012) (-2064.747) [-2065.260] (-2068.321) -- 0:01:07 94500 -- [-2066.079] (-2065.046) (-2066.893) (-2067.006) * (-2065.690) [-2064.898] (-2064.698) (-2068.939) -- 0:01:07 95000 -- (-2065.761) (-2065.810) (-2063.391) [-2064.548] * [-2064.885] (-2065.408) (-2063.526) (-2068.648) -- 0:01:06 Average standard deviation of split frequencies: 0.018350 95500 -- (-2065.123) (-2064.799) [-2067.306] (-2065.217) * [-2066.250] (-2064.829) (-2063.393) (-2066.849) -- 0:01:06 96000 -- (-2065.325) (-2066.335) (-2066.076) [-2064.152] * [-2067.083] (-2064.684) (-2064.619) (-2066.954) -- 0:01:05 96500 -- (-2069.038) (-2065.639) (-2065.732) [-2064.741] * (-2066.681) (-2064.451) (-2066.456) [-2069.153] -- 0:01:05 97000 -- [-2064.799] (-2064.684) (-2066.503) (-2065.201) * (-2064.774) [-2063.535] (-2065.162) (-2063.375) -- 0:01:05 97500 -- [-2065.291] (-2064.684) (-2065.751) (-2066.200) * (-2063.500) (-2063.871) [-2065.034] (-2063.413) -- 0:01:04 98000 -- (-2063.487) (-2064.331) (-2064.376) [-2065.920] * (-2063.343) (-2064.624) [-2066.845] (-2066.349) -- 0:01:04 98500 -- (-2063.826) [-2064.937] (-2066.348) (-2066.060) * [-2065.435] (-2065.270) (-2064.230) (-2063.597) -- 0:01:04 99000 -- (-2063.787) [-2063.849] (-2066.083) (-2066.103) * (-2064.556) (-2065.769) [-2064.725] (-2063.310) -- 0:01:03 99500 -- (-2072.010) (-2065.412) [-2064.664] (-2067.877) * (-2063.950) [-2065.872] (-2066.291) (-2064.892) -- 0:01:03 100000 -- [-2067.908] (-2064.488) (-2064.664) (-2065.373) * (-2063.424) (-2065.618) (-2066.657) [-2063.367] -- 0:01:02 Average standard deviation of split frequencies: 0.017745 100500 -- [-2065.860] (-2067.206) (-2063.431) (-2065.373) * (-2063.375) (-2067.317) [-2068.234] (-2064.078) -- 0:01:02 101000 -- (-2067.656) (-2064.179) (-2065.186) [-2065.220] * (-2063.627) (-2065.001) [-2064.505] (-2063.956) -- 0:01:02 101500 -- [-2064.396] (-2067.311) (-2066.058) (-2065.987) * [-2063.808] (-2065.032) (-2065.341) (-2063.956) -- 0:01:01 102000 -- (-2065.244) (-2068.021) (-2067.756) [-2067.643] * [-2064.448] (-2065.032) (-2066.313) (-2063.745) -- 0:01:01 102500 -- (-2066.149) [-2071.377] (-2063.803) (-2064.505) * (-2064.364) (-2066.464) [-2063.376] (-2063.778) -- 0:01:01 103000 -- (-2064.109) (-2072.582) [-2064.747] (-2064.432) * [-2064.349] (-2068.172) (-2063.344) (-2063.328) -- 0:01:00 103500 -- (-2064.824) (-2065.308) [-2064.700] (-2066.397) * (-2062.986) (-2065.481) [-2063.390] (-2063.154) -- 0:01:00 104000 -- [-2065.169] (-2066.949) (-2064.347) (-2070.587) * [-2062.986] (-2065.825) (-2064.133) (-2064.975) -- 0:01:00 104500 -- (-2064.206) (-2067.694) [-2064.558] (-2070.344) * (-2063.224) (-2066.338) [-2066.984] (-2066.040) -- 0:00:59 105000 -- [-2063.951] (-2065.694) (-2065.685) (-2068.113) * [-2066.846] (-2069.053) (-2063.863) (-2064.431) -- 0:00:59 Average standard deviation of split frequencies: 0.019895 105500 -- [-2065.181] (-2064.689) (-2064.671) (-2067.972) * (-2066.796) (-2064.541) (-2063.864) [-2063.172] -- 0:00:59 106000 -- [-2064.057] (-2071.537) (-2067.962) (-2065.091) * [-2063.959] (-2065.805) (-2065.803) (-2064.334) -- 0:00:59 106500 -- [-2064.726] (-2065.769) (-2066.215) (-2065.821) * (-2066.055) (-2064.842) [-2067.602] (-2064.401) -- 0:00:58 107000 -- (-2064.432) (-2063.389) [-2064.672] (-2063.563) * (-2066.036) (-2065.326) (-2063.523) [-2064.551] -- 0:00:58 107500 -- (-2063.786) [-2063.282] (-2064.167) (-2063.497) * (-2065.932) (-2066.021) [-2063.835] (-2067.625) -- 0:00:58 108000 -- (-2067.414) (-2066.665) (-2065.969) [-2063.216] * (-2068.232) [-2065.887] (-2063.609) (-2065.000) -- 0:00:57 108500 -- (-2070.470) (-2064.726) [-2065.701] (-2063.197) * [-2065.237] (-2064.520) (-2065.385) (-2066.395) -- 0:01:05 109000 -- (-2067.005) [-2064.726] (-2066.440) (-2063.026) * [-2064.176] (-2066.513) (-2065.110) (-2064.650) -- 0:01:05 109500 -- [-2064.666] (-2063.723) (-2066.247) (-2063.029) * (-2064.098) (-2064.367) (-2067.631) [-2065.017] -- 0:01:05 110000 -- (-2067.461) [-2063.665] (-2064.433) (-2063.127) * (-2067.357) [-2067.752] (-2067.193) (-2067.398) -- 0:01:04 Average standard deviation of split frequencies: 0.020588 110500 -- (-2067.831) (-2064.332) (-2065.630) [-2064.094] * (-2065.743) [-2064.264] (-2067.715) (-2064.684) -- 0:01:04 111000 -- (-2068.054) [-2066.784] (-2065.937) (-2066.273) * [-2064.766] (-2065.063) (-2064.742) (-2065.936) -- 0:01:04 111500 -- (-2066.705) [-2066.163] (-2066.424) (-2066.637) * (-2065.983) [-2063.850] (-2064.739) (-2069.570) -- 0:01:03 112000 -- (-2065.292) [-2066.171] (-2066.473) (-2065.265) * (-2065.381) (-2064.338) [-2064.742] (-2066.081) -- 0:01:03 112500 -- (-2066.005) (-2065.682) [-2068.541] (-2065.469) * (-2064.885) (-2063.416) (-2066.359) [-2066.010] -- 0:01:03 113000 -- (-2067.144) (-2066.611) [-2067.020] (-2064.952) * (-2064.566) [-2063.793] (-2065.856) (-2065.645) -- 0:01:02 113500 -- (-2068.898) (-2067.965) [-2067.321] (-2065.207) * [-2065.286] (-2064.229) (-2066.448) (-2066.205) -- 0:01:02 114000 -- [-2065.838] (-2068.050) (-2064.884) (-2064.684) * (-2070.565) (-2068.673) (-2064.956) [-2067.532] -- 0:01:02 114500 -- (-2067.601) (-2069.497) [-2064.952] (-2065.425) * (-2065.273) [-2065.100] (-2064.510) (-2069.960) -- 0:01:01 115000 -- [-2068.305] (-2066.387) (-2064.674) (-2065.191) * [-2064.107] (-2064.705) (-2065.490) (-2065.550) -- 0:01:01 Average standard deviation of split frequencies: 0.017610 115500 -- (-2066.306) [-2065.114] (-2066.118) (-2065.741) * (-2064.210) [-2064.601] (-2065.992) (-2066.218) -- 0:01:01 116000 -- (-2066.866) [-2064.761] (-2064.702) (-2064.987) * [-2064.177] (-2066.153) (-2065.257) (-2067.329) -- 0:01:00 116500 -- (-2066.769) (-2064.186) (-2065.616) [-2065.315] * (-2069.048) [-2064.856] (-2065.536) (-2066.536) -- 0:01:00 117000 -- (-2066.351) (-2069.111) [-2065.254] (-2066.186) * [-2064.987] (-2065.385) (-2064.937) (-2065.772) -- 0:01:00 117500 -- [-2064.217] (-2065.039) (-2069.288) (-2068.261) * [-2064.071] (-2064.041) (-2064.567) (-2065.668) -- 0:01:00 118000 -- (-2064.672) (-2063.582) (-2067.933) [-2066.653] * (-2064.532) (-2064.084) [-2067.022] (-2063.307) -- 0:00:59 118500 -- [-2067.242] (-2063.916) (-2066.041) (-2068.971) * (-2065.575) (-2065.300) (-2066.901) [-2064.725] -- 0:00:59 119000 -- (-2065.437) [-2063.312] (-2074.998) (-2069.544) * [-2065.520] (-2076.516) (-2063.769) (-2065.918) -- 0:00:59 119500 -- (-2065.171) [-2064.299] (-2070.391) (-2071.588) * [-2064.342] (-2071.278) (-2064.213) (-2066.616) -- 0:00:58 120000 -- (-2064.505) [-2064.425] (-2069.504) (-2067.187) * (-2064.829) (-2068.055) [-2064.195] (-2067.901) -- 0:00:58 Average standard deviation of split frequencies: 0.018916 120500 -- [-2065.541] (-2065.545) (-2068.310) (-2065.159) * [-2067.000] (-2069.353) (-2064.374) (-2068.229) -- 0:00:58 121000 -- (-2064.387) (-2066.969) (-2065.712) [-2069.645] * (-2063.074) (-2067.007) [-2063.983] (-2065.889) -- 0:00:58 121500 -- [-2066.492] (-2067.491) (-2065.576) (-2069.183) * (-2063.983) [-2066.497] (-2064.448) (-2065.487) -- 0:00:57 122000 -- (-2066.626) (-2064.520) (-2065.266) [-2065.668] * (-2064.520) (-2064.020) [-2064.846] (-2064.780) -- 0:00:57 122500 -- (-2066.053) (-2064.346) (-2064.508) [-2063.954] * (-2068.513) (-2067.532) (-2074.178) [-2064.207] -- 0:00:57 123000 -- (-2065.811) (-2064.282) (-2067.933) [-2066.575] * (-2066.190) (-2065.716) [-2068.835] (-2063.980) -- 0:00:57 123500 -- (-2065.141) [-2064.278] (-2066.261) (-2069.617) * (-2067.008) (-2065.254) (-2065.433) [-2065.713] -- 0:01:03 124000 -- (-2068.523) (-2066.593) (-2067.945) [-2063.737] * (-2065.458) (-2064.595) [-2063.859] (-2065.226) -- 0:01:03 124500 -- [-2065.613] (-2072.360) (-2066.689) (-2063.854) * (-2064.633) (-2065.152) (-2063.944) [-2063.047] -- 0:01:03 125000 -- (-2070.643) (-2067.254) (-2067.735) [-2064.061] * [-2064.275] (-2066.422) (-2065.522) (-2064.444) -- 0:01:03 Average standard deviation of split frequencies: 0.019268 125500 -- [-2067.586] (-2064.844) (-2066.029) (-2064.182) * (-2064.067) (-2063.912) (-2071.635) [-2064.000] -- 0:01:02 126000 -- (-2066.411) [-2065.275] (-2066.319) (-2066.468) * (-2064.937) [-2064.669] (-2067.756) (-2063.035) -- 0:01:02 126500 -- [-2066.659] (-2064.223) (-2065.740) (-2063.567) * (-2066.190) (-2064.211) (-2067.933) [-2063.787] -- 0:01:02 127000 -- (-2065.212) (-2064.844) (-2064.655) [-2068.408] * (-2069.396) [-2064.605] (-2063.703) (-2063.785) -- 0:01:01 127500 -- (-2064.199) (-2064.294) (-2066.123) [-2068.565] * (-2069.590) [-2064.745] (-2063.782) (-2063.785) -- 0:01:01 128000 -- (-2064.900) (-2065.144) [-2066.106] (-2063.898) * (-2070.667) (-2066.178) (-2064.232) [-2063.972] -- 0:01:01 128500 -- [-2064.625] (-2067.131) (-2065.969) (-2065.018) * (-2069.912) [-2065.424] (-2064.177) (-2064.706) -- 0:01:01 129000 -- (-2064.461) [-2066.262] (-2066.640) (-2065.008) * (-2069.276) (-2064.071) [-2064.693] (-2066.470) -- 0:01:00 129500 -- [-2065.120] (-2066.937) (-2065.068) (-2066.279) * (-2068.276) (-2064.367) [-2065.869] (-2065.101) -- 0:01:00 130000 -- (-2065.007) (-2067.320) (-2069.792) [-2064.792] * (-2065.202) (-2065.252) (-2069.579) [-2064.002] -- 0:01:00 Average standard deviation of split frequencies: 0.021076 130500 -- (-2065.071) (-2066.221) [-2065.121] (-2064.595) * (-2066.129) (-2064.544) [-2066.434] (-2064.003) -- 0:00:59 131000 -- (-2065.121) [-2064.154] (-2065.687) (-2065.083) * (-2065.259) (-2064.928) (-2066.744) [-2066.458] -- 0:00:59 131500 -- (-2067.918) (-2064.443) (-2065.533) [-2065.477] * (-2066.113) [-2064.959] (-2063.255) (-2065.246) -- 0:00:59 132000 -- [-2074.753] (-2064.510) (-2064.094) (-2066.065) * (-2067.378) [-2066.208] (-2064.201) (-2065.434) -- 0:00:59 132500 -- [-2066.517] (-2065.774) (-2064.094) (-2067.929) * [-2066.843] (-2067.239) (-2066.195) (-2067.587) -- 0:00:58 133000 -- (-2067.491) (-2064.752) [-2063.915] (-2064.183) * [-2067.334] (-2068.276) (-2066.114) (-2065.670) -- 0:00:58 133500 -- (-2065.992) (-2066.811) [-2063.555] (-2063.271) * (-2066.585) [-2066.529] (-2064.631) (-2066.515) -- 0:00:58 134000 -- (-2065.908) (-2067.905) [-2064.830] (-2064.717) * [-2067.089] (-2064.816) (-2064.561) (-2065.245) -- 0:00:58 134500 -- (-2065.088) (-2067.535) (-2063.885) [-2064.840] * (-2066.043) [-2062.951] (-2064.887) (-2066.408) -- 0:00:57 135000 -- (-2066.009) [-2068.164] (-2064.770) (-2067.059) * (-2064.644) (-2067.040) [-2065.205] (-2064.842) -- 0:00:57 Average standard deviation of split frequencies: 0.020797 135500 -- (-2065.470) (-2065.638) [-2064.511] (-2065.529) * (-2065.346) [-2069.991] (-2064.014) (-2064.558) -- 0:00:57 136000 -- (-2066.244) [-2069.447] (-2064.197) (-2065.531) * (-2064.077) (-2067.754) [-2064.062] (-2064.745) -- 0:00:57 136500 -- (-2066.320) (-2068.878) [-2064.197] (-2065.377) * (-2063.717) (-2066.231) [-2063.690] (-2067.882) -- 0:00:56 137000 -- (-2066.109) [-2063.907] (-2064.179) (-2065.080) * [-2064.047] (-2066.281) (-2067.445) (-2065.750) -- 0:00:56 137500 -- (-2066.024) [-2064.175] (-2064.437) (-2064.845) * (-2063.920) (-2067.249) (-2063.288) [-2065.295] -- 0:00:56 138000 -- [-2066.644] (-2065.060) (-2064.442) (-2064.837) * (-2066.039) [-2065.174] (-2066.510) (-2063.784) -- 0:00:56 138500 -- (-2066.444) [-2065.897] (-2064.522) (-2068.042) * (-2066.216) (-2065.839) (-2063.387) [-2067.067] -- 0:00:55 139000 -- [-2064.736] (-2065.371) (-2067.119) (-2066.914) * [-2065.426] (-2065.753) (-2065.423) (-2064.423) -- 0:01:01 139500 -- [-2068.256] (-2066.859) (-2080.610) (-2069.480) * (-2067.426) (-2065.380) (-2067.894) [-2062.983] -- 0:01:01 140000 -- (-2066.050) (-2068.635) [-2066.007] (-2068.881) * (-2065.771) (-2066.873) (-2070.093) [-2067.413] -- 0:01:01 Average standard deviation of split frequencies: 0.020852 140500 -- (-2065.076) [-2065.980] (-2072.045) (-2068.532) * (-2065.977) (-2069.598) [-2065.354] (-2064.884) -- 0:01:01 141000 -- (-2064.625) [-2065.239] (-2065.486) (-2070.221) * [-2066.703] (-2067.194) (-2065.206) (-2064.722) -- 0:01:00 141500 -- (-2065.674) (-2067.287) (-2066.688) [-2066.022] * [-2066.231] (-2065.917) (-2065.253) (-2064.735) -- 0:01:00 142000 -- (-2065.797) (-2065.747) (-2063.827) [-2065.660] * (-2069.772) (-2065.461) (-2064.361) [-2064.649] -- 0:01:00 142500 -- (-2067.723) [-2064.145] (-2063.929) (-2064.324) * (-2063.784) (-2065.126) [-2063.844] (-2064.650) -- 0:01:00 143000 -- (-2066.024) (-2070.029) (-2063.929) [-2064.010] * (-2065.116) (-2066.894) [-2066.280] (-2065.400) -- 0:00:59 143500 -- (-2065.232) (-2066.449) (-2064.900) [-2066.213] * [-2066.527] (-2064.274) (-2064.192) (-2065.475) -- 0:00:59 144000 -- (-2065.606) [-2064.964] (-2064.694) (-2067.411) * (-2066.351) [-2064.136] (-2063.571) (-2067.780) -- 0:00:59 144500 -- (-2069.431) [-2066.603] (-2064.605) (-2065.461) * (-2065.597) (-2064.193) [-2063.553] (-2068.688) -- 0:00:59 145000 -- (-2066.552) (-2066.314) (-2065.751) [-2064.208] * (-2064.525) (-2065.028) [-2063.589] (-2067.400) -- 0:00:58 Average standard deviation of split frequencies: 0.020628 145500 -- (-2070.866) (-2066.438) (-2064.930) [-2064.267] * (-2064.718) (-2064.287) [-2066.802] (-2064.944) -- 0:00:58 146000 -- (-2070.865) (-2067.368) [-2066.518] (-2063.850) * (-2066.090) (-2065.474) [-2064.905] (-2066.032) -- 0:00:58 146500 -- [-2064.588] (-2066.067) (-2066.112) (-2063.651) * (-2067.098) (-2066.048) (-2067.762) [-2065.148] -- 0:00:58 147000 -- [-2064.923] (-2066.313) (-2068.258) (-2068.912) * (-2071.623) (-2065.124) (-2067.345) [-2064.811] -- 0:00:58 147500 -- (-2067.419) (-2065.817) [-2064.932] (-2065.877) * [-2074.732] (-2065.188) (-2065.033) (-2065.373) -- 0:00:57 148000 -- (-2064.882) (-2063.797) [-2064.131] (-2066.392) * (-2069.189) (-2065.283) (-2063.852) [-2065.284] -- 0:00:57 148500 -- (-2066.594) (-2064.095) (-2064.426) [-2066.812] * (-2064.781) (-2063.562) [-2063.819] (-2063.515) -- 0:00:57 149000 -- (-2066.280) (-2064.609) [-2064.227] (-2066.372) * (-2064.857) (-2064.320) [-2063.658] (-2064.143) -- 0:00:57 149500 -- [-2065.166] (-2065.789) (-2064.844) (-2065.489) * (-2064.857) (-2067.571) [-2063.658] (-2065.318) -- 0:00:56 150000 -- [-2065.098] (-2067.219) (-2064.002) (-2064.960) * [-2063.714] (-2069.362) (-2068.457) (-2064.432) -- 0:00:56 Average standard deviation of split frequencies: 0.021243 150500 -- [-2065.301] (-2066.007) (-2065.681) (-2065.312) * [-2064.079] (-2068.348) (-2065.552) (-2067.379) -- 0:00:56 151000 -- (-2067.543) [-2066.686] (-2066.770) (-2065.341) * (-2064.541) (-2066.328) (-2066.832) [-2065.116] -- 0:00:56 151500 -- (-2065.760) (-2066.295) (-2066.832) [-2065.006] * [-2063.753] (-2068.058) (-2065.648) (-2065.846) -- 0:00:56 152000 -- (-2063.354) (-2065.091) (-2063.997) [-2065.239] * (-2065.692) (-2070.198) (-2065.304) [-2066.660] -- 0:00:55 152500 -- [-2063.133] (-2064.349) (-2064.381) (-2065.572) * (-2064.631) (-2065.983) (-2073.689) [-2065.994] -- 0:00:55 153000 -- (-2063.153) (-2071.361) (-2065.839) [-2066.202] * (-2063.898) (-2066.822) (-2069.917) [-2063.936] -- 0:00:55 153500 -- [-2065.609] (-2064.410) (-2064.893) (-2066.217) * (-2064.983) (-2067.223) (-2065.057) [-2063.659] -- 0:00:55 154000 -- [-2064.567] (-2063.777) (-2064.794) (-2064.583) * (-2065.479) [-2064.634] (-2065.133) (-2063.659) -- 0:00:54 154500 -- [-2067.355] (-2064.505) (-2064.012) (-2064.692) * [-2066.042] (-2065.825) (-2069.538) (-2063.578) -- 0:01:00 155000 -- (-2064.795) [-2065.238] (-2064.745) (-2073.445) * (-2070.041) (-2068.066) [-2069.391] (-2065.203) -- 0:00:59 Average standard deviation of split frequencies: 0.022397 155500 -- (-2064.786) (-2070.009) [-2063.284] (-2072.133) * (-2065.527) [-2066.579] (-2063.275) (-2065.231) -- 0:00:59 156000 -- (-2064.628) (-2065.561) [-2063.338] (-2071.839) * (-2064.784) (-2066.213) (-2063.313) [-2063.609] -- 0:00:59 156500 -- [-2064.939] (-2067.509) (-2064.688) (-2068.265) * (-2064.096) [-2065.618] (-2065.773) (-2067.142) -- 0:00:59 157000 -- [-2064.123] (-2067.681) (-2065.426) (-2066.690) * (-2066.119) [-2064.832] (-2068.679) (-2065.923) -- 0:00:59 157500 -- (-2066.232) [-2065.597] (-2069.107) (-2066.379) * (-2064.971) (-2063.383) (-2065.563) [-2067.557] -- 0:00:58 158000 -- (-2066.499) (-2065.000) [-2064.853] (-2066.442) * (-2065.403) (-2069.234) (-2065.287) [-2065.127] -- 0:00:58 158500 -- (-2066.526) (-2066.305) (-2064.465) [-2065.881] * [-2065.554] (-2065.449) (-2064.927) (-2064.773) -- 0:00:58 159000 -- (-2066.126) (-2065.076) [-2064.351] (-2068.173) * [-2065.321] (-2064.661) (-2066.060) (-2063.929) -- 0:00:58 159500 -- (-2064.654) (-2064.843) [-2065.399] (-2065.535) * (-2065.435) (-2064.563) [-2067.630] (-2064.342) -- 0:00:57 160000 -- (-2064.775) (-2065.907) [-2065.008] (-2065.005) * (-2065.676) [-2063.305] (-2065.508) (-2065.915) -- 0:00:57 Average standard deviation of split frequencies: 0.024124 160500 -- [-2064.224] (-2065.553) (-2065.857) (-2068.389) * (-2065.330) [-2063.304] (-2073.688) (-2063.595) -- 0:00:57 161000 -- (-2066.265) (-2066.079) [-2066.290] (-2069.908) * (-2065.263) (-2063.310) (-2071.355) [-2065.662] -- 0:00:57 161500 -- (-2068.275) (-2064.800) [-2065.272] (-2066.032) * (-2067.486) [-2063.261] (-2068.188) (-2066.568) -- 0:00:57 162000 -- (-2066.361) (-2065.234) (-2068.312) [-2065.158] * (-2068.061) (-2064.596) [-2065.323] (-2065.979) -- 0:00:56 162500 -- (-2069.017) (-2066.378) (-2066.280) [-2064.931] * [-2063.834] (-2067.588) (-2065.026) (-2066.352) -- 0:00:56 163000 -- (-2066.724) (-2064.062) (-2066.526) [-2066.789] * (-2063.708) (-2068.857) [-2063.179] (-2068.937) -- 0:00:56 163500 -- (-2066.018) [-2064.779] (-2066.525) (-2065.509) * [-2064.421] (-2070.873) (-2063.208) (-2067.318) -- 0:00:56 164000 -- (-2064.308) [-2064.380] (-2066.928) (-2065.508) * (-2064.703) [-2067.930] (-2063.469) (-2068.065) -- 0:00:56 164500 -- (-2065.532) (-2064.199) (-2065.244) [-2064.630] * (-2064.713) (-2064.156) [-2064.558] (-2064.237) -- 0:00:55 165000 -- [-2065.241] (-2063.946) (-2065.998) (-2068.611) * (-2065.038) (-2063.621) (-2064.828) [-2067.357] -- 0:00:55 Average standard deviation of split frequencies: 0.023507 165500 -- [-2064.783] (-2065.358) (-2067.326) (-2066.824) * [-2064.464] (-2067.468) (-2065.897) (-2065.748) -- 0:00:55 166000 -- (-2064.167) [-2064.938] (-2068.320) (-2066.617) * (-2064.805) [-2064.077] (-2071.387) (-2066.045) -- 0:00:55 166500 -- [-2065.764] (-2067.309) (-2068.557) (-2065.432) * (-2064.511) [-2064.084] (-2064.324) (-2063.649) -- 0:00:55 167000 -- (-2066.200) (-2065.543) (-2065.151) [-2067.438] * [-2065.696] (-2064.084) (-2064.348) (-2064.398) -- 0:00:54 167500 -- (-2066.623) (-2064.397) [-2067.989] (-2065.987) * (-2064.194) [-2065.515] (-2064.731) (-2064.432) -- 0:00:54 168000 -- (-2062.997) (-2064.653) [-2065.467] (-2065.249) * (-2063.599) (-2063.779) [-2065.185] (-2063.954) -- 0:00:54 168500 -- (-2065.412) [-2064.359] (-2068.678) (-2064.496) * (-2063.608) (-2063.463) (-2066.146) [-2063.515] -- 0:00:54 169000 -- (-2064.011) (-2065.604) [-2064.710] (-2064.618) * (-2066.555) (-2064.316) [-2067.413] (-2064.248) -- 0:00:54 169500 -- [-2065.286] (-2065.889) (-2068.882) (-2064.973) * (-2064.439) (-2066.010) [-2068.350] (-2064.290) -- 0:00:58 170000 -- (-2063.365) [-2065.080] (-2065.585) (-2065.075) * [-2065.850] (-2065.434) (-2069.667) (-2066.040) -- 0:00:58 Average standard deviation of split frequencies: 0.024372 170500 -- (-2065.073) (-2064.885) (-2065.387) [-2064.602] * [-2063.919] (-2063.036) (-2067.313) (-2064.487) -- 0:00:58 171000 -- [-2063.179] (-2064.714) (-2067.525) (-2064.053) * [-2067.723] (-2064.551) (-2063.827) (-2065.206) -- 0:00:58 171500 -- (-2068.939) [-2068.684] (-2067.389) (-2065.387) * (-2064.798) (-2070.303) (-2063.586) [-2068.507] -- 0:00:57 172000 -- (-2068.130) (-2068.818) (-2067.496) [-2064.057] * (-2062.943) [-2068.843] (-2064.518) (-2068.729) -- 0:00:57 172500 -- (-2067.798) (-2066.958) (-2066.306) [-2067.644] * (-2063.585) (-2070.063) [-2064.007] (-2072.046) -- 0:00:57 173000 -- (-2067.826) (-2068.363) [-2065.135] (-2064.390) * (-2067.622) (-2067.556) [-2063.828] (-2074.492) -- 0:00:57 173500 -- (-2066.512) (-2067.189) [-2065.724] (-2064.657) * (-2068.032) [-2066.134] (-2063.876) (-2066.941) -- 0:00:57 174000 -- (-2063.151) (-2066.916) [-2064.118] (-2066.035) * (-2063.334) (-2073.834) [-2063.428] (-2069.690) -- 0:00:56 174500 -- [-2063.954] (-2067.788) (-2072.703) (-2064.861) * (-2066.298) (-2065.191) [-2064.080] (-2064.374) -- 0:00:56 175000 -- [-2064.617] (-2067.783) (-2065.769) (-2064.904) * [-2064.546] (-2064.299) (-2063.710) (-2064.882) -- 0:00:56 Average standard deviation of split frequencies: 0.023808 175500 -- (-2064.561) (-2067.548) (-2064.687) [-2064.053] * [-2065.205] (-2063.882) (-2065.681) (-2065.464) -- 0:00:56 176000 -- [-2064.079] (-2065.937) (-2065.786) (-2067.992) * [-2067.030] (-2063.214) (-2064.516) (-2065.054) -- 0:00:56 176500 -- (-2065.154) (-2066.276) (-2066.047) [-2064.702] * (-2070.032) [-2063.297] (-2064.498) (-2069.402) -- 0:00:55 177000 -- (-2064.462) [-2067.152] (-2066.831) (-2065.727) * (-2070.123) (-2064.725) (-2066.667) [-2065.234] -- 0:00:55 177500 -- [-2063.636] (-2064.218) (-2065.430) (-2064.817) * (-2066.747) [-2066.085] (-2064.431) (-2064.655) -- 0:00:55 178000 -- [-2068.939] (-2064.935) (-2065.430) (-2067.858) * (-2066.027) [-2063.096] (-2064.201) (-2067.088) -- 0:00:55 178500 -- (-2065.192) (-2068.236) [-2066.393] (-2067.890) * (-2063.503) (-2066.473) (-2067.645) [-2070.605] -- 0:00:55 179000 -- (-2063.718) (-2066.231) [-2066.711] (-2064.477) * (-2063.878) (-2066.722) [-2066.139] (-2069.768) -- 0:00:55 179500 -- (-2064.429) (-2065.217) [-2067.792] (-2064.530) * [-2070.230] (-2063.331) (-2066.367) (-2066.271) -- 0:00:54 180000 -- (-2064.260) [-2063.971] (-2068.309) (-2067.003) * (-2065.302) [-2063.628] (-2069.784) (-2066.468) -- 0:00:54 Average standard deviation of split frequencies: 0.022562 180500 -- [-2064.349] (-2063.979) (-2065.343) (-2065.056) * [-2065.811] (-2064.353) (-2069.662) (-2064.796) -- 0:00:54 181000 -- [-2065.730] (-2064.017) (-2069.943) (-2066.797) * (-2065.159) (-2063.325) [-2065.929] (-2064.856) -- 0:00:54 181500 -- (-2065.615) [-2064.384] (-2068.787) (-2067.257) * (-2066.751) (-2063.400) (-2066.136) [-2065.322] -- 0:00:54 182000 -- (-2069.924) (-2064.427) (-2068.525) [-2065.161] * (-2066.718) (-2064.020) [-2069.938] (-2066.306) -- 0:00:53 182500 -- [-2071.742] (-2064.966) (-2067.590) (-2064.835) * (-2065.248) (-2063.289) (-2065.557) [-2068.524] -- 0:00:53 183000 -- [-2070.351] (-2064.895) (-2071.512) (-2067.286) * [-2067.438] (-2063.817) (-2066.191) (-2070.024) -- 0:00:53 183500 -- (-2066.012) [-2067.121] (-2070.151) (-2065.143) * (-2069.949) (-2065.032) (-2069.006) [-2067.700] -- 0:00:53 184000 -- [-2065.008] (-2068.546) (-2069.042) (-2065.143) * (-2063.068) (-2065.643) (-2064.733) [-2065.498] -- 0:00:53 184500 -- [-2069.330] (-2072.809) (-2069.547) (-2065.110) * (-2064.958) (-2064.330) (-2064.733) [-2067.109] -- 0:00:53 185000 -- (-2069.173) (-2068.064) [-2065.027] (-2065.992) * [-2064.468] (-2066.087) (-2067.410) (-2064.062) -- 0:00:57 Average standard deviation of split frequencies: 0.023514 185500 -- (-2067.530) [-2068.814] (-2066.721) (-2064.338) * (-2063.450) [-2065.043] (-2065.968) (-2064.861) -- 0:00:57 186000 -- (-2066.747) (-2072.134) [-2064.644] (-2065.648) * [-2064.166] (-2064.983) (-2067.663) (-2063.695) -- 0:00:56 186500 -- (-2065.677) (-2069.067) (-2063.513) [-2065.723] * (-2068.178) (-2069.125) [-2064.378] (-2064.543) -- 0:00:56 187000 -- (-2065.181) (-2069.424) [-2064.827] (-2065.736) * (-2069.179) (-2065.402) [-2064.143] (-2064.957) -- 0:00:56 187500 -- (-2068.264) (-2066.698) (-2063.063) [-2066.656] * [-2066.148] (-2065.054) (-2063.579) (-2064.092) -- 0:00:56 188000 -- (-2069.291) (-2065.520) [-2063.085] (-2066.662) * (-2064.688) [-2064.869] (-2065.797) (-2063.840) -- 0:00:56 188500 -- (-2064.852) (-2063.847) (-2065.013) [-2065.688] * (-2066.517) (-2064.539) (-2064.272) [-2063.854] -- 0:00:55 189000 -- (-2065.762) [-2067.171] (-2064.363) (-2064.414) * (-2066.587) [-2063.565] (-2063.960) (-2065.013) -- 0:00:55 189500 -- (-2066.813) (-2064.900) (-2064.296) [-2063.983] * (-2067.275) (-2065.081) [-2064.747] (-2064.633) -- 0:00:55 190000 -- [-2065.844] (-2066.037) (-2065.011) (-2064.392) * (-2067.026) (-2065.047) (-2064.857) [-2065.130] -- 0:00:55 Average standard deviation of split frequencies: 0.023553 190500 -- (-2064.549) [-2065.179] (-2064.622) (-2064.445) * (-2064.066) [-2065.432] (-2064.078) (-2063.267) -- 0:00:55 191000 -- (-2064.683) (-2064.042) [-2070.415] (-2063.503) * (-2066.202) [-2063.894] (-2064.070) (-2063.428) -- 0:00:55 191500 -- (-2064.969) [-2063.204] (-2069.888) (-2064.290) * (-2064.082) (-2064.983) (-2064.741) [-2065.374] -- 0:00:54 192000 -- (-2064.333) (-2065.665) (-2065.409) [-2064.336] * (-2064.522) [-2065.550] (-2065.274) (-2063.749) -- 0:00:54 192500 -- (-2065.653) (-2066.818) [-2063.786] (-2066.282) * (-2064.476) (-2065.195) (-2064.309) [-2063.957] -- 0:00:54 193000 -- (-2064.771) [-2066.361] (-2063.913) (-2063.490) * (-2064.961) (-2065.799) (-2065.073) [-2064.264] -- 0:00:54 193500 -- [-2064.166] (-2063.427) (-2064.945) (-2065.543) * [-2064.454] (-2067.540) (-2063.613) (-2064.418) -- 0:00:54 194000 -- (-2063.939) [-2063.468] (-2063.992) (-2063.572) * (-2066.427) (-2067.995) [-2065.602] (-2064.106) -- 0:00:54 194500 -- (-2064.465) [-2067.282] (-2063.858) (-2063.577) * [-2065.006] (-2063.363) (-2065.196) (-2064.070) -- 0:00:53 195000 -- (-2065.452) [-2064.066] (-2065.165) (-2065.411) * (-2064.675) (-2063.735) (-2064.983) [-2063.929] -- 0:00:53 Average standard deviation of split frequencies: 0.023671 195500 -- (-2063.872) (-2065.768) (-2064.777) [-2065.781] * (-2064.161) [-2064.711] (-2065.083) (-2065.137) -- 0:00:53 196000 -- [-2064.632] (-2065.983) (-2064.433) (-2065.882) * (-2064.561) (-2064.473) (-2067.007) [-2066.235] -- 0:00:53 196500 -- (-2064.472) [-2065.683] (-2066.548) (-2066.519) * [-2064.373] (-2067.392) (-2066.863) (-2066.221) -- 0:00:53 197000 -- (-2064.924) [-2068.769] (-2066.487) (-2066.207) * (-2068.696) [-2066.629] (-2067.300) (-2066.149) -- 0:00:52 197500 -- [-2065.536] (-2064.663) (-2064.628) (-2067.287) * [-2065.770] (-2066.027) (-2069.233) (-2064.949) -- 0:00:52 198000 -- [-2064.646] (-2064.696) (-2065.002) (-2065.545) * (-2066.203) (-2065.397) (-2067.387) [-2064.009] -- 0:00:52 198500 -- [-2064.667] (-2064.699) (-2064.797) (-2063.711) * (-2069.419) (-2066.593) (-2064.046) [-2065.196] -- 0:00:52 199000 -- (-2068.231) (-2065.849) [-2063.957] (-2063.791) * (-2063.749) [-2067.331] (-2071.194) (-2068.846) -- 0:00:52 199500 -- (-2065.243) [-2064.041] (-2063.821) (-2063.297) * [-2063.894] (-2066.133) (-2067.496) (-2068.807) -- 0:00:52 200000 -- (-2065.473) (-2065.090) [-2063.782] (-2065.032) * [-2063.783] (-2064.590) (-2064.234) (-2070.334) -- 0:00:51 Average standard deviation of split frequencies: 0.022379 200500 -- [-2065.631] (-2067.512) (-2063.688) (-2063.523) * (-2063.330) (-2064.063) (-2066.178) [-2071.051] -- 0:00:55 201000 -- (-2063.654) [-2065.026] (-2063.933) (-2063.405) * [-2063.653] (-2066.983) (-2065.688) (-2067.989) -- 0:00:55 201500 -- [-2063.787] (-2064.321) (-2063.857) (-2068.865) * [-2062.987] (-2066.057) (-2066.524) (-2068.877) -- 0:00:55 202000 -- (-2063.740) [-2063.699] (-2065.633) (-2063.181) * (-2065.100) (-2067.949) [-2063.743] (-2066.265) -- 0:00:55 202500 -- [-2066.095] (-2066.964) (-2065.149) (-2063.393) * [-2063.980] (-2069.632) (-2063.782) (-2064.687) -- 0:00:55 203000 -- (-2065.650) (-2067.953) (-2063.494) [-2063.326] * (-2063.505) (-2067.788) (-2064.545) [-2065.982] -- 0:00:54 203500 -- (-2067.377) (-2067.175) (-2065.206) [-2064.259] * (-2066.565) [-2069.877] (-2066.301) (-2067.675) -- 0:00:54 204000 -- (-2069.695) [-2064.914] (-2064.671) (-2064.237) * (-2064.824) (-2065.617) [-2067.946] (-2067.313) -- 0:00:54 204500 -- (-2065.019) [-2064.241] (-2064.876) (-2063.600) * [-2063.913] (-2068.194) (-2068.697) (-2064.529) -- 0:00:54 205000 -- (-2065.006) [-2064.269] (-2065.069) (-2062.968) * (-2064.473) (-2066.422) (-2067.880) [-2064.095] -- 0:00:54 Average standard deviation of split frequencies: 0.022763 205500 -- [-2063.495] (-2071.993) (-2065.317) (-2066.538) * (-2063.554) [-2065.329] (-2066.949) (-2064.234) -- 0:00:54 206000 -- [-2063.885] (-2068.176) (-2066.665) (-2065.576) * (-2063.861) (-2063.507) [-2066.291] (-2066.710) -- 0:00:53 206500 -- [-2063.468] (-2065.397) (-2068.928) (-2064.537) * (-2063.473) [-2063.254] (-2064.759) (-2068.518) -- 0:00:53 207000 -- (-2063.509) [-2064.066] (-2065.645) (-2065.205) * [-2064.210] (-2063.280) (-2064.665) (-2070.746) -- 0:00:53 207500 -- (-2074.507) (-2063.588) (-2064.905) [-2065.530] * (-2064.944) (-2063.238) [-2064.470] (-2066.822) -- 0:00:53 208000 -- (-2064.211) [-2063.379] (-2065.742) (-2064.968) * (-2064.801) (-2064.760) [-2064.559] (-2065.728) -- 0:00:53 208500 -- [-2066.914] (-2063.285) (-2064.099) (-2066.763) * [-2065.070] (-2069.979) (-2065.224) (-2065.703) -- 0:00:53 209000 -- (-2070.442) (-2062.924) (-2065.749) [-2064.133] * (-2065.723) (-2064.994) (-2063.837) [-2065.432] -- 0:00:52 209500 -- [-2066.887] (-2064.383) (-2066.011) (-2064.844) * (-2066.210) (-2065.320) [-2064.706] (-2066.768) -- 0:00:52 210000 -- [-2063.822] (-2067.147) (-2070.231) (-2063.762) * (-2064.854) (-2067.341) [-2064.706] (-2067.101) -- 0:00:52 Average standard deviation of split frequencies: 0.021594 210500 -- (-2063.976) (-2066.272) [-2068.715] (-2063.401) * (-2065.207) [-2063.833] (-2064.664) (-2065.394) -- 0:00:52 211000 -- (-2064.979) (-2066.742) [-2066.005] (-2063.350) * (-2065.837) (-2064.138) [-2064.181] (-2064.560) -- 0:00:52 211500 -- (-2064.568) (-2065.983) (-2064.728) [-2063.478] * (-2063.604) (-2067.495) (-2066.487) [-2065.128] -- 0:00:52 212000 -- (-2063.431) (-2066.788) (-2066.030) [-2063.300] * [-2063.990] (-2064.747) (-2067.334) (-2066.041) -- 0:00:52 212500 -- (-2063.431) (-2065.330) (-2065.820) [-2063.798] * [-2063.315] (-2063.567) (-2066.875) (-2067.160) -- 0:00:51 213000 -- (-2063.333) (-2063.524) (-2066.772) [-2066.172] * (-2063.509) (-2064.469) (-2066.874) [-2067.416] -- 0:00:51 213500 -- (-2064.486) [-2063.524] (-2065.931) (-2065.749) * (-2064.217) (-2063.852) (-2065.663) [-2068.380] -- 0:00:51 214000 -- (-2065.956) (-2064.243) (-2065.931) [-2065.313] * (-2063.803) (-2063.559) [-2064.835] (-2067.955) -- 0:00:51 214500 -- (-2063.951) (-2065.053) (-2068.352) [-2064.891] * [-2063.662] (-2065.169) (-2065.004) (-2067.455) -- 0:00:51 215000 -- (-2063.203) [-2064.844] (-2066.555) (-2065.337) * (-2064.025) (-2063.766) [-2065.015] (-2065.878) -- 0:00:51 Average standard deviation of split frequencies: 0.021715 215500 -- [-2064.264] (-2065.334) (-2065.847) (-2066.460) * (-2063.890) (-2064.997) (-2065.019) [-2065.224] -- 0:00:50 216000 -- [-2064.114] (-2071.044) (-2064.256) (-2066.874) * [-2064.794] (-2064.190) (-2065.515) (-2065.469) -- 0:00:54 216500 -- [-2064.718] (-2065.543) (-2064.060) (-2064.393) * [-2064.157] (-2068.443) (-2064.263) (-2068.287) -- 0:00:54 217000 -- (-2064.059) (-2070.336) (-2063.916) [-2064.435] * (-2070.141) (-2064.701) (-2063.167) [-2065.059] -- 0:00:54 217500 -- (-2064.889) (-2076.235) [-2064.008] (-2064.271) * (-2065.529) (-2064.523) (-2064.775) [-2064.917] -- 0:00:53 218000 -- (-2065.146) (-2066.503) (-2066.682) [-2065.209] * (-2065.615) (-2064.093) (-2065.268) [-2064.039] -- 0:00:53 218500 -- (-2065.849) [-2068.302] (-2063.960) (-2065.239) * (-2067.575) (-2064.095) (-2064.305) [-2064.839] -- 0:00:53 219000 -- (-2064.813) (-2067.226) [-2063.896] (-2065.628) * [-2063.854] (-2068.684) (-2066.528) (-2064.966) -- 0:00:53 219500 -- (-2064.522) [-2067.650] (-2064.118) (-2064.051) * (-2065.145) (-2068.972) [-2063.661] (-2065.602) -- 0:00:53 220000 -- (-2065.059) (-2065.475) (-2065.345) [-2066.478] * [-2065.359] (-2068.304) (-2065.719) (-2067.955) -- 0:00:53 Average standard deviation of split frequencies: 0.019939 220500 -- [-2066.107] (-2066.796) (-2065.882) (-2068.209) * (-2066.236) (-2067.533) (-2066.620) [-2065.659] -- 0:00:53 221000 -- (-2068.904) (-2067.205) (-2064.619) [-2066.762] * (-2066.735) (-2067.610) [-2067.305] (-2065.177) -- 0:00:52 221500 -- (-2067.594) (-2065.010) (-2064.522) [-2065.687] * [-2068.875] (-2066.705) (-2067.681) (-2066.793) -- 0:00:52 222000 -- (-2067.563) (-2066.126) [-2067.965] (-2066.583) * [-2067.874] (-2071.952) (-2067.880) (-2069.374) -- 0:00:52 222500 -- (-2070.192) [-2066.232] (-2068.040) (-2064.617) * (-2065.438) [-2065.672] (-2065.717) (-2064.233) -- 0:00:52 223000 -- [-2067.307] (-2068.762) (-2068.253) (-2064.299) * [-2063.741] (-2067.554) (-2063.936) (-2066.603) -- 0:00:52 223500 -- (-2068.651) (-2067.879) (-2067.570) [-2063.954] * [-2063.843] (-2066.820) (-2063.957) (-2068.999) -- 0:00:52 224000 -- (-2067.406) [-2065.722] (-2066.929) (-2063.498) * (-2063.882) (-2067.363) (-2064.820) [-2064.970] -- 0:00:51 224500 -- [-2064.283] (-2063.959) (-2065.867) (-2064.834) * (-2066.170) (-2066.928) [-2065.518] (-2065.343) -- 0:00:51 225000 -- (-2066.027) (-2064.673) [-2066.900] (-2064.829) * (-2066.125) [-2066.274] (-2063.317) (-2067.289) -- 0:00:51 Average standard deviation of split frequencies: 0.022051 225500 -- [-2063.837] (-2065.502) (-2066.891) (-2064.891) * [-2064.458] (-2067.658) (-2065.313) (-2066.936) -- 0:00:51 226000 -- (-2065.436) (-2067.964) [-2064.607] (-2063.930) * (-2064.882) (-2064.452) (-2064.421) [-2065.321] -- 0:00:51 226500 -- (-2064.609) (-2068.569) (-2065.222) [-2063.770] * [-2065.201] (-2064.318) (-2064.556) (-2064.799) -- 0:00:51 227000 -- [-2064.595] (-2074.940) (-2068.736) (-2064.696) * (-2065.199) [-2064.002] (-2064.892) (-2063.953) -- 0:00:51 227500 -- (-2063.651) [-2069.463] (-2065.359) (-2065.714) * (-2064.688) (-2063.096) (-2064.882) [-2065.250] -- 0:00:50 228000 -- (-2065.163) (-2069.617) [-2065.924] (-2064.207) * (-2064.473) [-2063.209] (-2065.486) (-2064.072) -- 0:00:50 228500 -- (-2065.002) (-2069.534) (-2064.226) [-2064.689] * (-2064.507) [-2063.651] (-2065.172) (-2064.547) -- 0:00:50 229000 -- (-2064.083) (-2066.101) (-2064.205) [-2065.680] * (-2064.427) [-2063.585] (-2064.490) (-2067.651) -- 0:00:50 229500 -- (-2069.330) [-2065.807] (-2065.343) (-2066.533) * (-2063.403) (-2065.871) [-2065.358] (-2066.382) -- 0:00:50 230000 -- (-2072.500) (-2066.226) (-2064.453) [-2064.095] * (-2064.633) (-2065.743) [-2064.632] (-2064.613) -- 0:00:50 Average standard deviation of split frequencies: 0.022991 230500 -- [-2063.612] (-2065.580) (-2064.295) (-2066.414) * [-2063.642] (-2065.716) (-2065.060) (-2063.918) -- 0:00:50 231000 -- (-2063.611) [-2067.374] (-2063.553) (-2066.686) * [-2063.668] (-2065.264) (-2064.962) (-2063.917) -- 0:00:49 231500 -- (-2064.226) [-2066.748] (-2064.649) (-2064.056) * [-2063.668] (-2065.511) (-2067.383) (-2064.647) -- 0:00:53 232000 -- [-2065.814] (-2066.961) (-2066.060) (-2064.506) * (-2064.628) [-2064.773] (-2064.484) (-2066.309) -- 0:00:52 232500 -- [-2065.967] (-2065.217) (-2066.626) (-2065.040) * (-2064.291) (-2067.823) (-2065.067) [-2063.403] -- 0:00:52 233000 -- [-2063.615] (-2064.903) (-2069.683) (-2064.803) * [-2064.003] (-2064.631) (-2063.951) (-2066.751) -- 0:00:52 233500 -- (-2064.581) [-2066.174] (-2068.926) (-2066.872) * (-2068.202) (-2065.900) (-2065.920) [-2068.367] -- 0:00:52 234000 -- [-2064.506] (-2066.424) (-2068.054) (-2064.451) * [-2067.594] (-2063.559) (-2064.620) (-2066.061) -- 0:00:52 234500 -- [-2064.827] (-2064.673) (-2067.054) (-2065.085) * (-2063.944) (-2066.101) [-2066.666] (-2066.011) -- 0:00:52 235000 -- [-2063.679] (-2066.239) (-2069.913) (-2064.214) * (-2064.124) (-2065.074) [-2066.203] (-2067.779) -- 0:00:52 Average standard deviation of split frequencies: 0.022708 235500 -- (-2065.640) [-2065.880] (-2067.577) (-2071.058) * (-2064.308) (-2065.479) [-2064.993] (-2065.379) -- 0:00:51 236000 -- (-2065.304) (-2065.960) [-2065.741] (-2069.904) * (-2063.671) [-2065.630] (-2064.482) (-2063.078) -- 0:00:51 236500 -- (-2067.337) [-2066.838] (-2067.761) (-2065.207) * (-2064.391) (-2063.584) [-2064.884] (-2063.096) -- 0:00:51 237000 -- (-2066.253) (-2066.078) [-2070.628] (-2070.856) * (-2064.252) (-2064.384) [-2067.519] (-2065.085) -- 0:00:51 237500 -- [-2062.833] (-2067.032) (-2069.925) (-2069.167) * (-2065.368) [-2066.027] (-2067.346) (-2065.085) -- 0:00:51 238000 -- [-2062.837] (-2063.925) (-2070.069) (-2067.652) * [-2066.545] (-2066.978) (-2069.781) (-2064.045) -- 0:00:51 238500 -- [-2064.266] (-2067.650) (-2066.903) (-2067.759) * (-2065.961) (-2065.009) (-2070.534) [-2063.667] -- 0:00:51 239000 -- (-2064.986) (-2064.254) (-2066.400) [-2065.020] * (-2064.695) (-2065.409) [-2067.033] (-2065.413) -- 0:00:50 239500 -- [-2063.387] (-2064.157) (-2066.242) (-2064.328) * (-2065.595) (-2069.083) [-2065.437] (-2064.425) -- 0:00:50 240000 -- [-2063.452] (-2064.860) (-2066.215) (-2064.548) * (-2064.761) [-2064.899] (-2065.080) (-2063.964) -- 0:00:50 Average standard deviation of split frequencies: 0.022268 240500 -- (-2063.169) [-2064.636] (-2066.278) (-2066.196) * (-2065.597) (-2065.663) (-2063.855) [-2065.376] -- 0:00:50 241000 -- (-2065.044) (-2067.297) [-2065.317] (-2067.933) * (-2065.481) (-2065.630) [-2064.357] (-2063.483) -- 0:00:50 241500 -- [-2066.779] (-2070.358) (-2065.995) (-2067.282) * (-2065.235) (-2066.009) [-2064.179] (-2064.407) -- 0:00:50 242000 -- (-2068.879) (-2075.021) [-2064.716] (-2065.704) * [-2064.483] (-2067.162) (-2064.438) (-2064.555) -- 0:00:50 242500 -- (-2072.785) (-2072.600) [-2064.646] (-2063.597) * (-2069.305) [-2066.795] (-2063.102) (-2064.672) -- 0:00:49 243000 -- [-2065.040] (-2071.068) (-2065.005) (-2063.517) * (-2064.583) (-2067.433) (-2063.650) [-2064.776] -- 0:00:49 243500 -- (-2065.083) [-2065.812] (-2063.963) (-2066.882) * (-2064.583) (-2064.078) [-2063.930] (-2068.036) -- 0:00:49 244000 -- [-2063.676] (-2065.933) (-2063.963) (-2065.306) * (-2064.508) (-2064.078) [-2064.742] (-2067.380) -- 0:00:49 244500 -- (-2064.127) (-2070.005) (-2066.356) [-2065.592] * (-2067.775) (-2064.661) (-2066.453) [-2064.861] -- 0:00:49 245000 -- (-2063.405) [-2067.215] (-2066.187) (-2065.535) * (-2064.536) [-2063.000] (-2064.077) (-2065.559) -- 0:00:49 Average standard deviation of split frequencies: 0.023600 245500 -- (-2064.866) [-2064.243] (-2065.719) (-2065.337) * (-2065.490) (-2065.361) (-2064.348) [-2065.060] -- 0:00:49 246000 -- (-2064.832) (-2063.797) [-2067.146] (-2067.501) * [-2065.980] (-2065.320) (-2064.370) (-2064.203) -- 0:00:49 246500 -- (-2064.369) (-2066.035) [-2065.267] (-2067.725) * [-2064.890] (-2065.339) (-2063.654) (-2063.683) -- 0:00:48 247000 -- [-2065.777] (-2070.010) (-2066.385) (-2065.783) * (-2065.061) [-2065.294] (-2064.001) (-2063.844) -- 0:00:51 247500 -- (-2066.930) (-2065.006) (-2067.317) [-2066.889] * [-2065.061] (-2063.476) (-2068.745) (-2063.684) -- 0:00:51 248000 -- [-2066.803] (-2065.117) (-2068.540) (-2067.878) * (-2064.428) (-2064.146) [-2066.012] (-2069.241) -- 0:00:51 248500 -- [-2066.020] (-2066.106) (-2065.168) (-2063.809) * [-2063.769] (-2064.962) (-2065.157) (-2068.089) -- 0:00:51 249000 -- (-2070.178) [-2067.436] (-2064.299) (-2064.276) * (-2063.739) [-2068.104] (-2070.883) (-2065.168) -- 0:00:51 249500 -- (-2071.373) (-2067.172) [-2066.113] (-2063.206) * (-2067.296) (-2065.462) (-2065.875) [-2066.506] -- 0:00:51 250000 -- (-2063.003) (-2065.605) [-2064.979] (-2063.167) * [-2069.921] (-2065.615) (-2063.818) (-2066.353) -- 0:00:51 Average standard deviation of split frequencies: 0.021973 250500 -- [-2063.929] (-2065.606) (-2066.944) (-2067.132) * (-2068.463) (-2066.423) [-2063.293] (-2067.142) -- 0:00:50 251000 -- (-2064.488) (-2064.367) (-2065.769) [-2065.391] * (-2068.577) [-2067.305] (-2063.612) (-2065.671) -- 0:00:50 251500 -- (-2065.123) (-2065.614) [-2063.757] (-2064.441) * (-2066.927) [-2066.988] (-2063.543) (-2063.742) -- 0:00:50 252000 -- (-2065.254) [-2063.041] (-2066.194) (-2066.007) * (-2063.458) [-2065.266] (-2067.510) (-2064.097) -- 0:00:50 252500 -- (-2067.748) (-2063.043) [-2067.015] (-2070.004) * (-2063.458) [-2064.816] (-2067.022) (-2064.138) -- 0:00:50 253000 -- (-2066.318) (-2066.451) [-2065.524] (-2070.018) * (-2064.054) (-2063.920) [-2063.079] (-2066.421) -- 0:00:50 253500 -- (-2068.620) (-2065.217) [-2065.030] (-2065.544) * (-2063.401) (-2063.524) [-2063.231] (-2068.200) -- 0:00:50 254000 -- (-2066.825) (-2066.013) (-2064.742) [-2067.990] * (-2063.555) (-2063.229) [-2064.404] (-2069.466) -- 0:00:49 254500 -- (-2068.466) [-2064.352] (-2068.220) (-2067.870) * (-2063.421) (-2065.025) (-2063.151) [-2066.140] -- 0:00:49 255000 -- (-2068.303) (-2063.504) [-2065.487] (-2066.396) * (-2066.963) (-2067.441) [-2063.239] (-2065.381) -- 0:00:49 Average standard deviation of split frequencies: 0.022005 255500 -- [-2066.219] (-2064.841) (-2065.790) (-2065.911) * (-2069.873) (-2066.722) (-2063.695) [-2064.644] -- 0:00:49 256000 -- (-2064.603) (-2063.773) (-2066.681) [-2065.080] * (-2065.963) (-2066.992) [-2063.640] (-2064.386) -- 0:00:49 256500 -- [-2065.034] (-2063.812) (-2064.981) (-2064.900) * (-2068.836) (-2063.884) [-2064.764] (-2064.919) -- 0:00:49 257000 -- [-2065.056] (-2064.611) (-2065.474) (-2064.272) * (-2066.205) (-2063.737) [-2065.589] (-2065.949) -- 0:00:49 257500 -- (-2066.439) (-2065.239) (-2064.825) [-2063.818] * (-2066.916) (-2064.784) (-2068.113) [-2065.385] -- 0:00:49 258000 -- (-2065.837) [-2064.204] (-2064.115) (-2064.781) * (-2064.288) [-2065.126] (-2067.710) (-2068.488) -- 0:00:48 258500 -- (-2065.832) (-2064.386) [-2064.260] (-2067.571) * [-2067.504] (-2064.531) (-2065.162) (-2064.381) -- 0:00:48 259000 -- [-2064.380] (-2067.533) (-2065.918) (-2065.732) * [-2068.246] (-2065.006) (-2065.895) (-2063.833) -- 0:00:48 259500 -- (-2064.500) (-2064.481) (-2067.908) [-2065.893] * (-2067.006) [-2063.681] (-2069.159) (-2064.511) -- 0:00:48 260000 -- (-2064.659) (-2064.104) [-2064.211] (-2065.352) * [-2070.685] (-2063.714) (-2064.198) (-2064.399) -- 0:00:48 Average standard deviation of split frequencies: 0.022082 260500 -- [-2064.056] (-2064.137) (-2066.945) (-2065.004) * (-2068.845) [-2064.744] (-2065.036) (-2069.766) -- 0:00:48 261000 -- [-2063.665] (-2063.889) (-2065.695) (-2064.227) * (-2067.023) (-2065.042) [-2066.565] (-2069.791) -- 0:00:48 261500 -- (-2063.667) (-2064.630) (-2065.695) [-2064.200] * (-2067.285) [-2064.567] (-2066.590) (-2068.833) -- 0:00:48 262000 -- [-2063.269] (-2064.519) (-2065.777) (-2064.928) * (-2066.463) (-2064.737) (-2066.564) [-2068.086] -- 0:00:50 262500 -- (-2063.362) [-2063.268] (-2063.316) (-2064.877) * (-2067.910) (-2064.690) (-2066.004) [-2066.088] -- 0:00:50 263000 -- [-2063.933] (-2064.220) (-2064.570) (-2066.020) * [-2070.100] (-2064.208) (-2067.625) (-2065.549) -- 0:00:50 263500 -- (-2063.507) (-2064.409) (-2065.303) [-2066.202] * [-2067.342] (-2064.550) (-2065.535) (-2064.491) -- 0:00:50 264000 -- [-2063.109] (-2069.150) (-2065.326) (-2064.843) * [-2064.917] (-2068.799) (-2067.947) (-2064.779) -- 0:00:50 264500 -- (-2063.683) (-2067.382) [-2063.522] (-2064.111) * (-2064.464) (-2064.535) [-2063.845] (-2065.607) -- 0:00:50 265000 -- (-2064.790) [-2064.217] (-2065.229) (-2064.347) * (-2064.575) (-2066.350) [-2065.847] (-2068.438) -- 0:00:49 Average standard deviation of split frequencies: 0.021887 265500 -- [-2066.962] (-2067.930) (-2065.612) (-2064.119) * (-2064.781) [-2066.265] (-2067.685) (-2064.781) -- 0:00:49 266000 -- (-2067.727) (-2067.974) [-2064.581] (-2068.084) * (-2064.930) [-2066.265] (-2065.368) (-2065.024) -- 0:00:49 266500 -- (-2065.325) [-2065.281] (-2065.397) (-2065.941) * (-2067.716) (-2066.847) (-2070.248) [-2064.853] -- 0:00:49 267000 -- (-2066.889) [-2068.084] (-2066.718) (-2066.357) * (-2067.452) (-2067.072) [-2065.321] (-2064.958) -- 0:00:49 267500 -- (-2064.504) (-2069.394) (-2066.844) [-2066.851] * [-2064.672] (-2066.813) (-2066.374) (-2064.459) -- 0:00:49 268000 -- [-2064.497] (-2065.971) (-2066.741) (-2066.061) * (-2065.842) [-2068.892] (-2069.130) (-2064.082) -- 0:00:49 268500 -- (-2065.189) (-2066.184) (-2063.964) [-2064.820] * (-2064.178) (-2070.272) (-2065.597) [-2064.082] -- 0:00:49 269000 -- (-2065.141) (-2065.754) (-2066.984) [-2064.862] * (-2066.175) (-2064.747) (-2068.698) [-2066.860] -- 0:00:48 269500 -- [-2064.561] (-2064.277) (-2066.738) (-2065.347) * (-2065.048) [-2063.687] (-2067.321) (-2066.240) -- 0:00:48 270000 -- (-2066.448) (-2064.484) (-2069.812) [-2065.810] * (-2065.816) (-2063.358) (-2067.365) [-2065.210] -- 0:00:48 Average standard deviation of split frequencies: 0.023741 270500 -- (-2069.056) [-2069.248] (-2067.239) (-2066.864) * (-2069.649) (-2065.296) (-2066.962) [-2067.596] -- 0:00:48 271000 -- (-2067.763) (-2068.973) (-2066.205) [-2065.686] * (-2066.600) (-2067.110) (-2068.156) [-2065.222] -- 0:00:48 271500 -- [-2066.392] (-2064.555) (-2067.730) (-2066.565) * [-2065.440] (-2069.152) (-2065.720) (-2071.350) -- 0:00:48 272000 -- (-2068.635) (-2067.335) [-2064.405] (-2064.790) * (-2065.333) (-2070.354) [-2066.342] (-2066.340) -- 0:00:48 272500 -- (-2065.775) (-2066.165) [-2065.145] (-2064.938) * (-2064.154) [-2066.320] (-2066.702) (-2069.132) -- 0:00:48 273000 -- (-2067.954) (-2066.527) [-2067.194] (-2069.163) * (-2064.038) (-2066.714) [-2067.118] (-2068.270) -- 0:00:47 273500 -- (-2066.476) [-2066.026] (-2065.795) (-2067.032) * (-2065.100) [-2067.595] (-2068.417) (-2074.327) -- 0:00:47 274000 -- (-2064.330) (-2067.728) [-2064.892] (-2064.774) * [-2065.153] (-2064.087) (-2066.685) (-2076.608) -- 0:00:47 274500 -- (-2067.292) (-2067.044) (-2065.736) [-2068.344] * [-2063.303] (-2064.201) (-2065.329) (-2063.993) -- 0:00:47 275000 -- (-2070.136) [-2063.574] (-2064.977) (-2069.159) * (-2071.116) (-2064.098) (-2063.878) [-2063.993] -- 0:00:47 Average standard deviation of split frequencies: 0.022923 275500 -- (-2064.077) (-2065.075) [-2065.610] (-2064.671) * (-2065.829) (-2065.920) (-2065.803) [-2063.560] -- 0:00:47 276000 -- (-2063.426) [-2063.598] (-2073.249) (-2066.197) * (-2063.962) (-2065.576) (-2064.746) [-2063.478] -- 0:00:47 276500 -- (-2064.819) (-2063.075) (-2065.751) [-2066.792] * (-2064.354) (-2065.386) (-2064.062) [-2066.212] -- 0:00:47 277000 -- [-2065.302] (-2065.452) (-2066.168) (-2066.320) * [-2065.414] (-2065.524) (-2063.982) (-2068.738) -- 0:00:46 277500 -- [-2063.141] (-2065.464) (-2069.506) (-2064.160) * [-2065.412] (-2068.702) (-2063.982) (-2065.009) -- 0:00:49 278000 -- [-2063.493] (-2065.547) (-2070.107) (-2064.302) * (-2067.967) (-2066.738) (-2063.751) [-2065.183] -- 0:00:49 278500 -- (-2064.623) [-2065.938] (-2069.053) (-2066.918) * [-2066.589] (-2065.956) (-2066.371) (-2065.569) -- 0:00:49 279000 -- (-2065.315) (-2064.334) [-2066.582] (-2066.520) * (-2066.547) (-2066.213) (-2064.645) [-2066.384] -- 0:00:49 279500 -- (-2065.097) [-2066.131] (-2064.224) (-2066.093) * (-2066.089) (-2067.596) [-2065.889] (-2067.270) -- 0:00:48 280000 -- (-2065.618) (-2070.868) [-2064.702] (-2073.000) * (-2068.484) [-2066.568] (-2065.457) (-2068.070) -- 0:00:48 Average standard deviation of split frequencies: 0.022807 280500 -- (-2063.257) [-2064.260] (-2066.941) (-2067.324) * [-2069.206] (-2063.750) (-2066.084) (-2070.192) -- 0:00:48 281000 -- (-2068.007) (-2067.003) (-2064.319) [-2065.284] * [-2066.474] (-2064.994) (-2064.590) (-2071.082) -- 0:00:48 281500 -- (-2064.744) (-2073.680) (-2064.737) [-2066.980] * [-2066.283] (-2065.415) (-2063.915) (-2069.177) -- 0:00:48 282000 -- (-2065.688) [-2069.288] (-2064.163) (-2065.607) * (-2069.428) (-2070.934) [-2063.724] (-2063.536) -- 0:00:48 282500 -- (-2068.022) (-2069.262) (-2064.773) [-2063.857] * (-2068.218) (-2065.805) (-2065.611) [-2063.377] -- 0:00:48 283000 -- (-2064.412) (-2063.887) [-2064.525] (-2066.441) * (-2064.871) (-2065.079) [-2064.883] (-2063.408) -- 0:00:48 283500 -- (-2069.850) (-2063.946) [-2064.539] (-2063.878) * (-2065.177) (-2067.229) (-2067.486) [-2063.959] -- 0:00:48 284000 -- (-2066.247) (-2064.145) [-2065.259] (-2064.425) * [-2064.613] (-2065.022) (-2063.615) (-2064.363) -- 0:00:47 284500 -- (-2066.341) (-2065.515) [-2064.358] (-2064.481) * (-2064.288) (-2065.024) [-2072.512] (-2063.461) -- 0:00:47 285000 -- (-2067.405) (-2065.506) [-2064.794] (-2064.960) * [-2064.017] (-2066.247) (-2068.860) (-2063.450) -- 0:00:47 Average standard deviation of split frequencies: 0.022989 285500 -- [-2066.216] (-2068.633) (-2066.315) (-2067.479) * (-2067.996) (-2065.521) (-2063.958) [-2063.787] -- 0:00:47 286000 -- (-2064.305) [-2067.633] (-2065.066) (-2067.412) * (-2066.532) (-2066.331) (-2063.874) [-2064.694] -- 0:00:47 286500 -- (-2063.680) (-2066.391) [-2069.130] (-2064.805) * [-2067.697] (-2068.018) (-2065.175) (-2064.405) -- 0:00:47 287000 -- [-2068.382] (-2066.194) (-2069.446) (-2064.832) * (-2065.996) (-2064.419) (-2066.214) [-2064.657] -- 0:00:47 287500 -- [-2063.187] (-2065.171) (-2067.288) (-2066.014) * (-2064.103) [-2065.791] (-2065.962) (-2064.288) -- 0:00:47 288000 -- (-2063.751) (-2063.986) (-2064.373) [-2064.278] * (-2064.949) (-2064.412) (-2064.009) [-2063.848] -- 0:00:46 288500 -- (-2064.146) [-2066.095] (-2063.819) (-2066.616) * [-2064.329] (-2065.630) (-2065.673) (-2063.930) -- 0:00:46 289000 -- [-2064.187] (-2063.900) (-2063.961) (-2066.723) * (-2065.393) (-2064.014) [-2066.857] (-2067.141) -- 0:00:46 289500 -- (-2068.315) (-2063.747) [-2068.603] (-2067.533) * [-2064.357] (-2064.521) (-2066.677) (-2069.327) -- 0:00:46 290000 -- [-2068.409] (-2066.335) (-2068.606) (-2063.972) * (-2065.533) [-2064.603] (-2065.089) (-2063.623) -- 0:00:46 Average standard deviation of split frequencies: 0.023132 290500 -- (-2066.992) [-2064.953] (-2065.913) (-2064.621) * (-2064.427) (-2064.413) (-2065.410) [-2063.957] -- 0:00:46 291000 -- (-2064.126) (-2065.629) (-2064.647) [-2065.801] * [-2064.663] (-2065.781) (-2065.931) (-2065.849) -- 0:00:46 291500 -- (-2069.478) (-2066.026) (-2064.558) [-2064.117] * [-2069.958] (-2064.552) (-2065.867) (-2064.996) -- 0:00:46 292000 -- (-2067.952) [-2067.141] (-2064.827) (-2064.905) * (-2066.035) (-2064.694) (-2068.315) [-2066.156] -- 0:00:46 292500 -- (-2068.357) (-2066.449) (-2067.422) [-2064.919] * (-2066.866) (-2066.642) (-2065.262) [-2063.225] -- 0:00:45 293000 -- (-2067.806) [-2065.748] (-2068.729) (-2063.313) * (-2065.645) [-2066.756] (-2065.325) (-2064.055) -- 0:00:48 293500 -- (-2067.698) [-2066.532] (-2065.266) (-2062.987) * (-2064.361) [-2065.545] (-2065.569) (-2066.979) -- 0:00:48 294000 -- (-2065.333) (-2065.616) [-2065.236] (-2064.861) * (-2064.553) (-2065.232) (-2065.977) [-2065.741] -- 0:00:48 294500 -- (-2066.282) (-2066.977) (-2071.253) [-2063.785] * (-2064.030) (-2067.273) (-2064.000) [-2067.377] -- 0:00:47 295000 -- (-2068.421) (-2066.891) [-2066.834] (-2063.803) * (-2064.757) (-2068.487) (-2063.998) [-2067.414] -- 0:00:47 Average standard deviation of split frequencies: 0.021374 295500 -- (-2068.589) (-2064.377) (-2067.118) [-2068.919] * (-2068.449) (-2066.826) (-2064.275) [-2068.079] -- 0:00:47 296000 -- (-2066.760) (-2064.164) [-2064.275] (-2068.496) * (-2066.656) (-2066.091) [-2063.684] (-2067.691) -- 0:00:47 296500 -- [-2065.219] (-2064.881) (-2065.570) (-2065.666) * (-2065.632) (-2067.776) (-2063.684) [-2065.560] -- 0:00:47 297000 -- (-2066.329) (-2063.876) [-2064.005] (-2064.100) * [-2069.172] (-2066.635) (-2067.968) (-2065.069) -- 0:00:47 297500 -- [-2064.371] (-2064.320) (-2067.817) (-2063.890) * [-2064.383] (-2067.354) (-2066.675) (-2066.847) -- 0:00:47 298000 -- [-2066.147] (-2064.499) (-2067.624) (-2063.773) * (-2065.959) (-2065.445) [-2065.679] (-2068.112) -- 0:00:47 298500 -- (-2064.602) [-2064.148] (-2066.779) (-2068.685) * (-2066.353) (-2064.339) (-2064.273) [-2064.532] -- 0:00:47 299000 -- (-2064.631) (-2066.011) [-2066.004] (-2063.973) * (-2066.192) [-2065.600] (-2065.065) (-2063.857) -- 0:00:46 299500 -- (-2065.985) (-2069.900) (-2065.970) [-2063.335] * (-2070.065) (-2063.567) [-2063.442] (-2063.872) -- 0:00:46 300000 -- (-2064.077) (-2066.253) [-2064.642] (-2065.753) * [-2063.109] (-2063.491) (-2064.816) (-2066.236) -- 0:00:46 Average standard deviation of split frequencies: 0.019887 300500 -- (-2066.722) (-2066.324) [-2065.878] (-2066.508) * (-2063.162) (-2063.195) [-2063.278] (-2066.369) -- 0:00:46 301000 -- [-2064.798] (-2066.131) (-2066.625) (-2067.331) * [-2063.619] (-2064.556) (-2063.436) (-2064.946) -- 0:00:46 301500 -- [-2064.962] (-2068.957) (-2066.601) (-2064.196) * [-2063.176] (-2064.539) (-2067.846) (-2064.367) -- 0:00:46 302000 -- (-2065.849) [-2067.238] (-2066.579) (-2064.288) * (-2063.166) (-2064.308) (-2066.992) [-2063.551] -- 0:00:46 302500 -- (-2065.022) [-2063.211] (-2067.235) (-2066.523) * (-2063.172) [-2064.455] (-2068.869) (-2071.104) -- 0:00:46 303000 -- [-2065.360] (-2063.224) (-2067.010) (-2066.005) * [-2064.158] (-2067.718) (-2066.941) (-2067.388) -- 0:00:46 303500 -- (-2064.772) (-2063.180) (-2065.716) [-2065.225] * (-2066.168) (-2066.093) [-2066.846] (-2064.378) -- 0:00:45 304000 -- (-2065.999) [-2063.637] (-2066.134) (-2065.127) * (-2066.444) (-2067.520) [-2064.313] (-2064.483) -- 0:00:45 304500 -- (-2064.845) (-2064.866) [-2067.850] (-2065.292) * (-2066.352) [-2070.228] (-2066.908) (-2063.872) -- 0:00:45 305000 -- (-2064.370) (-2064.579) (-2066.523) [-2066.103] * (-2068.942) (-2065.143) [-2063.715] (-2064.311) -- 0:00:45 Average standard deviation of split frequencies: 0.019054 305500 -- (-2064.259) [-2064.462] (-2066.739) (-2063.496) * (-2064.171) (-2065.139) (-2064.050) [-2064.125] -- 0:00:45 306000 -- [-2065.278] (-2069.870) (-2068.911) (-2064.459) * (-2063.102) (-2064.956) (-2066.769) [-2063.367] -- 0:00:45 306500 -- [-2065.893] (-2063.141) (-2065.185) (-2064.374) * (-2064.285) [-2065.872] (-2067.580) (-2064.842) -- 0:00:45 307000 -- [-2065.074] (-2065.791) (-2065.900) (-2063.776) * (-2064.561) [-2064.770] (-2066.909) (-2063.979) -- 0:00:45 307500 -- (-2065.730) [-2069.775] (-2063.196) (-2064.387) * (-2066.091) (-2064.488) (-2067.701) [-2063.969] -- 0:00:45 308000 -- (-2065.248) [-2065.563] (-2063.723) (-2064.002) * (-2065.478) (-2064.018) (-2066.305) [-2066.697] -- 0:00:47 308500 -- (-2066.214) (-2065.656) [-2064.945] (-2065.815) * [-2066.701] (-2067.947) (-2066.011) (-2065.669) -- 0:00:47 309000 -- [-2065.232] (-2069.332) (-2065.431) (-2064.211) * (-2063.461) [-2064.472] (-2064.377) (-2065.417) -- 0:00:46 309500 -- (-2064.624) [-2067.607] (-2064.627) (-2067.971) * (-2063.367) (-2065.461) [-2064.308] (-2064.531) -- 0:00:46 310000 -- (-2064.581) [-2068.472] (-2065.569) (-2066.639) * (-2064.992) (-2069.056) [-2063.413] (-2063.978) -- 0:00:46 Average standard deviation of split frequencies: 0.019806 310500 -- (-2069.413) (-2064.551) (-2068.106) [-2064.576] * [-2066.366] (-2065.220) (-2065.007) (-2064.484) -- 0:00:46 311000 -- (-2065.575) (-2065.506) (-2065.304) [-2064.065] * [-2066.806] (-2064.467) (-2064.824) (-2065.739) -- 0:00:46 311500 -- [-2064.096] (-2066.875) (-2064.924) (-2066.194) * (-2068.841) (-2064.134) [-2067.167] (-2066.104) -- 0:00:46 312000 -- (-2065.438) (-2066.875) (-2066.172) [-2067.731] * [-2065.225] (-2073.624) (-2064.319) (-2066.085) -- 0:00:46 312500 -- (-2064.504) (-2066.870) (-2066.184) [-2064.966] * (-2066.864) (-2070.964) (-2065.844) [-2066.060] -- 0:00:46 313000 -- (-2062.894) (-2067.185) [-2066.191] (-2068.446) * (-2066.825) (-2068.241) (-2065.408) [-2069.665] -- 0:00:46 313500 -- [-2063.765] (-2064.524) (-2065.118) (-2064.131) * (-2065.322) (-2068.027) [-2066.760] (-2070.889) -- 0:00:45 314000 -- (-2064.202) (-2063.877) [-2065.159] (-2063.733) * [-2064.385] (-2065.882) (-2063.862) (-2069.163) -- 0:00:45 314500 -- (-2066.475) [-2067.187] (-2064.320) (-2063.841) * [-2063.899] (-2065.573) (-2068.420) (-2066.338) -- 0:00:45 315000 -- (-2062.868) (-2065.409) [-2066.157] (-2063.619) * [-2063.859] (-2066.198) (-2066.923) (-2066.854) -- 0:00:45 Average standard deviation of split frequencies: 0.019472 315500 -- [-2062.868] (-2065.187) (-2066.074) (-2063.185) * (-2065.185) [-2064.097] (-2064.167) (-2063.449) -- 0:00:45 316000 -- (-2065.290) (-2069.077) (-2069.439) [-2065.130] * [-2068.104] (-2063.481) (-2064.524) (-2063.492) -- 0:00:45 316500 -- [-2065.441] (-2064.452) (-2066.574) (-2063.241) * (-2067.266) (-2063.481) (-2064.563) [-2063.456] -- 0:00:45 317000 -- (-2065.094) (-2065.957) [-2067.515] (-2063.635) * [-2066.165] (-2064.483) (-2063.794) (-2065.412) -- 0:00:45 317500 -- (-2063.293) (-2072.741) (-2068.402) [-2063.529] * (-2064.032) [-2065.280] (-2064.905) (-2065.578) -- 0:00:45 318000 -- (-2064.973) (-2073.734) [-2067.622] (-2069.986) * (-2064.887) (-2064.184) [-2064.971] (-2065.732) -- 0:00:45 318500 -- (-2064.755) (-2070.169) (-2064.433) [-2066.641] * (-2068.284) (-2068.766) [-2064.314] (-2067.142) -- 0:00:44 319000 -- (-2064.355) (-2065.203) [-2064.520] (-2067.712) * (-2064.018) (-2067.183) [-2067.706] (-2068.264) -- 0:00:44 319500 -- [-2065.659] (-2068.009) (-2067.795) (-2063.938) * (-2067.828) (-2070.798) [-2066.681] (-2067.127) -- 0:00:44 320000 -- (-2064.283) [-2068.466] (-2064.814) (-2066.457) * (-2064.936) (-2067.256) (-2063.205) [-2065.051] -- 0:00:44 Average standard deviation of split frequencies: 0.020349 320500 -- (-2064.367) (-2066.793) [-2063.291] (-2065.725) * [-2066.008] (-2065.308) (-2064.484) (-2065.505) -- 0:00:44 321000 -- (-2068.243) [-2067.763] (-2063.809) (-2063.765) * (-2064.666) (-2065.073) [-2063.513] (-2064.083) -- 0:00:44 321500 -- (-2065.987) (-2067.623) [-2064.076] (-2064.958) * (-2064.780) [-2065.878] (-2063.416) (-2064.331) -- 0:00:44 322000 -- (-2066.800) [-2065.187] (-2064.866) (-2063.578) * (-2064.236) (-2063.266) [-2064.189] (-2066.691) -- 0:00:44 322500 -- (-2063.310) (-2064.460) (-2064.779) [-2067.131] * (-2064.814) (-2063.931) (-2063.201) [-2066.119] -- 0:00:44 323000 -- [-2063.310] (-2065.087) (-2066.216) (-2069.041) * [-2064.816] (-2063.973) (-2063.066) (-2064.362) -- 0:00:46 323500 -- [-2065.233] (-2065.091) (-2066.279) (-2068.358) * (-2064.497) [-2064.031] (-2068.307) (-2064.236) -- 0:00:46 324000 -- (-2065.573) (-2064.151) (-2067.985) [-2065.280] * (-2065.970) (-2064.552) [-2067.613] (-2064.236) -- 0:00:45 324500 -- (-2068.752) (-2068.617) (-2065.475) [-2063.831] * (-2065.612) (-2068.889) (-2067.436) [-2065.323] -- 0:00:45 325000 -- (-2067.315) (-2065.229) (-2063.610) [-2063.852] * (-2064.149) (-2066.725) [-2064.299] (-2063.867) -- 0:00:45 Average standard deviation of split frequencies: 0.021310 325500 -- (-2069.333) [-2065.312] (-2063.172) (-2065.264) * (-2064.086) (-2065.123) [-2063.088] (-2067.859) -- 0:00:45 326000 -- [-2066.158] (-2064.187) (-2063.172) (-2066.781) * [-2064.129] (-2066.859) (-2063.529) (-2067.721) -- 0:00:45 326500 -- [-2064.929] (-2064.109) (-2063.436) (-2066.292) * (-2066.254) (-2069.709) [-2064.690] (-2064.338) -- 0:00:45 327000 -- (-2065.195) (-2065.416) [-2064.634] (-2068.670) * (-2065.943) (-2064.281) [-2064.565] (-2066.826) -- 0:00:45 327500 -- (-2064.809) (-2064.701) [-2066.574] (-2064.689) * [-2064.326] (-2064.253) (-2065.028) (-2063.742) -- 0:00:45 328000 -- [-2064.134] (-2063.897) (-2065.793) (-2065.564) * (-2064.637) (-2065.151) [-2064.290] (-2063.713) -- 0:00:45 328500 -- (-2068.392) (-2064.569) [-2063.743] (-2064.762) * (-2067.402) (-2064.510) (-2063.720) [-2065.171] -- 0:00:44 329000 -- [-2065.993] (-2064.902) (-2064.938) (-2064.581) * (-2066.637) [-2063.501] (-2063.967) (-2065.905) -- 0:00:44 329500 -- (-2065.470) [-2066.114] (-2063.891) (-2064.071) * (-2066.296) (-2063.588) (-2068.908) [-2065.989] -- 0:00:44 330000 -- [-2065.533] (-2070.063) (-2066.085) (-2064.475) * (-2065.288) (-2064.240) (-2064.145) [-2064.816] -- 0:00:44 Average standard deviation of split frequencies: 0.020934 330500 -- (-2065.546) (-2065.307) [-2063.999] (-2067.754) * (-2065.060) (-2064.080) (-2067.039) [-2063.604] -- 0:00:44 331000 -- [-2063.695] (-2080.348) (-2069.107) (-2065.382) * [-2065.610] (-2064.804) (-2067.965) (-2069.432) -- 0:00:44 331500 -- [-2063.222] (-2067.758) (-2063.940) (-2068.709) * (-2065.672) (-2063.835) (-2064.243) [-2065.210] -- 0:00:44 332000 -- [-2064.123] (-2070.254) (-2064.227) (-2065.023) * [-2065.094] (-2066.148) (-2065.914) (-2064.746) -- 0:00:44 332500 -- [-2066.701] (-2067.900) (-2063.560) (-2064.376) * (-2065.444) (-2065.110) [-2063.320] (-2063.726) -- 0:00:44 333000 -- (-2066.255) (-2063.189) (-2065.763) [-2065.688] * (-2065.692) (-2072.092) [-2064.704] (-2062.855) -- 0:00:44 333500 -- (-2065.700) [-2063.489] (-2065.157) (-2069.367) * (-2066.628) [-2065.719] (-2068.889) (-2067.251) -- 0:00:43 334000 -- (-2069.821) (-2063.531) (-2064.838) [-2063.833] * (-2064.834) (-2066.233) (-2066.014) [-2065.414] -- 0:00:43 334500 -- [-2064.452] (-2063.531) (-2063.855) (-2064.644) * (-2066.496) (-2066.703) [-2070.657] (-2065.356) -- 0:00:43 335000 -- (-2064.636) (-2063.911) (-2065.752) [-2064.094] * (-2067.502) (-2069.732) (-2064.416) [-2064.100] -- 0:00:43 Average standard deviation of split frequencies: 0.020380 335500 -- (-2066.609) (-2063.948) (-2065.466) [-2064.478] * (-2065.598) (-2064.539) (-2065.191) [-2064.100] -- 0:00:43 336000 -- (-2068.685) (-2063.962) [-2063.533] (-2064.443) * (-2067.438) (-2067.531) [-2064.396] (-2065.315) -- 0:00:43 336500 -- (-2070.068) (-2066.832) (-2063.679) [-2064.812] * (-2065.635) [-2065.269] (-2064.273) (-2065.660) -- 0:00:43 337000 -- (-2064.790) (-2064.090) (-2065.966) [-2063.479] * (-2063.604) (-2065.188) [-2064.525] (-2064.432) -- 0:00:43 337500 -- (-2064.084) (-2065.706) [-2063.780] (-2063.575) * [-2064.714] (-2063.983) (-2064.663) (-2064.015) -- 0:00:43 338000 -- [-2063.774] (-2064.912) (-2065.799) (-2066.974) * (-2064.012) (-2063.696) (-2064.917) [-2066.272] -- 0:00:43 338500 -- [-2066.726] (-2063.324) (-2065.186) (-2069.068) * [-2063.952] (-2065.324) (-2064.394) (-2065.645) -- 0:00:44 339000 -- (-2066.505) [-2063.692] (-2064.141) (-2067.988) * (-2066.534) [-2071.137] (-2065.028) (-2066.541) -- 0:00:44 339500 -- (-2069.806) (-2065.108) (-2064.269) [-2067.254] * (-2066.112) (-2070.942) (-2065.022) [-2066.148] -- 0:00:44 340000 -- (-2064.705) (-2067.751) (-2065.390) [-2065.419] * (-2063.167) [-2064.909] (-2065.234) (-2067.367) -- 0:00:44 Average standard deviation of split frequencies: 0.020611 340500 -- (-2063.723) (-2067.815) (-2063.828) [-2068.282] * (-2064.840) [-2063.815] (-2064.909) (-2065.885) -- 0:00:44 341000 -- (-2064.438) (-2064.801) [-2065.439] (-2066.670) * (-2064.856) (-2067.339) (-2064.648) [-2066.036] -- 0:00:44 341500 -- [-2063.816] (-2064.880) (-2063.767) (-2066.998) * (-2064.845) (-2068.370) [-2063.687] (-2067.383) -- 0:00:44 342000 -- (-2065.066) [-2064.954] (-2066.376) (-2070.059) * (-2065.014) [-2065.937] (-2069.058) (-2064.690) -- 0:00:44 342500 -- (-2063.520) (-2065.657) (-2069.427) [-2064.467] * (-2065.533) [-2066.207] (-2068.148) (-2066.880) -- 0:00:44 343000 -- (-2065.241) (-2065.398) [-2066.017] (-2064.191) * (-2064.200) (-2066.573) (-2064.502) [-2064.444] -- 0:00:44 343500 -- (-2066.475) [-2064.965] (-2064.306) (-2064.746) * (-2067.227) (-2065.104) [-2065.658] (-2064.306) -- 0:00:43 344000 -- (-2063.686) [-2065.295] (-2067.256) (-2063.662) * (-2069.421) [-2064.534] (-2064.119) (-2063.978) -- 0:00:43 344500 -- (-2065.767) (-2063.746) (-2067.268) [-2064.043] * [-2064.418] (-2064.535) (-2065.389) (-2063.949) -- 0:00:43 345000 -- (-2065.843) (-2065.217) [-2067.617] (-2067.785) * [-2065.509] (-2063.657) (-2066.094) (-2064.159) -- 0:00:43 Average standard deviation of split frequencies: 0.020221 345500 -- [-2065.788] (-2066.681) (-2063.053) (-2065.482) * (-2064.386) [-2065.461] (-2065.582) (-2066.145) -- 0:00:43 346000 -- (-2066.510) (-2066.015) [-2064.375] (-2066.902) * (-2064.870) [-2063.548] (-2064.664) (-2066.044) -- 0:00:43 346500 -- [-2066.510] (-2065.335) (-2064.836) (-2065.266) * (-2064.858) (-2063.751) [-2067.966] (-2064.901) -- 0:00:43 347000 -- (-2063.722) (-2065.467) (-2065.141) [-2063.512] * (-2064.280) (-2065.948) [-2069.260] (-2067.685) -- 0:00:43 347500 -- (-2063.691) (-2065.612) [-2064.771] (-2063.882) * (-2064.394) [-2065.152] (-2064.683) (-2065.803) -- 0:00:43 348000 -- (-2064.607) (-2069.355) (-2064.376) [-2066.540] * (-2069.403) (-2065.408) [-2063.236] (-2068.106) -- 0:00:43 348500 -- (-2065.506) (-2068.787) [-2064.258] (-2064.456) * [-2065.209] (-2067.042) (-2063.236) (-2067.880) -- 0:00:42 349000 -- (-2067.855) (-2067.174) [-2066.597] (-2064.553) * [-2063.999] (-2067.285) (-2063.535) (-2067.702) -- 0:00:42 349500 -- [-2064.767] (-2066.949) (-2067.312) (-2066.280) * (-2064.581) (-2063.252) (-2064.025) [-2064.840] -- 0:00:42 350000 -- [-2065.415] (-2067.293) (-2067.786) (-2065.804) * (-2064.888) (-2066.090) [-2064.179] (-2064.839) -- 0:00:42 Average standard deviation of split frequencies: 0.019599 350500 -- (-2063.743) (-2063.489) [-2065.664] (-2064.972) * (-2063.972) (-2065.965) (-2065.241) [-2067.493] -- 0:00:42 351000 -- (-2064.208) (-2064.411) [-2064.762] (-2063.405) * [-2064.749] (-2063.461) (-2065.248) (-2066.485) -- 0:00:42 351500 -- [-2064.020] (-2064.802) (-2063.798) (-2063.433) * [-2064.257] (-2067.384) (-2064.473) (-2065.960) -- 0:00:42 352000 -- [-2063.792] (-2066.948) (-2063.500) (-2064.638) * (-2064.353) (-2066.169) [-2063.131] (-2068.475) -- 0:00:42 352500 -- [-2067.046] (-2063.334) (-2064.157) (-2067.714) * (-2065.526) (-2065.403) [-2063.021] (-2069.327) -- 0:00:42 353000 -- (-2066.736) (-2063.408) [-2064.438] (-2068.048) * (-2067.726) (-2065.754) [-2063.682] (-2067.577) -- 0:00:42 353500 -- (-2073.709) [-2065.219] (-2064.606) (-2063.506) * (-2072.348) (-2065.248) [-2066.403] (-2064.202) -- 0:00:42 354000 -- [-2067.352] (-2066.139) (-2063.828) (-2063.065) * (-2071.237) (-2064.007) (-2069.554) [-2064.767] -- 0:00:43 354500 -- (-2063.610) (-2064.751) [-2065.171] (-2063.930) * (-2068.214) (-2063.326) (-2068.613) [-2064.265] -- 0:00:43 355000 -- [-2067.992] (-2063.805) (-2063.808) (-2066.843) * (-2064.016) (-2063.342) (-2069.789) [-2065.036] -- 0:00:43 Average standard deviation of split frequencies: 0.019444 355500 -- [-2067.579] (-2066.443) (-2065.532) (-2069.966) * [-2063.248] (-2063.341) (-2074.375) (-2063.871) -- 0:00:43 356000 -- (-2064.435) (-2066.884) [-2064.403] (-2068.843) * (-2063.048) [-2065.340] (-2072.291) (-2066.971) -- 0:00:43 356500 -- (-2064.608) [-2065.108] (-2066.281) (-2066.356) * [-2066.986] (-2065.243) (-2067.141) (-2065.946) -- 0:00:43 357000 -- (-2064.470) (-2067.243) (-2068.371) [-2065.108] * (-2066.085) (-2064.888) [-2066.349] (-2064.883) -- 0:00:43 357500 -- (-2065.607) (-2065.362) (-2066.018) [-2064.415] * (-2068.402) [-2064.541] (-2064.349) (-2064.599) -- 0:00:43 358000 -- (-2066.539) (-2064.702) [-2068.492] (-2065.599) * [-2063.451] (-2064.678) (-2063.827) (-2064.292) -- 0:00:43 358500 -- (-2066.277) [-2063.174] (-2068.914) (-2065.771) * (-2064.258) [-2063.682] (-2064.929) (-2063.777) -- 0:00:42 359000 -- [-2064.788] (-2063.824) (-2069.669) (-2063.913) * (-2068.666) (-2064.072) (-2067.894) [-2064.524] -- 0:00:42 359500 -- (-2067.166) (-2065.561) (-2067.490) [-2067.371] * [-2067.670] (-2065.408) (-2069.107) (-2068.897) -- 0:00:42 360000 -- (-2069.349) [-2063.579] (-2068.039) (-2065.595) * (-2064.352) [-2064.060] (-2070.718) (-2069.470) -- 0:00:42 Average standard deviation of split frequencies: 0.018986 360500 -- (-2065.018) [-2064.849] (-2065.185) (-2067.258) * [-2064.372] (-2064.731) (-2066.356) (-2066.275) -- 0:00:42 361000 -- (-2064.462) (-2067.912) (-2064.765) [-2065.433] * (-2064.487) [-2065.108] (-2065.653) (-2065.165) -- 0:00:42 361500 -- (-2063.265) (-2065.516) [-2068.206] (-2063.698) * (-2067.030) (-2066.068) (-2066.195) [-2065.663] -- 0:00:42 362000 -- (-2064.056) [-2063.843] (-2065.994) (-2067.884) * (-2069.190) [-2065.206] (-2069.027) (-2066.372) -- 0:00:42 362500 -- [-2063.130] (-2063.657) (-2067.880) (-2064.302) * (-2067.203) (-2070.357) (-2068.344) [-2064.321] -- 0:00:42 363000 -- (-2063.185) (-2063.657) (-2066.224) [-2065.401] * [-2064.803] (-2071.710) (-2067.587) (-2064.121) -- 0:00:42 363500 -- (-2063.104) (-2064.928) [-2065.749] (-2065.042) * (-2066.524) (-2066.989) (-2064.616) [-2064.236] -- 0:00:42 364000 -- [-2063.999] (-2063.833) (-2066.378) (-2063.226) * (-2065.015) [-2066.736] (-2067.326) (-2071.614) -- 0:00:41 364500 -- (-2064.875) (-2063.965) (-2064.846) [-2063.430] * [-2065.186] (-2066.591) (-2065.763) (-2071.385) -- 0:00:41 365000 -- (-2065.096) [-2064.370] (-2068.536) (-2064.056) * (-2063.065) (-2064.204) [-2065.868] (-2063.259) -- 0:00:41 Average standard deviation of split frequencies: 0.019388 365500 -- (-2063.938) [-2065.273] (-2067.167) (-2064.515) * [-2063.177] (-2064.151) (-2064.947) (-2063.369) -- 0:00:41 366000 -- (-2069.732) [-2063.363] (-2064.487) (-2064.491) * (-2067.603) (-2064.823) [-2065.461] (-2066.821) -- 0:00:41 366500 -- (-2064.815) [-2063.694] (-2064.359) (-2063.002) * (-2066.931) (-2066.230) [-2069.150] (-2064.023) -- 0:00:41 367000 -- (-2064.558) (-2063.690) [-2064.065] (-2065.366) * (-2065.524) [-2067.113] (-2069.532) (-2065.222) -- 0:00:41 367500 -- [-2064.749] (-2065.293) (-2065.939) (-2065.050) * [-2067.086] (-2064.047) (-2063.858) (-2066.167) -- 0:00:41 368000 -- (-2064.372) (-2063.992) (-2066.491) [-2067.604] * [-2064.395] (-2065.344) (-2068.817) (-2064.953) -- 0:00:41 368500 -- (-2064.422) [-2065.513] (-2065.820) (-2067.360) * (-2067.679) (-2067.057) (-2065.335) [-2063.746] -- 0:00:41 369000 -- (-2064.396) (-2065.255) (-2064.306) [-2065.145] * (-2068.124) (-2069.379) [-2066.444] (-2065.190) -- 0:00:42 369500 -- (-2063.301) (-2066.882) (-2065.032) [-2065.679] * (-2067.357) (-2067.458) (-2066.216) [-2066.062] -- 0:00:42 370000 -- (-2063.506) (-2066.484) (-2064.857) [-2063.648] * (-2066.939) [-2065.385] (-2064.517) (-2064.785) -- 0:00:42 Average standard deviation of split frequencies: 0.019813 370500 -- (-2064.138) (-2067.948) (-2065.475) [-2064.378] * (-2065.237) [-2064.138] (-2064.766) (-2064.307) -- 0:00:42 371000 -- (-2063.529) [-2064.061] (-2064.568) (-2070.079) * (-2067.186) [-2063.094] (-2065.581) (-2064.498) -- 0:00:42 371500 -- [-2065.866] (-2064.266) (-2069.174) (-2067.272) * (-2064.417) [-2064.738] (-2069.549) (-2065.692) -- 0:00:42 372000 -- (-2065.987) (-2064.696) [-2064.319] (-2065.205) * (-2063.175) (-2063.990) [-2064.875] (-2066.816) -- 0:00:42 372500 -- (-2065.092) [-2064.501] (-2067.762) (-2065.299) * (-2065.040) [-2065.592] (-2063.578) (-2066.302) -- 0:00:42 373000 -- (-2064.145) [-2064.255] (-2064.529) (-2065.185) * (-2065.783) (-2066.411) [-2063.475] (-2067.913) -- 0:00:42 373500 -- (-2064.945) [-2065.645] (-2065.981) (-2064.573) * (-2065.746) (-2067.839) (-2063.769) [-2065.106] -- 0:00:41 374000 -- (-2064.950) (-2065.671) [-2064.334] (-2064.679) * [-2065.799] (-2063.220) (-2065.091) (-2064.255) -- 0:00:41 374500 -- (-2064.950) (-2064.730) [-2065.212] (-2065.202) * (-2066.797) (-2066.164) (-2063.352) [-2063.036] -- 0:00:41 375000 -- (-2066.074) (-2065.189) [-2063.352] (-2065.570) * [-2065.873] (-2064.738) (-2063.421) (-2063.930) -- 0:00:41 Average standard deviation of split frequencies: 0.020126 375500 -- (-2065.943) [-2064.623] (-2064.541) (-2064.909) * (-2067.902) (-2065.685) (-2064.456) [-2063.857] -- 0:00:41 376000 -- [-2065.808] (-2064.721) (-2064.341) (-2063.013) * [-2066.060] (-2064.001) (-2065.360) (-2065.816) -- 0:00:41 376500 -- (-2063.847) (-2063.797) [-2063.623] (-2063.238) * (-2066.123) (-2064.158) (-2065.264) [-2068.396] -- 0:00:41 377000 -- (-2064.696) (-2066.908) [-2066.240] (-2063.120) * (-2067.823) [-2066.364] (-2064.014) (-2066.830) -- 0:00:41 377500 -- (-2069.917) (-2067.205) [-2063.934] (-2063.164) * (-2066.323) (-2066.953) [-2064.687] (-2066.483) -- 0:00:41 378000 -- [-2066.352] (-2066.829) (-2063.499) (-2065.515) * (-2066.918) (-2066.944) (-2065.232) [-2065.053] -- 0:00:41 378500 -- (-2064.109) (-2067.928) (-2063.448) [-2065.832] * (-2062.904) [-2065.222] (-2067.957) (-2064.886) -- 0:00:41 379000 -- [-2064.544] (-2066.177) (-2064.870) (-2069.128) * (-2065.104) (-2066.191) [-2064.527] (-2063.695) -- 0:00:40 379500 -- (-2070.849) [-2066.776] (-2063.709) (-2065.499) * (-2063.678) (-2065.254) [-2063.596] (-2065.147) -- 0:00:40 380000 -- (-2065.591) (-2065.166) (-2064.047) [-2065.430] * (-2066.585) [-2066.157] (-2065.411) (-2067.308) -- 0:00:40 Average standard deviation of split frequencies: 0.018851 380500 -- (-2063.162) [-2064.293] (-2064.070) (-2064.523) * (-2066.746) (-2066.367) (-2064.704) [-2065.080] -- 0:00:40 381000 -- (-2063.717) (-2068.211) [-2068.347] (-2066.555) * (-2069.217) [-2064.627] (-2064.765) (-2066.867) -- 0:00:40 381500 -- (-2064.743) (-2070.290) [-2065.144] (-2065.599) * (-2072.521) (-2069.239) [-2065.813] (-2065.057) -- 0:00:40 382000 -- [-2065.543] (-2072.861) (-2068.199) (-2063.138) * [-2063.585] (-2068.226) (-2067.968) (-2064.451) -- 0:00:40 382500 -- (-2067.781) (-2063.119) [-2069.002] (-2065.269) * (-2067.190) (-2067.495) [-2066.701] (-2065.042) -- 0:00:40 383000 -- (-2066.452) [-2063.820] (-2072.979) (-2065.957) * (-2065.495) (-2067.509) [-2066.909] (-2065.975) -- 0:00:40 383500 -- (-2064.355) [-2065.311] (-2066.258) (-2064.178) * (-2065.700) (-2065.639) (-2069.455) [-2067.329] -- 0:00:40 384000 -- (-2065.083) (-2064.403) (-2063.998) [-2068.584] * (-2070.475) (-2066.258) (-2066.964) [-2067.455] -- 0:00:40 384500 -- (-2064.643) (-2063.715) (-2064.012) [-2063.024] * (-2067.542) (-2064.813) [-2069.651] (-2064.287) -- 0:00:41 385000 -- (-2063.603) (-2064.853) (-2066.967) [-2063.677] * (-2067.399) (-2064.768) [-2065.819] (-2064.484) -- 0:00:41 Average standard deviation of split frequencies: 0.018897 385500 -- (-2065.062) (-2066.988) [-2065.991] (-2063.641) * [-2069.881] (-2063.300) (-2069.122) (-2064.485) -- 0:00:41 386000 -- (-2067.914) [-2064.220] (-2065.536) (-2064.563) * [-2068.676] (-2064.395) (-2070.242) (-2064.419) -- 0:00:41 386500 -- [-2067.486] (-2067.197) (-2067.153) (-2064.260) * [-2068.258] (-2069.123) (-2064.971) (-2063.977) -- 0:00:41 387000 -- (-2070.171) (-2067.198) [-2064.556] (-2064.271) * (-2066.125) (-2066.713) (-2067.415) [-2063.417] -- 0:00:41 387500 -- (-2067.169) (-2065.268) (-2063.373) [-2066.203] * (-2065.861) [-2065.931] (-2066.577) (-2063.670) -- 0:00:41 388000 -- (-2069.120) (-2066.987) (-2063.556) [-2064.324] * (-2066.397) [-2064.973] (-2064.545) (-2063.965) -- 0:00:41 388500 -- (-2066.575) [-2063.749] (-2068.789) (-2067.272) * (-2066.034) [-2063.666] (-2068.215) (-2064.662) -- 0:00:40 389000 -- (-2065.042) [-2063.368] (-2066.093) (-2065.042) * (-2067.051) (-2064.091) (-2068.351) [-2064.471] -- 0:00:40 389500 -- (-2068.847) [-2064.711] (-2065.518) (-2066.981)