--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:53:59 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/hemB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1337.82         -1340.85
2      -1337.74         -1343.11
--------------------------------------
TOTAL    -1337.78         -1342.52
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.898675    0.089367    0.394470    1.507366    0.873659   1277.68   1311.06    1.000
r(A<->C){all}   0.159362    0.019713    0.000021    0.439983    0.121694    281.15    314.89    1.000
r(A<->G){all}   0.171259    0.020892    0.000134    0.465702    0.137255    205.38    217.56    1.000
r(A<->T){all}   0.163068    0.019411    0.000093    0.447594    0.123523    310.57    319.48    1.002
r(C<->G){all}   0.166510    0.019398    0.000179    0.445272    0.132492    208.45    299.22    1.000
r(C<->T){all}   0.160775    0.019591    0.000059    0.440817    0.121363    149.44    151.36    1.000
r(G<->T){all}   0.179026    0.021654    0.000045    0.477434    0.139212    140.91    156.00    1.000
pi(A){all}      0.168466    0.000139    0.145751    0.190881    0.168298   1300.70   1313.14    1.000
pi(C){all}      0.277253    0.000195    0.250349    0.304779    0.277266   1378.31   1400.66    1.000
pi(G){all}      0.336948    0.000221    0.308491    0.366561    0.336798   1154.37   1212.05    1.001
pi(T){all}      0.217332    0.000170    0.191261    0.241249    0.217008   1125.37   1240.44    1.000
alpha{1,2}      0.412667    0.222090    0.000108    1.368793    0.247098   1061.29   1221.76    1.000
alpha{3}        0.459939    0.244160    0.000180    1.441593    0.304881   1028.18   1196.07    1.000
pinvar{all}     0.998457    0.000003    0.995015    0.999999    0.999069   1015.95   1227.40    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1292.646534
Model 2: PositiveSelection	-1292.646534
Model 0: one-ratio	-1292.646763
Model 7: beta	-1292.646534
Model 8: beta&w>1	-1292.646695


Model 0 vs 1	4.5799999998052954E-4

Model 2 vs 1	0.0

Model 8 vs 7	3.219999998691492E-4
>C1
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C2
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C3
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C4
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C5
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C6
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=329 

C1              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C2              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C3              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C4              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C5              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C6              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
                **************************************************

C1              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C2              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C3              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C4              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C5              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C6              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
                **************************************************

C1              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C2              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C3              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C4              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C5              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C6              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
                **************************************************

C1              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C2              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C3              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C4              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C5              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C6              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
                **************************************************

C1              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C2              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C3              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C4              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C5              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C6              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
                **************************************************

C1              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C2              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C3              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C4              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C5              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C6              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
                **************************************************

C1              VLESLTSIRRAGADIVFTYWAADVACWLS
C2              VLESLTSIRRAGADIVFTYWAADVACWLS
C3              VLESLTSIRRAGADIVFTYWAADVACWLS
C4              VLESLTSIRRAGADIVFTYWAADVACWLS
C5              VLESLTSIRRAGADIVFTYWAADVACWLS
C6              VLESLTSIRRAGADIVFTYWAADVACWLS
                *****************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  329 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  329 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9870]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9870]--->[9870]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.515 Mb, Max= 30.896 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C2              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C3              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C4              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C5              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
C6              VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
                **************************************************

C1              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C2              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C3              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C4              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C5              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
C6              ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
                **************************************************

C1              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C2              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C3              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C4              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C5              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
C6              DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
                **************************************************

C1              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C2              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C3              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C4              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C5              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
C6              VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
                **************************************************

C1              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C2              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C3              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C4              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C5              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
C6              AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
                **************************************************

C1              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C2              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C3              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C4              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C5              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
C6              IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
                **************************************************

C1              VLESLTSIRRAGADIVFTYWAADVACWLS
C2              VLESLTSIRRAGADIVFTYWAADVACWLS
C3              VLESLTSIRRAGADIVFTYWAADVACWLS
C4              VLESLTSIRRAGADIVFTYWAADVACWLS
C5              VLESLTSIRRAGADIVFTYWAADVACWLS
C6              VLESLTSIRRAGADIVFTYWAADVACWLS
                *****************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
C2              GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
C3              GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
C4              GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
C5              GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
C6              GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
                **************************************************

C1              CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
C2              CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
C3              CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
C4              CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
C5              CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
C6              CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
                **************************************************

C1              TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
C2              TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
C3              TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
C4              TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
C5              TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
C6              TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
                **************************************************

C1              GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
C2              GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
C3              GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
C4              GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
C5              GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
C6              GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
                **************************************************

C1              TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
C2              TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
C3              TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
C4              TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
C5              TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
C6              TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
                **************************************************

C1              TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
C2              TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
C3              TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
C4              TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
C5              TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
C6              TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
                **************************************************

C1              GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
C2              GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
C3              GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
C4              GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
C5              GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
C6              GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
                **************************************************

C1              TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
C2              TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
C3              TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
C4              TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
C5              TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
C6              TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
                **************************************************

C1              GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
C2              GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
C3              GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
C4              GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
C5              GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
C6              GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
                **************************************************

C1              GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
C2              GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
C3              GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
C4              GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
C5              GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
C6              GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
                **************************************************

C1              CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
C2              CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
C3              CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
C4              CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
C5              CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
C6              CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
                **************************************************

C1              ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
C2              ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
C3              ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
C4              ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
C5              ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
C6              ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
                **************************************************

C1              GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
C2              GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
C3              GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
C4              GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
C5              GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
C6              GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
                **************************************************

C1              CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
C2              CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
C3              CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
C4              CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
C5              CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
C6              CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
                **************************************************

C1              GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
C2              GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
C3              GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
C4              GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
C5              GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
C6              GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
                **************************************************

C1              ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
C2              ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
C3              ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
C4              ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
C5              ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
C6              ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
                **************************************************

C1              CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
C2              CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
C3              CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
C4              CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
C5              CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
C6              CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
                **************************************************

C1              CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
C2              CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
C3              CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
C4              CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
C5              CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
C6              CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
                **************************************************

C1              GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
C2              GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
C3              GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
C4              GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
C5              GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
C6              GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
                **************************************************

C1              CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
C2              CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
C3              CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
C4              CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
C5              CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
C6              CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
                *************************************



>C1
GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
>C2
GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
>C3
GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
>C4
GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
>C5
GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
>C6
GTGAGCGTCAGTGGTTACCCGCGGCACCGGCCGCGCCGGCTTCGCTCAAC
CCCCGCGATGCGCCGCCTGGTGGCGCAGACTTCTCTGGAGCCAAGGAATT
TGGTGCTGCCGATGTTCGTTGCTGACGGTATTGACGAGCTGCGGCCAATT
GCTTCCATGCCGGGTGTTGTGCAGCACACCCGGGATTCGCTGCGTCGCGC
TGCTGTCGCTGCCGTCGATGCCGGGGTAGGTGGATTGAACCTGTTTGGCG
TGCCCCGCGACCAGGATAAGGATGCAACTGGCTCGGCTGGGGTAGATCCC
GATGGCATCCTCAATGTCGCTCTTCGCGATCTGGCCGAGGATCTCGGTGA
TGCCACCGTGTTGATGGCCGACACCTGTCTGGACGAGTTTACCGACCACG
GGCACTGCGGCGTCCTAGACGGGCAGGGCCGAGTGGACAACGACGCCACC
GTGGCACGGTATGTGGAACTTGCTGTGGCACAAGCGGAATCCGGTGCTAA
CGTGGTTGGTCCGAGCGGGATGATGGACGGCCAAATAGGTGCGCTCCGAG
ACGGACTTGACAGTGCAGGCTATGCCGACGTAGCGATCCTGGCTTACGCT
GCGAAGTTTTCTTCGGCGTTCTACGGACCATTCCGCGAGGCGGTGAGCTG
CAGCTTGTCCGGTGACCGACGCACCTACCAGCAGGAACCAGGCAATGCCC
GCGAGGCGTTGCGCGAAATCAAGTTGGATCTCGACGAGGGTGCAGACATT
ATCATGATCAAACCCGCTTCGGGGTATCTGGACGTCGTTGCTACGGCAGC
CGGTGTTTCGCCGGTTCCGGTAGCTGCCTATCAAGTCTCGGGGGAGTACG
CGATGATTTGCGCTGCGGCCGCAAACAACTGGATTGACGAACGTGCCGCT
GTGCTGGAGTCGTTGACAAGTATCCGGCGCGCTGGGGCGGATATCGTGTT
CACCTATTGGGCCGCTGATGTGGCGTGTTGGCTTTCT
>C1
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C2
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C3
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C4
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C5
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS
>C6
VSVSGYPRHRPRRLRSTPAMRRLVAQTSLEPRNLVLPMFVADGIDELRPI
ASMPGVVQHTRDSLRRAAVAAVDAGVGGLNLFGVPRDQDKDATGSAGVDP
DGILNVALRDLAEDLGDATVLMADTCLDEFTDHGHCGVLDGQGRVDNDAT
VARYVELAVAQAESGANVVGPSGMMDGQIGALRDGLDSAGYADVAILAYA
AKFSSAFYGPFREAVSCSLSGDRRTYQQEPGNAREALREIKLDLDEGADI
IMIKPASGYLDVVATAAGVSPVPVAAYQVSGEYAMICAAAANNWIDERAA
VLESLTSIRRAGADIVFTYWAADVACWLS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 987 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579791156
      Setting output file names to "/data/2res/hemB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1268420277
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0341806825
      Seed = 1720193954
      Swapseed = 1579791156
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2208.953184 -- -24.965149
         Chain 2 -- -2208.953312 -- -24.965149
         Chain 3 -- -2208.953312 -- -24.965149
         Chain 4 -- -2208.953184 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2208.953184 -- -24.965149
         Chain 2 -- -2208.952976 -- -24.965149
         Chain 3 -- -2208.953184 -- -24.965149
         Chain 4 -- -2208.953312 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2208.953] (-2208.953) (-2208.953) (-2208.953) * [-2208.953] (-2208.953) (-2208.953) (-2208.953) 
        500 -- [-1357.045] (-1366.926) (-1365.607) (-1353.074) * [-1351.515] (-1352.691) (-1364.852) (-1362.005) -- 0:00:00
       1000 -- [-1346.272] (-1348.286) (-1359.894) (-1354.367) * (-1348.316) (-1353.140) (-1355.958) [-1351.615] -- 0:00:00
       1500 -- (-1350.371) [-1343.415] (-1353.291) (-1346.198) * (-1360.172) [-1352.873] (-1352.396) (-1357.247) -- 0:00:00
       2000 -- (-1345.582) (-1351.439) (-1348.107) [-1346.944] * [-1345.394] (-1357.325) (-1355.566) (-1348.015) -- 0:00:00
       2500 -- [-1348.954] (-1349.259) (-1344.401) (-1344.640) * [-1354.012] (-1345.213) (-1345.541) (-1351.122) -- 0:00:00
       3000 -- (-1349.072) (-1350.729) [-1344.059] (-1344.947) * [-1345.919] (-1349.008) (-1353.491) (-1346.183) -- 0:00:00
       3500 -- (-1348.104) [-1347.888] (-1355.341) (-1347.549) * [-1349.925] (-1355.988) (-1354.225) (-1348.626) -- 0:00:00
       4000 -- (-1346.395) (-1369.808) (-1347.909) [-1345.080] * [-1344.681] (-1349.742) (-1350.407) (-1341.733) -- 0:00:00
       4500 -- [-1345.043] (-1345.127) (-1350.891) (-1355.622) * (-1351.812) (-1346.347) (-1346.967) [-1349.665] -- 0:00:00
       5000 -- (-1342.213) [-1349.807] (-1347.227) (-1349.741) * [-1342.356] (-1348.632) (-1349.779) (-1356.539) -- 0:00:00

      Average standard deviation of split frequencies: 0.085710

       5500 -- (-1343.642) (-1348.861) [-1349.905] (-1353.197) * [-1346.669] (-1350.985) (-1346.541) (-1352.291) -- 0:00:00
       6000 -- (-1345.434) (-1342.267) [-1353.819] (-1350.836) * [-1345.864] (-1350.181) (-1350.704) (-1355.526) -- 0:00:00
       6500 -- (-1352.599) (-1350.318) [-1350.564] (-1354.191) * (-1345.297) (-1348.093) (-1348.982) [-1349.003] -- 0:00:00
       7000 -- [-1349.888] (-1347.380) (-1352.159) (-1347.393) * [-1346.581] (-1346.085) (-1349.711) (-1350.116) -- 0:00:00
       7500 -- (-1346.193) [-1346.243] (-1347.708) (-1348.185) * (-1352.818) [-1344.721] (-1356.551) (-1344.424) -- 0:00:00
       8000 -- [-1347.063] (-1346.364) (-1347.825) (-1345.197) * (-1347.776) (-1354.103) (-1344.732) [-1345.342] -- 0:00:00
       8500 -- (-1345.289) (-1346.760) [-1346.781] (-1348.085) * (-1350.375) (-1355.137) [-1349.283] (-1349.195) -- 0:01:56
       9000 -- (-1343.299) (-1354.379) [-1344.894] (-1344.791) * (-1343.309) (-1344.696) [-1344.712] (-1353.278) -- 0:01:50
       9500 -- (-1352.685) (-1355.195) [-1346.460] (-1344.682) * (-1358.262) (-1345.562) [-1346.633] (-1349.898) -- 0:01:44
      10000 -- (-1350.896) [-1353.422] (-1344.663) (-1345.568) * (-1349.806) (-1347.457) (-1348.059) [-1352.090] -- 0:01:39

      Average standard deviation of split frequencies: 0.068746

      10500 -- (-1348.222) (-1346.763) (-1343.590) [-1342.418] * [-1353.999] (-1345.431) (-1344.788) (-1349.366) -- 0:01:34
      11000 -- (-1357.719) (-1357.096) (-1346.580) [-1344.575] * (-1345.653) (-1346.742) [-1347.351] (-1349.931) -- 0:01:29
      11500 -- (-1343.474) (-1345.743) (-1358.613) [-1346.905] * (-1349.513) (-1346.053) (-1347.876) [-1342.749] -- 0:01:25
      12000 -- (-1350.314) (-1354.146) [-1349.563] (-1348.808) * (-1358.530) [-1350.039] (-1346.692) (-1346.637) -- 0:01:22
      12500 -- [-1350.874] (-1344.641) (-1351.247) (-1344.877) * (-1350.784) [-1350.317] (-1350.269) (-1350.854) -- 0:01:19
      13000 -- (-1347.870) [-1348.153] (-1344.757) (-1347.136) * (-1346.837) (-1349.639) (-1346.072) [-1346.374] -- 0:01:15
      13500 -- (-1343.610) (-1348.136) (-1341.427) [-1349.691] * (-1352.593) (-1353.446) [-1349.743] (-1348.661) -- 0:01:13
      14000 -- (-1352.805) [-1345.246] (-1350.456) (-1351.714) * (-1342.166) (-1352.788) [-1348.345] (-1344.426) -- 0:01:10
      14500 -- (-1346.388) [-1341.922] (-1357.510) (-1360.195) * (-1349.393) (-1349.154) (-1342.854) [-1343.865] -- 0:01:07
      15000 -- (-1346.691) [-1347.040] (-1346.171) (-1355.533) * (-1339.836) (-1339.538) [-1344.702] (-1345.678) -- 0:01:05

      Average standard deviation of split frequencies: 0.060329

      15500 -- [-1344.034] (-1352.241) (-1346.916) (-1359.464) * (-1338.558) (-1340.494) [-1346.072] (-1346.467) -- 0:01:03
      16000 -- [-1352.079] (-1344.384) (-1353.298) (-1348.338) * (-1338.567) (-1343.100) (-1350.598) [-1342.378] -- 0:01:01
      16500 -- (-1346.871) (-1346.561) [-1346.766] (-1346.520) * (-1338.286) (-1339.212) (-1355.922) [-1348.675] -- 0:00:59
      17000 -- (-1349.339) (-1349.375) (-1348.083) [-1347.130] * (-1339.393) (-1345.032) (-1345.469) [-1344.409] -- 0:00:57
      17500 -- (-1345.665) [-1355.532] (-1347.519) (-1348.675) * (-1339.796) [-1344.236] (-1348.316) (-1350.608) -- 0:00:56
      18000 -- (-1351.908) (-1345.952) (-1344.468) [-1350.618] * (-1339.749) [-1338.914] (-1344.879) (-1348.462) -- 0:00:54
      18500 -- (-1350.792) [-1348.698] (-1342.166) (-1339.012) * (-1338.217) (-1337.621) (-1352.031) [-1343.248] -- 0:00:53
      19000 -- (-1352.033) [-1346.535] (-1340.944) (-1338.714) * [-1338.351] (-1338.224) (-1352.237) (-1347.307) -- 0:00:51
      19500 -- (-1345.665) [-1353.642] (-1338.073) (-1338.934) * (-1337.584) [-1339.022] (-1346.001) (-1348.124) -- 0:00:50
      20000 -- [-1345.227] (-1347.568) (-1337.206) (-1338.341) * (-1341.074) [-1338.914] (-1350.894) (-1340.484) -- 0:00:49

      Average standard deviation of split frequencies: 0.069771

      20500 -- (-1350.890) (-1345.560) [-1337.668] (-1338.453) * (-1339.621) (-1343.722) (-1354.570) [-1348.131] -- 0:00:47
      21000 -- (-1350.367) (-1347.366) [-1339.815] (-1339.231) * (-1337.991) [-1339.373] (-1345.192) (-1350.816) -- 0:00:46
      21500 -- (-1340.846) (-1343.797) (-1339.126) [-1337.681] * [-1341.925] (-1338.167) (-1349.936) (-1349.436) -- 0:00:45
      22000 -- (-1345.664) (-1347.288) (-1337.222) [-1337.464] * (-1340.362) (-1338.778) (-1347.274) [-1350.313] -- 0:00:44
      22500 -- (-1351.332) [-1349.524] (-1341.705) (-1338.215) * (-1338.509) (-1340.673) (-1352.045) [-1342.759] -- 0:00:43
      23000 -- (-1350.227) (-1347.576) (-1336.547) [-1338.534] * (-1337.263) (-1340.611) [-1348.450] (-1353.378) -- 0:01:24
      23500 -- (-1345.113) (-1346.444) (-1336.252) [-1336.778] * (-1338.581) (-1337.971) [-1342.296] (-1343.925) -- 0:01:23
      24000 -- (-1349.349) [-1343.542] (-1337.760) (-1337.950) * (-1338.506) (-1338.298) (-1343.166) [-1344.327] -- 0:01:21
      24500 -- (-1351.155) (-1346.565) [-1338.340] (-1337.515) * (-1337.945) (-1337.715) [-1344.661] (-1348.887) -- 0:01:19
      25000 -- (-1346.953) (-1345.800) (-1337.034) [-1338.297] * (-1339.338) (-1340.238) [-1352.160] (-1350.920) -- 0:01:18

      Average standard deviation of split frequencies: 0.050767

      25500 -- (-1349.758) (-1344.884) [-1336.883] (-1338.585) * (-1338.528) (-1338.294) [-1355.329] (-1346.738) -- 0:01:16
      26000 -- [-1352.981] (-1343.072) (-1338.665) (-1337.721) * (-1338.357) (-1339.180) (-1348.993) [-1347.426] -- 0:01:14
      26500 -- (-1353.016) (-1346.468) (-1343.211) [-1339.199] * (-1339.273) (-1337.826) (-1350.263) [-1347.525] -- 0:01:13
      27000 -- [-1351.245] (-1351.591) (-1342.297) (-1341.023) * (-1337.194) (-1338.500) (-1347.563) [-1350.575] -- 0:01:12
      27500 -- [-1342.954] (-1344.492) (-1338.036) (-1338.648) * [-1342.380] (-1338.277) (-1343.394) (-1352.312) -- 0:01:10
      28000 -- (-1355.779) [-1358.872] (-1337.786) (-1339.464) * (-1340.473) (-1339.994) [-1341.595] (-1349.941) -- 0:01:09
      28500 -- (-1349.039) (-1344.719) [-1343.064] (-1339.528) * (-1339.710) (-1342.845) [-1345.540] (-1344.957) -- 0:01:08
      29000 -- (-1349.613) (-1348.937) [-1337.323] (-1338.871) * (-1341.088) (-1342.202) [-1340.652] (-1350.547) -- 0:01:06
      29500 -- (-1355.181) [-1345.788] (-1338.115) (-1341.037) * [-1337.168] (-1343.920) (-1351.042) (-1346.083) -- 0:01:05
      30000 -- (-1349.366) [-1345.296] (-1337.449) (-1340.685) * (-1341.957) (-1338.079) (-1346.803) [-1346.313] -- 0:01:04

      Average standard deviation of split frequencies: 0.049776

      30500 -- [-1343.813] (-1349.454) (-1338.714) (-1339.734) * (-1339.564) (-1339.566) [-1344.590] (-1353.051) -- 0:01:03
      31000 -- [-1346.475] (-1344.405) (-1337.266) (-1341.069) * (-1341.487) [-1339.521] (-1352.179) (-1362.276) -- 0:01:02
      31500 -- (-1345.120) [-1348.194] (-1337.805) (-1339.468) * (-1341.303) (-1339.891) [-1345.893] (-1348.298) -- 0:01:01
      32000 -- [-1348.908] (-1349.741) (-1338.658) (-1339.366) * (-1339.816) (-1337.669) (-1340.523) [-1352.297] -- 0:01:00
      32500 -- (-1352.260) (-1341.824) [-1338.913] (-1338.703) * (-1339.164) (-1338.368) [-1344.806] (-1341.929) -- 0:00:59
      33000 -- (-1353.376) (-1345.335) [-1336.615] (-1338.640) * (-1339.112) (-1338.398) [-1348.074] (-1347.938) -- 0:00:58
      33500 -- [-1350.093] (-1347.944) (-1337.150) (-1338.258) * (-1338.976) [-1342.261] (-1346.155) (-1347.108) -- 0:00:57
      34000 -- (-1351.746) (-1350.836) (-1337.053) [-1337.802] * (-1339.485) (-1337.971) [-1343.227] (-1352.021) -- 0:00:56
      34500 -- [-1344.817] (-1354.597) (-1336.406) (-1341.314) * [-1337.525] (-1337.224) (-1345.275) (-1350.241) -- 0:00:55
      35000 -- [-1347.776] (-1346.846) (-1336.940) (-1342.208) * (-1337.514) [-1337.335] (-1350.843) (-1342.383) -- 0:00:55

      Average standard deviation of split frequencies: 0.042401

      35500 -- [-1346.613] (-1346.765) (-1339.809) (-1341.726) * (-1337.414) [-1339.547] (-1347.053) (-1349.136) -- 0:00:54
      36000 -- (-1343.234) (-1349.896) (-1340.373) [-1338.274] * (-1337.025) (-1339.507) (-1349.193) [-1346.488] -- 0:01:20
      36500 -- (-1350.684) (-1344.762) (-1340.984) [-1337.018] * (-1337.909) (-1338.155) [-1349.027] (-1358.101) -- 0:01:19
      37000 -- (-1344.242) (-1345.243) (-1340.724) [-1336.742] * (-1340.749) [-1340.768] (-1342.481) (-1344.999) -- 0:01:18
      37500 -- (-1349.492) [-1344.686] (-1344.149) (-1338.053) * [-1338.273] (-1342.948) (-1347.339) (-1344.956) -- 0:01:17
      38000 -- [-1347.570] (-1343.248) (-1342.917) (-1337.806) * (-1339.820) (-1340.561) [-1350.811] (-1354.454) -- 0:01:15
      38500 -- (-1354.015) [-1349.783] (-1338.783) (-1342.481) * (-1336.991) (-1341.674) [-1345.162] (-1344.890) -- 0:01:14
      39000 -- (-1341.448) [-1345.179] (-1339.425) (-1338.171) * [-1337.909] (-1340.604) (-1348.290) (-1350.962) -- 0:01:13
      39500 -- (-1352.601) [-1348.531] (-1339.135) (-1337.661) * (-1338.241) [-1338.714] (-1353.683) (-1351.257) -- 0:01:12
      40000 -- (-1344.588) [-1347.186] (-1340.939) (-1338.247) * (-1339.993) (-1338.174) (-1361.882) [-1348.689] -- 0:01:12

      Average standard deviation of split frequencies: 0.034166

      40500 -- [-1343.438] (-1352.648) (-1338.377) (-1339.012) * (-1338.323) [-1338.248] (-1350.422) (-1344.816) -- 0:01:11
      41000 -- (-1350.580) (-1354.000) (-1336.579) [-1338.492] * (-1337.163) (-1338.202) (-1338.648) [-1354.417] -- 0:01:10
      41500 -- (-1337.871) (-1345.796) [-1336.458] (-1338.452) * [-1337.533] (-1339.433) (-1348.742) (-1350.172) -- 0:01:09
      42000 -- (-1339.049) [-1345.887] (-1339.254) (-1339.105) * (-1337.208) (-1338.037) [-1338.022] (-1346.738) -- 0:01:08
      42500 -- (-1339.710) [-1347.040] (-1337.272) (-1340.291) * (-1342.438) (-1340.029) [-1338.950] (-1349.715) -- 0:01:07
      43000 -- (-1338.356) (-1352.498) [-1337.663] (-1340.754) * (-1341.019) (-1338.483) [-1340.121] (-1347.062) -- 0:01:06
      43500 -- (-1340.640) [-1352.051] (-1337.865) (-1343.265) * (-1336.786) (-1338.111) (-1341.647) [-1342.079] -- 0:01:05
      44000 -- (-1341.071) (-1347.727) (-1341.494) [-1341.894] * (-1341.475) (-1338.863) (-1343.742) [-1345.248] -- 0:01:05
      44500 -- (-1347.193) [-1343.658] (-1338.891) (-1341.950) * (-1339.138) [-1337.007] (-1344.349) (-1344.709) -- 0:01:04
      45000 -- (-1338.674) (-1347.709) (-1337.793) [-1336.792] * [-1337.153] (-1337.129) (-1338.998) (-1344.961) -- 0:01:03

      Average standard deviation of split frequencies: 0.028694

      45500 -- [-1338.622] (-1348.823) (-1338.275) (-1337.507) * (-1338.566) [-1336.712] (-1340.044) (-1344.093) -- 0:01:02
      46000 -- (-1339.030) [-1349.961] (-1340.640) (-1337.261) * (-1336.717) [-1336.844] (-1344.527) (-1354.257) -- 0:01:02
      46500 -- (-1338.987) [-1344.324] (-1338.566) (-1338.503) * (-1337.187) [-1337.534] (-1343.310) (-1354.994) -- 0:01:01
      47000 -- [-1338.048] (-1346.109) (-1336.772) (-1336.476) * (-1336.787) [-1337.527] (-1339.033) (-1349.865) -- 0:01:00
      47500 -- (-1341.730) (-1344.436) [-1337.758] (-1337.378) * [-1337.106] (-1337.099) (-1338.042) (-1347.509) -- 0:01:00
      48000 -- (-1345.668) (-1345.430) (-1337.575) [-1337.612] * (-1336.986) (-1339.905) (-1338.043) [-1347.407] -- 0:00:59
      48500 -- [-1341.172] (-1341.606) (-1344.686) (-1336.279) * (-1339.215) (-1338.148) (-1338.035) [-1338.005] -- 0:00:58
      49000 -- [-1339.037] (-1368.419) (-1344.617) (-1340.947) * (-1337.915) (-1337.951) (-1337.338) [-1338.218] -- 0:00:58
      49500 -- [-1337.293] (-1361.276) (-1342.123) (-1340.675) * (-1337.442) (-1338.304) (-1338.322) [-1337.911] -- 0:00:57
      50000 -- [-1337.189] (-1336.760) (-1340.684) (-1340.669) * (-1341.099) [-1340.731] (-1337.842) (-1338.628) -- 0:00:57

      Average standard deviation of split frequencies: 0.025121

      50500 -- [-1337.895] (-1338.578) (-1340.814) (-1337.027) * (-1337.873) (-1338.092) (-1338.583) [-1337.734] -- 0:01:15
      51000 -- [-1337.935] (-1339.464) (-1339.365) (-1337.549) * (-1338.781) (-1339.149) (-1339.544) [-1337.677] -- 0:01:14
      51500 -- (-1336.927) (-1341.429) (-1342.172) [-1338.374] * (-1336.965) [-1340.368] (-1340.539) (-1337.901) -- 0:01:13
      52000 -- [-1337.764] (-1341.621) (-1337.862) (-1339.083) * (-1337.880) [-1339.391] (-1339.311) (-1341.249) -- 0:01:12
      52500 -- [-1339.642] (-1341.941) (-1337.172) (-1338.765) * (-1339.667) (-1337.344) [-1339.634] (-1337.794) -- 0:01:12
      53000 -- (-1339.030) (-1339.321) [-1338.872] (-1345.466) * [-1339.412] (-1340.153) (-1338.514) (-1344.315) -- 0:01:11
      53500 -- (-1337.555) (-1337.179) [-1337.141] (-1339.835) * (-1338.712) (-1339.740) [-1340.352] (-1337.360) -- 0:01:10
      54000 -- (-1338.545) (-1337.537) [-1339.113] (-1339.102) * (-1341.757) [-1337.151] (-1339.493) (-1336.921) -- 0:01:10
      54500 -- (-1338.905) (-1344.527) [-1338.059] (-1339.397) * [-1339.516] (-1338.833) (-1340.397) (-1337.388) -- 0:01:09
      55000 -- (-1337.890) (-1340.111) [-1339.333] (-1339.533) * [-1339.502] (-1338.023) (-1337.760) (-1337.657) -- 0:01:08

      Average standard deviation of split frequencies: 0.018165

      55500 -- (-1337.799) (-1337.027) (-1341.219) [-1339.906] * (-1341.942) (-1340.785) [-1336.904] (-1338.612) -- 0:01:08
      56000 -- [-1338.389] (-1337.721) (-1337.138) (-1338.271) * (-1338.906) (-1341.977) (-1342.963) [-1337.108] -- 0:01:07
      56500 -- (-1340.535) [-1342.004] (-1337.315) (-1338.174) * (-1339.642) (-1338.043) (-1338.270) [-1336.246] -- 0:01:06
      57000 -- (-1337.401) [-1338.989] (-1339.034) (-1338.823) * (-1338.597) (-1340.433) (-1337.646) [-1336.364] -- 0:01:06
      57500 -- (-1337.164) (-1342.466) [-1339.034] (-1337.828) * (-1338.495) [-1343.197] (-1340.384) (-1336.352) -- 0:01:05
      58000 -- [-1339.931] (-1338.944) (-1339.533) (-1338.692) * (-1337.274) [-1343.871] (-1339.876) (-1336.287) -- 0:01:04
      58500 -- (-1337.733) (-1337.303) (-1339.430) [-1338.521] * (-1337.925) (-1344.716) [-1337.609] (-1337.671) -- 0:01:04
      59000 -- [-1339.124] (-1336.950) (-1339.256) (-1338.166) * (-1338.764) (-1342.494) [-1336.702] (-1338.739) -- 0:01:03
      59500 -- (-1340.891) (-1336.853) (-1339.281) [-1338.080] * (-1339.020) [-1343.058] (-1337.658) (-1339.828) -- 0:01:03
      60000 -- (-1340.434) [-1337.999] (-1339.544) (-1340.953) * (-1338.254) (-1343.894) (-1338.512) [-1336.172] -- 0:01:02

      Average standard deviation of split frequencies: 0.019222

      60500 -- (-1337.317) (-1337.474) (-1339.526) [-1340.636] * (-1338.479) (-1342.424) (-1338.332) [-1339.531] -- 0:01:02
      61000 -- [-1337.312] (-1342.490) (-1340.281) (-1338.694) * (-1337.753) [-1341.399] (-1337.796) (-1337.249) -- 0:01:01
      61500 -- (-1341.390) [-1338.247] (-1336.881) (-1338.671) * (-1336.835) [-1341.653] (-1338.226) (-1338.297) -- 0:01:01
      62000 -- (-1341.348) (-1339.063) (-1340.212) [-1344.587] * (-1337.154) [-1341.364] (-1338.667) (-1337.390) -- 0:01:00
      62500 -- (-1337.792) [-1337.067] (-1338.078) (-1341.603) * (-1338.979) (-1341.879) (-1337.568) [-1337.885] -- 0:01:00
      63000 -- [-1339.702] (-1339.979) (-1337.827) (-1341.314) * [-1340.142] (-1344.921) (-1339.930) (-1339.912) -- 0:00:59
      63500 -- [-1339.960] (-1336.611) (-1337.593) (-1347.016) * (-1342.817) (-1344.738) [-1338.140] (-1339.669) -- 0:00:58
      64000 -- (-1341.291) [-1337.814] (-1338.281) (-1344.823) * (-1340.161) [-1341.652] (-1339.145) (-1338.701) -- 0:00:58
      64500 -- (-1342.587) [-1337.567] (-1340.993) (-1343.388) * [-1342.428] (-1338.524) (-1337.191) (-1341.593) -- 0:00:58
      65000 -- (-1344.364) (-1340.189) (-1338.457) [-1339.761] * [-1339.530] (-1341.776) (-1337.234) (-1340.492) -- 0:00:57

      Average standard deviation of split frequencies: 0.015713

      65500 -- (-1337.066) (-1338.670) (-1340.764) [-1337.062] * (-1341.855) (-1339.329) [-1339.824] (-1336.887) -- 0:00:57
      66000 -- (-1338.151) (-1339.095) [-1341.574] (-1338.796) * (-1340.983) (-1341.285) (-1339.508) [-1337.615] -- 0:00:56
      66500 -- (-1337.599) [-1336.802] (-1338.839) (-1336.964) * (-1342.462) (-1337.126) (-1337.004) [-1337.520] -- 0:01:10
      67000 -- (-1337.616) (-1338.823) (-1340.169) [-1336.256] * (-1341.616) (-1336.709) (-1340.139) [-1338.052] -- 0:01:09
      67500 -- (-1339.792) (-1336.952) (-1337.199) [-1336.546] * [-1336.989] (-1339.709) (-1338.873) (-1342.226) -- 0:01:09
      68000 -- (-1340.845) (-1338.590) (-1338.615) [-1336.221] * [-1337.157] (-1337.721) (-1337.423) (-1341.496) -- 0:01:08
      68500 -- (-1340.651) [-1337.963] (-1338.414) (-1338.470) * (-1336.790) [-1339.761] (-1340.194) (-1341.295) -- 0:01:07
      69000 -- (-1341.760) (-1339.840) (-1337.693) [-1337.007] * (-1340.178) (-1338.526) (-1337.840) [-1337.872] -- 0:01:07
      69500 -- (-1342.467) (-1338.958) (-1339.511) [-1337.999] * (-1338.066) [-1339.063] (-1337.821) (-1338.050) -- 0:01:06
      70000 -- (-1340.877) (-1338.968) (-1338.150) [-1338.321] * (-1338.338) (-1340.442) (-1338.646) [-1338.180] -- 0:01:06

      Average standard deviation of split frequencies: 0.014746

      70500 -- [-1341.227] (-1337.340) (-1337.773) (-1337.149) * [-1337.472] (-1340.483) (-1338.401) (-1342.471) -- 0:01:05
      71000 -- (-1337.483) [-1338.840] (-1340.625) (-1339.517) * (-1337.358) [-1338.941] (-1337.351) (-1341.389) -- 0:01:05
      71500 -- (-1340.504) (-1339.147) (-1337.144) [-1337.917] * (-1338.100) [-1338.956] (-1336.892) (-1341.856) -- 0:01:04
      72000 -- [-1340.656] (-1338.130) (-1338.837) (-1339.088) * (-1336.679) (-1337.565) [-1337.132] (-1340.118) -- 0:01:04
      72500 -- (-1339.442) [-1337.648] (-1337.745) (-1338.713) * (-1336.791) [-1339.036] (-1337.979) (-1339.607) -- 0:01:03
      73000 -- (-1339.271) (-1337.730) [-1337.890] (-1338.178) * (-1341.609) (-1337.558) [-1336.791] (-1338.791) -- 0:01:03
      73500 -- (-1342.020) [-1338.088] (-1337.619) (-1338.352) * (-1343.694) [-1339.342] (-1340.591) (-1336.823) -- 0:01:03
      74000 -- (-1339.839) (-1340.451) (-1339.331) [-1338.742] * [-1336.856] (-1339.367) (-1339.362) (-1337.743) -- 0:01:02
      74500 -- [-1340.190] (-1341.806) (-1343.680) (-1339.599) * (-1337.327) [-1340.891] (-1339.082) (-1338.210) -- 0:01:02
      75000 -- [-1340.270] (-1337.943) (-1338.458) (-1339.200) * (-1337.172) (-1336.983) [-1338.089] (-1337.966) -- 0:01:01

      Average standard deviation of split frequencies: 0.017678

      75500 -- (-1340.858) (-1338.205) [-1340.031] (-1340.991) * (-1340.389) (-1336.944) [-1338.647] (-1339.757) -- 0:01:01
      76000 -- [-1338.088] (-1338.770) (-1338.043) (-1339.608) * [-1336.886] (-1336.439) (-1338.040) (-1337.436) -- 0:01:00
      76500 -- (-1337.359) [-1336.389] (-1337.980) (-1342.143) * (-1337.469) (-1336.197) [-1343.201] (-1341.737) -- 0:01:00
      77000 -- (-1337.318) (-1337.787) (-1340.116) [-1337.746] * (-1338.020) (-1340.021) [-1341.161] (-1338.129) -- 0:00:59
      77500 -- [-1336.690] (-1337.880) (-1338.884) (-1340.966) * (-1336.872) [-1338.063] (-1342.395) (-1337.045) -- 0:00:59
      78000 -- (-1338.732) (-1336.212) [-1339.143] (-1338.240) * (-1339.438) (-1349.138) (-1342.298) [-1337.550] -- 0:00:59
      78500 -- (-1338.010) (-1336.350) [-1340.141] (-1336.991) * [-1339.343] (-1341.653) (-1342.505) (-1343.677) -- 0:00:58
      79000 -- (-1338.535) (-1341.619) [-1340.677] (-1338.335) * (-1339.080) [-1340.361] (-1339.714) (-1337.315) -- 0:00:58
      79500 -- [-1337.313] (-1338.782) (-1339.218) (-1337.416) * (-1338.314) (-1338.181) (-1341.966) [-1336.877] -- 0:00:57
      80000 -- (-1336.747) [-1338.223] (-1339.071) (-1337.310) * (-1339.184) (-1337.547) (-1338.379) [-1338.510] -- 0:00:57

      Average standard deviation of split frequencies: 0.021222

      80500 -- [-1338.657] (-1336.879) (-1339.247) (-1338.159) * (-1343.733) (-1336.878) (-1338.375) [-1339.139] -- 0:00:57
      81000 -- (-1337.308) [-1337.040] (-1336.580) (-1338.149) * (-1336.487) [-1339.982] (-1337.893) (-1338.313) -- 0:00:56
      81500 -- [-1337.471] (-1336.531) (-1337.838) (-1339.355) * [-1337.080] (-1339.087) (-1338.512) (-1339.915) -- 0:00:56
      82000 -- (-1338.760) [-1338.090] (-1342.471) (-1337.799) * (-1338.498) [-1338.076] (-1340.052) (-1338.009) -- 0:00:55
      82500 -- (-1338.161) [-1337.327] (-1337.538) (-1341.115) * (-1336.524) (-1337.779) [-1338.768] (-1339.838) -- 0:01:06
      83000 -- (-1336.765) (-1336.624) [-1340.983] (-1341.577) * (-1340.637) [-1337.386] (-1338.154) (-1340.250) -- 0:01:06
      83500 -- (-1342.352) [-1337.986] (-1338.817) (-1341.472) * (-1340.495) (-1338.024) (-1339.286) [-1338.115] -- 0:01:05
      84000 -- (-1339.777) (-1336.884) [-1340.883] (-1341.874) * (-1343.378) [-1338.118] (-1337.707) (-1337.452) -- 0:01:05
      84500 -- [-1337.179] (-1337.353) (-1339.406) (-1339.814) * (-1339.549) (-1339.014) [-1336.936] (-1339.866) -- 0:01:05
      85000 -- [-1337.994] (-1337.768) (-1341.681) (-1340.551) * [-1338.143] (-1337.210) (-1336.841) (-1338.870) -- 0:01:04

      Average standard deviation of split frequencies: 0.020281

      85500 -- (-1337.169) (-1340.411) (-1337.174) [-1338.229] * (-1337.065) (-1338.064) [-1340.355] (-1336.756) -- 0:01:04
      86000 -- [-1337.799] (-1339.565) (-1336.378) (-1336.525) * (-1340.193) [-1339.114] (-1339.625) (-1337.614) -- 0:01:03
      86500 -- (-1338.537) (-1338.192) (-1336.402) [-1336.102] * (-1339.049) (-1343.843) (-1339.509) [-1338.655] -- 0:01:03
      87000 -- (-1338.377) (-1340.213) (-1336.456) [-1336.104] * (-1339.218) (-1340.873) [-1338.583] (-1341.770) -- 0:01:02
      87500 -- (-1338.249) [-1336.310] (-1336.566) (-1336.973) * (-1339.876) (-1340.446) [-1337.649] (-1338.022) -- 0:01:02
      88000 -- (-1340.814) (-1337.803) (-1339.206) [-1336.977] * (-1341.016) (-1343.671) [-1337.832] (-1339.332) -- 0:01:02
      88500 -- (-1337.554) [-1337.854] (-1340.913) (-1338.188) * (-1340.564) (-1350.405) [-1336.286] (-1338.241) -- 0:01:01
      89000 -- (-1337.394) [-1338.028] (-1336.297) (-1342.571) * [-1337.291] (-1345.472) (-1336.265) (-1337.602) -- 0:01:01
      89500 -- (-1337.957) (-1339.653) [-1340.203] (-1341.579) * (-1337.119) (-1340.929) [-1336.734] (-1336.679) -- 0:01:01
      90000 -- (-1339.209) [-1338.622] (-1338.678) (-1341.404) * (-1336.764) (-1342.029) (-1338.435) [-1337.687] -- 0:01:00

      Average standard deviation of split frequencies: 0.019064

      90500 -- (-1337.637) (-1337.177) (-1338.990) [-1338.158] * (-1337.701) (-1339.684) (-1336.521) [-1338.909] -- 0:01:00
      91000 -- (-1339.408) (-1336.867) (-1338.820) [-1339.431] * [-1342.109] (-1338.025) (-1340.202) (-1338.640) -- 0:00:59
      91500 -- (-1339.235) (-1336.845) (-1337.672) [-1341.548] * [-1338.040] (-1338.447) (-1337.440) (-1339.593) -- 0:00:59
      92000 -- [-1337.861] (-1337.929) (-1339.909) (-1337.356) * (-1337.661) [-1342.260] (-1339.747) (-1342.238) -- 0:00:59
      92500 -- (-1337.298) (-1341.837) [-1341.926] (-1338.897) * (-1336.994) (-1340.652) [-1340.378] (-1336.471) -- 0:00:58
      93000 -- [-1337.656] (-1338.309) (-1342.243) (-1338.880) * [-1338.072] (-1341.122) (-1341.146) (-1336.539) -- 0:00:58
      93500 -- (-1339.925) (-1340.395) (-1342.747) [-1339.498] * (-1337.041) (-1341.238) (-1339.091) [-1340.789] -- 0:00:58
      94000 -- [-1338.449] (-1337.557) (-1341.656) (-1339.725) * [-1336.391] (-1338.824) (-1339.704) (-1345.553) -- 0:00:57
      94500 -- (-1338.065) (-1337.012) [-1338.783] (-1342.593) * (-1337.851) (-1339.776) [-1338.538] (-1339.452) -- 0:00:57
      95000 -- (-1340.531) (-1339.069) [-1340.253] (-1337.852) * (-1337.848) (-1338.001) [-1339.132] (-1340.703) -- 0:00:57

      Average standard deviation of split frequencies: 0.023002

      95500 -- (-1337.677) (-1337.151) [-1339.374] (-1337.240) * (-1340.564) (-1339.506) (-1339.917) [-1341.902] -- 0:00:56
      96000 -- (-1338.840) (-1338.690) [-1338.939] (-1337.467) * (-1340.366) [-1338.186] (-1338.484) (-1339.771) -- 0:00:56
      96500 -- (-1337.601) [-1338.631] (-1342.632) (-1337.350) * (-1337.494) [-1337.703] (-1338.659) (-1337.430) -- 0:00:56
      97000 -- (-1336.601) [-1338.006] (-1338.491) (-1337.703) * (-1337.695) (-1337.803) [-1337.895] (-1337.793) -- 0:00:55
      97500 -- (-1336.521) (-1339.972) [-1338.489] (-1340.148) * (-1337.990) (-1341.748) [-1337.358] (-1339.019) -- 0:00:55
      98000 -- (-1336.763) (-1339.783) [-1338.409] (-1338.588) * (-1338.065) (-1339.241) [-1338.054] (-1338.540) -- 0:00:55
      98500 -- (-1336.650) [-1339.165] (-1338.734) (-1338.662) * [-1336.913] (-1339.458) (-1342.550) (-1339.378) -- 0:01:04
      99000 -- (-1341.619) (-1340.269) [-1340.795] (-1338.418) * (-1338.773) [-1337.182] (-1342.693) (-1339.839) -- 0:01:03
      99500 -- [-1338.190] (-1339.026) (-1339.677) (-1342.282) * (-1339.625) [-1337.293] (-1338.995) (-1338.511) -- 0:01:03
      100000 -- (-1343.570) (-1339.817) (-1339.593) [-1340.052] * (-1341.087) (-1337.153) (-1339.244) [-1337.704] -- 0:01:02

      Average standard deviation of split frequencies: 0.024154

      100500 -- (-1343.942) [-1339.776] (-1340.067) (-1337.555) * (-1346.032) (-1343.085) (-1338.635) [-1337.847] -- 0:01:02
      101000 -- (-1341.856) [-1337.659] (-1337.951) (-1339.937) * (-1343.930) (-1344.891) [-1341.035] (-1342.023) -- 0:01:02
      101500 -- [-1340.920] (-1337.498) (-1337.290) (-1336.699) * (-1342.534) (-1340.780) (-1337.762) [-1338.462] -- 0:01:01
      102000 -- (-1338.595) (-1340.583) [-1338.455] (-1336.262) * (-1338.421) (-1342.456) [-1337.561] (-1339.110) -- 0:01:01
      102500 -- [-1339.526] (-1340.455) (-1338.265) (-1336.473) * (-1338.301) [-1339.843] (-1338.592) (-1339.448) -- 0:01:01
      103000 -- (-1338.650) (-1336.541) [-1340.706] (-1336.815) * (-1338.622) (-1340.714) (-1339.780) [-1337.055] -- 0:01:00
      103500 -- [-1338.713] (-1337.867) (-1340.695) (-1336.402) * [-1339.155] (-1338.031) (-1338.948) (-1336.843) -- 0:01:00
      104000 -- [-1337.057] (-1338.573) (-1341.191) (-1336.683) * [-1340.571] (-1339.372) (-1340.872) (-1338.528) -- 0:01:00
      104500 -- (-1336.994) (-1336.321) (-1338.330) [-1337.291] * (-1339.380) (-1338.569) (-1339.941) [-1337.849] -- 0:00:59
      105000 -- (-1340.876) (-1336.121) [-1337.182] (-1337.139) * (-1339.224) (-1340.103) (-1338.332) [-1339.607] -- 0:00:59

      Average standard deviation of split frequencies: 0.021813

      105500 -- (-1340.489) (-1336.390) (-1336.571) [-1340.497] * (-1341.282) (-1342.045) [-1340.450] (-1337.882) -- 0:00:59
      106000 -- (-1338.601) (-1336.774) [-1337.739] (-1340.343) * [-1337.200] (-1337.444) (-1340.525) (-1337.335) -- 0:00:59
      106500 -- [-1340.074] (-1337.122) (-1340.714) (-1340.142) * (-1338.881) (-1337.772) [-1337.182] (-1336.527) -- 0:00:58
      107000 -- (-1337.182) (-1336.997) (-1340.543) [-1340.850] * (-1339.029) [-1337.591] (-1336.924) (-1340.628) -- 0:00:58
      107500 -- [-1339.425] (-1336.786) (-1339.761) (-1339.939) * (-1339.544) (-1336.787) [-1337.461] (-1338.932) -- 0:00:58
      108000 -- (-1339.914) (-1337.071) [-1339.511] (-1339.734) * (-1341.043) (-1337.104) (-1337.456) [-1339.876] -- 0:00:57
      108500 -- (-1337.453) (-1336.599) [-1338.910] (-1341.250) * [-1339.736] (-1341.344) (-1336.639) (-1338.235) -- 0:00:57
      109000 -- [-1339.638] (-1337.488) (-1337.856) (-1338.195) * (-1337.238) (-1338.679) (-1338.736) [-1336.411] -- 0:00:57
      109500 -- [-1340.375] (-1337.059) (-1338.203) (-1336.962) * [-1339.069] (-1337.613) (-1337.524) (-1337.032) -- 0:00:56
      110000 -- [-1337.278] (-1337.059) (-1340.094) (-1336.843) * (-1337.933) [-1339.769] (-1337.096) (-1336.214) -- 0:00:56

      Average standard deviation of split frequencies: 0.022150

      110500 -- (-1337.756) (-1337.801) [-1343.538] (-1339.430) * [-1337.712] (-1340.160) (-1336.636) (-1336.660) -- 0:00:56
      111000 -- (-1337.872) [-1338.840] (-1341.588) (-1337.511) * (-1337.737) (-1342.013) [-1336.436] (-1336.997) -- 0:00:56
      111500 -- (-1339.195) (-1336.960) [-1337.776] (-1338.505) * (-1338.562) [-1339.164] (-1338.252) (-1340.611) -- 0:00:55
      112000 -- (-1339.996) (-1338.503) [-1336.955] (-1338.083) * (-1337.640) (-1337.383) [-1337.134] (-1337.222) -- 0:00:55
      112500 -- (-1337.197) (-1338.161) (-1337.819) [-1337.101] * (-1337.640) [-1337.183] (-1337.753) (-1337.887) -- 0:00:55
      113000 -- (-1338.158) (-1338.631) (-1340.451) [-1338.688] * (-1338.382) (-1337.871) [-1337.474] (-1337.886) -- 0:00:54
      113500 -- [-1338.765] (-1337.974) (-1338.883) (-1339.361) * (-1340.623) (-1339.391) [-1337.781] (-1339.213) -- 0:00:54
      114000 -- (-1337.325) (-1341.901) (-1340.521) [-1337.419] * (-1340.852) (-1337.214) [-1337.310] (-1338.020) -- 0:00:54
      114500 -- [-1337.912] (-1338.650) (-1336.358) (-1341.332) * (-1340.875) (-1337.679) [-1337.611] (-1337.472) -- 0:01:01
      115000 -- (-1336.993) (-1337.931) (-1337.714) [-1340.755] * (-1344.298) (-1337.450) (-1338.300) [-1338.317] -- 0:01:01

      Average standard deviation of split frequencies: 0.022148

      115500 -- (-1338.037) [-1337.882] (-1337.499) (-1340.732) * (-1342.997) [-1337.147] (-1341.731) (-1337.411) -- 0:01:01
      116000 -- (-1338.830) (-1337.310) [-1339.232] (-1339.733) * (-1341.255) (-1337.018) (-1345.857) [-1337.325] -- 0:01:00
      116500 -- (-1342.858) [-1338.525] (-1339.691) (-1340.138) * (-1341.388) [-1338.613] (-1340.518) (-1341.675) -- 0:01:00
      117000 -- (-1338.974) [-1337.361] (-1337.951) (-1340.414) * [-1343.293] (-1340.882) (-1339.556) (-1339.315) -- 0:01:00
      117500 -- (-1343.193) (-1338.182) (-1338.646) [-1339.976] * (-1341.346) (-1340.136) [-1340.695] (-1336.951) -- 0:01:00
      118000 -- (-1340.827) [-1337.248] (-1338.891) (-1340.061) * (-1340.587) (-1340.233) [-1337.144] (-1342.271) -- 0:00:59
      118500 -- (-1341.338) (-1338.682) (-1337.290) [-1336.853] * (-1340.545) (-1337.102) (-1337.972) [-1342.645] -- 0:00:59
      119000 -- [-1338.273] (-1336.868) (-1337.937) (-1338.235) * (-1340.809) (-1339.375) [-1338.913] (-1342.498) -- 0:00:59
      119500 -- (-1341.428) (-1339.249) (-1339.131) [-1336.613] * (-1341.594) [-1339.025] (-1339.356) (-1339.618) -- 0:00:58
      120000 -- (-1337.016) [-1339.741] (-1339.946) (-1336.646) * (-1342.334) (-1336.827) [-1337.115] (-1341.792) -- 0:00:58

      Average standard deviation of split frequencies: 0.025085

      120500 -- (-1338.027) (-1337.272) (-1337.210) [-1340.271] * (-1340.386) (-1336.998) (-1339.711) [-1338.940] -- 0:00:58
      121000 -- (-1338.143) (-1338.179) (-1336.305) [-1338.949] * (-1340.322) [-1337.935] (-1340.862) (-1337.496) -- 0:00:58
      121500 -- (-1338.603) (-1337.063) [-1337.000] (-1339.900) * (-1338.885) [-1336.676] (-1340.952) (-1337.478) -- 0:00:57
      122000 -- (-1337.411) (-1337.803) [-1338.737] (-1338.112) * (-1338.139) [-1339.912] (-1338.288) (-1337.604) -- 0:00:57
      122500 -- (-1340.170) (-1341.532) [-1338.205] (-1342.194) * (-1338.400) (-1337.972) [-1337.228] (-1338.019) -- 0:00:57
      123000 -- (-1339.674) [-1341.658] (-1336.761) (-1338.146) * [-1337.134] (-1340.317) (-1339.477) (-1338.759) -- 0:00:57
      123500 -- (-1336.921) [-1339.495] (-1338.233) (-1337.720) * (-1338.577) [-1343.255] (-1339.466) (-1337.998) -- 0:00:56
      124000 -- (-1337.158) (-1340.093) (-1337.325) [-1338.364] * [-1341.730] (-1342.739) (-1342.401) (-1339.129) -- 0:00:56
      124500 -- [-1339.647] (-1336.778) (-1336.465) (-1337.655) * (-1340.279) (-1340.670) (-1339.757) [-1340.854] -- 0:00:56
      125000 -- (-1338.614) [-1337.502] (-1338.521) (-1341.412) * [-1340.162] (-1337.395) (-1344.513) (-1337.099) -- 0:00:56

      Average standard deviation of split frequencies: 0.023160

      125500 -- (-1340.575) (-1338.956) [-1337.410] (-1344.525) * (-1338.074) [-1337.753] (-1342.618) (-1336.503) -- 0:00:55
      126000 -- (-1338.840) (-1338.328) [-1339.714] (-1338.630) * (-1338.541) (-1337.676) (-1337.963) [-1336.658] -- 0:00:55
      126500 -- (-1339.237) (-1338.458) [-1337.629] (-1337.052) * [-1337.692] (-1338.467) (-1338.267) (-1337.148) -- 0:00:55
      127000 -- (-1339.034) (-1337.891) [-1337.096] (-1337.026) * (-1338.793) [-1338.164] (-1341.513) (-1339.027) -- 0:00:54
      127500 -- (-1339.044) [-1339.723] (-1341.265) (-1336.550) * (-1338.152) (-1336.632) (-1339.537) [-1341.652] -- 0:00:54
      128000 -- (-1339.169) [-1340.989] (-1337.592) (-1339.610) * [-1337.086] (-1339.085) (-1343.029) (-1345.827) -- 0:00:54
      128500 -- [-1339.682] (-1342.685) (-1337.542) (-1341.209) * [-1338.873] (-1337.079) (-1340.301) (-1336.888) -- 0:00:54
      129000 -- [-1338.926] (-1338.097) (-1337.083) (-1342.146) * (-1337.956) (-1336.788) (-1339.159) [-1336.447] -- 0:00:54
      129500 -- (-1339.116) (-1338.176) [-1337.427] (-1338.067) * [-1337.686] (-1339.724) (-1340.558) (-1337.030) -- 0:00:53
      130000 -- (-1342.126) (-1338.184) [-1336.955] (-1340.850) * (-1340.706) (-1339.944) (-1336.861) [-1337.826] -- 0:00:53

      Average standard deviation of split frequencies: 0.022162

      130500 -- (-1338.530) (-1340.046) (-1337.541) [-1340.852] * (-1336.551) (-1337.153) (-1338.055) [-1338.035] -- 0:00:53
      131000 -- (-1339.495) (-1339.336) (-1337.411) [-1337.451] * (-1337.850) (-1338.744) [-1336.718] (-1340.131) -- 0:00:59
      131500 -- (-1339.553) [-1337.405] (-1340.054) (-1338.085) * (-1343.978) (-1341.001) [-1337.026] (-1337.226) -- 0:00:59
      132000 -- (-1345.318) [-1337.292] (-1339.694) (-1338.440) * (-1339.554) (-1345.925) (-1337.286) [-1338.193] -- 0:00:59
      132500 -- (-1337.970) [-1340.536] (-1339.746) (-1338.027) * (-1338.585) (-1338.509) (-1339.026) [-1338.128] -- 0:00:58
      133000 -- [-1339.525] (-1340.172) (-1339.657) (-1341.836) * [-1341.316] (-1342.396) (-1340.085) (-1337.638) -- 0:00:58
      133500 -- (-1338.637) (-1338.237) [-1337.536] (-1340.645) * [-1338.109] (-1341.432) (-1342.230) (-1339.973) -- 0:00:58
      134000 -- (-1339.865) [-1336.627] (-1337.045) (-1340.567) * (-1339.296) (-1341.007) [-1340.181] (-1337.958) -- 0:00:58
      134500 -- (-1336.979) (-1337.458) [-1338.254] (-1337.504) * (-1339.296) [-1337.798] (-1337.094) (-1337.631) -- 0:00:57
      135000 -- [-1337.195] (-1337.185) (-1338.343) (-1337.543) * [-1338.011] (-1338.067) (-1338.803) (-1337.092) -- 0:00:57

      Average standard deviation of split frequencies: 0.023570

      135500 -- (-1339.203) (-1339.207) (-1338.296) [-1337.593] * (-1339.193) (-1338.319) [-1336.993] (-1337.729) -- 0:00:57
      136000 -- [-1337.326] (-1336.592) (-1338.626) (-1337.712) * (-1339.377) (-1337.821) [-1337.747] (-1339.584) -- 0:00:57
      136500 -- (-1337.639) [-1336.442] (-1338.877) (-1339.084) * (-1337.626) (-1337.533) (-1337.746) [-1339.547] -- 0:00:56
      137000 -- [-1341.693] (-1337.059) (-1343.122) (-1337.387) * [-1338.939] (-1337.026) (-1336.467) (-1338.852) -- 0:00:56
      137500 -- (-1339.301) (-1337.337) (-1336.638) [-1337.629] * (-1338.925) [-1340.689] (-1337.855) (-1339.563) -- 0:00:56
      138000 -- (-1338.561) (-1338.111) (-1336.504) [-1337.805] * (-1337.882) (-1338.567) (-1338.308) [-1338.421] -- 0:00:56
      138500 -- (-1341.895) (-1337.571) [-1338.326] (-1340.984) * (-1338.577) (-1337.799) (-1337.899) [-1337.144] -- 0:00:55
      139000 -- (-1340.326) [-1339.726] (-1339.295) (-1339.796) * (-1341.486) (-1338.493) [-1337.581] (-1337.155) -- 0:00:55
      139500 -- (-1337.959) [-1336.939] (-1337.422) (-1338.531) * (-1338.256) (-1338.972) [-1338.061] (-1337.086) -- 0:00:55
      140000 -- (-1336.881) (-1336.574) [-1336.829] (-1338.251) * (-1339.179) (-1337.333) (-1337.424) [-1337.781] -- 0:00:55

      Average standard deviation of split frequencies: 0.022577

      140500 -- (-1336.783) [-1337.594] (-1336.521) (-1337.926) * (-1336.663) (-1337.000) (-1341.106) [-1341.418] -- 0:00:55
      141000 -- (-1336.882) (-1337.225) [-1337.169] (-1340.193) * [-1336.517] (-1338.301) (-1340.985) (-1342.100) -- 0:00:54
      141500 -- (-1338.547) (-1337.444) (-1340.194) [-1337.154] * (-1338.501) [-1339.580] (-1336.803) (-1341.341) -- 0:00:54
      142000 -- (-1338.123) (-1338.148) [-1337.524] (-1337.005) * [-1339.659] (-1337.516) (-1337.505) (-1340.940) -- 0:00:54
      142500 -- (-1336.957) (-1342.308) (-1337.528) [-1336.935] * (-1344.636) (-1342.320) (-1339.195) [-1339.299] -- 0:00:54
      143000 -- [-1337.864] (-1339.691) (-1338.994) (-1337.660) * [-1338.602] (-1339.045) (-1346.230) (-1341.469) -- 0:00:53
      143500 -- (-1337.427) (-1339.208) (-1347.676) [-1337.308] * [-1342.334] (-1340.264) (-1339.942) (-1341.392) -- 0:00:53
      144000 -- [-1336.884] (-1340.086) (-1350.489) (-1337.218) * (-1340.489) (-1340.992) [-1339.531] (-1339.519) -- 0:00:53
      144500 -- (-1337.807) (-1338.236) (-1338.241) [-1342.098] * (-1338.229) (-1337.966) (-1338.217) [-1340.473] -- 0:00:53
      145000 -- [-1337.733] (-1341.050) (-1338.359) (-1338.967) * (-1339.350) (-1337.836) [-1337.055] (-1340.579) -- 0:00:53

      Average standard deviation of split frequencies: 0.022117

      145500 -- [-1337.184] (-1338.791) (-1338.155) (-1339.633) * (-1338.971) [-1337.322] (-1337.688) (-1339.361) -- 0:00:52
      146000 -- (-1337.209) (-1341.480) [-1344.392] (-1340.764) * (-1338.779) (-1338.700) [-1340.524] (-1338.773) -- 0:00:52
      146500 -- [-1339.359] (-1339.287) (-1337.706) (-1338.594) * [-1339.774] (-1339.193) (-1341.898) (-1338.359) -- 0:00:52
      147000 -- (-1337.509) (-1337.214) [-1339.353] (-1338.181) * (-1341.296) [-1336.944] (-1341.010) (-1337.420) -- 0:00:58
      147500 -- (-1337.163) [-1337.899] (-1338.048) (-1343.537) * [-1342.430] (-1336.748) (-1341.895) (-1338.570) -- 0:00:57
      148000 -- (-1338.850) (-1337.083) [-1337.276] (-1338.407) * (-1344.464) [-1337.605] (-1338.526) (-1339.966) -- 0:00:57
      148500 -- [-1336.284] (-1337.468) (-1338.180) (-1336.441) * [-1342.479] (-1341.338) (-1336.609) (-1337.463) -- 0:00:57
      149000 -- [-1337.032] (-1337.351) (-1337.894) (-1337.750) * (-1341.446) (-1340.463) [-1336.801] (-1338.781) -- 0:00:57
      149500 -- (-1337.741) [-1336.540] (-1338.774) (-1341.514) * (-1338.746) (-1339.947) [-1337.228] (-1338.820) -- 0:00:56
      150000 -- (-1338.920) (-1336.667) [-1338.644] (-1339.267) * (-1339.370) (-1336.685) [-1337.193] (-1339.734) -- 0:00:56

      Average standard deviation of split frequencies: 0.022527

      150500 -- (-1337.263) (-1340.772) (-1339.509) [-1337.691] * [-1338.527] (-1336.550) (-1339.004) (-1339.344) -- 0:00:56
      151000 -- [-1338.723] (-1337.419) (-1340.171) (-1337.688) * (-1341.023) (-1338.988) [-1340.144] (-1341.509) -- 0:00:56
      151500 -- (-1344.884) [-1338.268] (-1344.061) (-1336.823) * (-1337.746) [-1337.883] (-1341.070) (-1340.355) -- 0:00:56
      152000 -- (-1338.358) [-1338.131] (-1343.765) (-1338.078) * [-1338.993] (-1338.250) (-1345.669) (-1342.073) -- 0:00:55
      152500 -- [-1338.627] (-1342.485) (-1341.304) (-1336.870) * (-1339.586) (-1338.698) [-1339.100] (-1341.688) -- 0:00:55
      153000 -- [-1338.254] (-1341.625) (-1338.147) (-1337.143) * (-1339.915) (-1336.462) (-1338.916) [-1341.447] -- 0:00:55
      153500 -- (-1336.846) (-1343.047) (-1337.747) [-1338.251] * [-1339.916] (-1338.510) (-1337.345) (-1342.942) -- 0:00:55
      154000 -- (-1337.888) [-1339.804] (-1339.868) (-1338.341) * (-1339.540) [-1345.360] (-1342.747) (-1341.156) -- 0:00:54
      154500 -- (-1336.974) [-1337.612] (-1337.570) (-1342.692) * (-1339.337) (-1344.006) [-1337.804] (-1339.945) -- 0:00:54
      155000 -- (-1339.322) [-1338.670] (-1338.608) (-1336.856) * [-1338.434] (-1338.043) (-1338.746) (-1337.218) -- 0:00:54

      Average standard deviation of split frequencies: 0.024708

      155500 -- [-1338.149] (-1337.888) (-1337.375) (-1337.899) * [-1340.209] (-1337.635) (-1338.903) (-1337.081) -- 0:00:54
      156000 -- (-1337.175) (-1338.009) (-1337.420) [-1337.829] * (-1336.980) (-1339.011) (-1338.957) [-1336.487] -- 0:00:54
      156500 -- (-1339.191) [-1339.619] (-1337.622) (-1337.815) * [-1339.650] (-1342.637) (-1339.584) (-1336.426) -- 0:00:53
      157000 -- (-1339.907) (-1338.660) (-1339.003) [-1337.275] * (-1339.083) [-1339.947] (-1337.684) (-1340.359) -- 0:00:53
      157500 -- (-1337.736) (-1342.707) (-1337.878) [-1337.392] * (-1340.292) [-1339.673] (-1338.258) (-1339.822) -- 0:00:53
      158000 -- (-1344.056) (-1337.992) [-1338.626] (-1337.567) * (-1340.277) (-1341.667) [-1338.177] (-1340.696) -- 0:00:53
      158500 -- (-1341.260) [-1336.751] (-1339.206) (-1340.730) * (-1337.868) [-1342.180] (-1338.578) (-1340.361) -- 0:00:53
      159000 -- (-1341.811) [-1337.301] (-1339.776) (-1337.247) * (-1341.561) (-1341.779) (-1338.634) [-1337.419] -- 0:00:52
      159500 -- (-1338.739) (-1336.778) (-1336.243) [-1337.844] * (-1341.539) [-1339.845] (-1336.937) (-1337.610) -- 0:00:52
      160000 -- (-1337.854) (-1337.684) [-1336.867] (-1341.012) * [-1338.030] (-1341.168) (-1337.702) (-1337.865) -- 0:00:52

      Average standard deviation of split frequencies: 0.022782

      160500 -- (-1341.130) (-1339.230) (-1337.608) [-1337.327] * [-1339.747] (-1344.317) (-1336.808) (-1337.706) -- 0:00:52
      161000 -- (-1342.972) (-1337.890) [-1338.205] (-1338.667) * (-1338.329) [-1338.759] (-1337.226) (-1337.266) -- 0:00:52
      161500 -- (-1339.293) [-1340.286] (-1339.913) (-1338.077) * [-1337.266] (-1342.324) (-1336.943) (-1337.453) -- 0:00:51
      162000 -- (-1339.138) (-1339.797) [-1337.667] (-1337.244) * [-1336.911] (-1338.853) (-1337.689) (-1339.821) -- 0:00:51
      162500 -- (-1338.100) [-1338.800] (-1337.470) (-1337.350) * (-1336.733) [-1341.691] (-1337.025) (-1342.325) -- 0:00:51
      163000 -- (-1341.182) (-1337.872) (-1337.455) [-1339.202] * (-1344.263) (-1339.160) [-1336.956] (-1339.994) -- 0:00:56
      163500 -- (-1338.820) (-1338.450) [-1336.822] (-1336.461) * (-1342.556) (-1337.232) [-1337.669] (-1339.257) -- 0:00:56
      164000 -- (-1338.333) [-1339.096] (-1339.053) (-1337.909) * (-1344.468) (-1339.591) (-1338.087) [-1338.211] -- 0:00:56
      164500 -- (-1337.407) [-1339.759] (-1339.955) (-1339.569) * (-1341.997) [-1339.789] (-1336.670) (-1338.175) -- 0:00:55
      165000 -- (-1340.368) [-1343.358] (-1339.690) (-1338.862) * (-1339.661) (-1338.295) (-1337.641) [-1337.597] -- 0:00:55

      Average standard deviation of split frequencies: 0.020626

      165500 -- (-1338.499) (-1337.289) (-1340.437) [-1337.804] * [-1337.190] (-1337.593) (-1341.556) (-1341.325) -- 0:00:55
      166000 -- [-1336.829] (-1338.279) (-1337.724) (-1337.507) * [-1336.879] (-1339.833) (-1337.527) (-1343.745) -- 0:00:55
      166500 -- (-1336.214) (-1336.603) (-1340.295) [-1338.785] * [-1337.479] (-1339.531) (-1338.640) (-1343.258) -- 0:00:55
      167000 -- (-1338.507) [-1336.543] (-1343.958) (-1339.435) * (-1337.455) (-1338.064) [-1341.580] (-1341.846) -- 0:00:54
      167500 -- [-1338.236] (-1337.955) (-1339.750) (-1339.551) * [-1337.421] (-1337.646) (-1339.819) (-1338.085) -- 0:00:54
      168000 -- (-1336.502) (-1342.290) (-1338.874) [-1337.001] * [-1338.247] (-1337.433) (-1337.309) (-1337.777) -- 0:00:54
      168500 -- (-1336.501) [-1339.379] (-1339.425) (-1337.221) * (-1338.088) (-1337.327) (-1337.745) [-1337.411] -- 0:00:54
      169000 -- (-1338.275) (-1337.640) [-1338.982] (-1340.336) * (-1336.470) [-1341.629] (-1337.044) (-1339.896) -- 0:00:54
      169500 -- [-1336.608] (-1337.682) (-1343.576) (-1339.137) * (-1336.737) [-1341.842] (-1338.018) (-1342.087) -- 0:00:53
      170000 -- [-1339.394] (-1338.069) (-1337.369) (-1338.822) * (-1339.142) [-1339.091] (-1340.154) (-1339.162) -- 0:00:53

      Average standard deviation of split frequencies: 0.022097

      170500 -- [-1337.751] (-1337.741) (-1338.820) (-1338.767) * [-1338.054] (-1337.484) (-1343.508) (-1340.089) -- 0:00:53
      171000 -- (-1337.685) (-1340.053) (-1341.058) [-1341.791] * (-1338.260) (-1340.826) [-1343.284] (-1341.484) -- 0:00:53
      171500 -- (-1337.048) (-1336.666) [-1336.998] (-1339.828) * [-1338.146] (-1342.243) (-1341.896) (-1338.702) -- 0:00:53
      172000 -- (-1340.748) [-1337.471] (-1338.818) (-1339.510) * (-1338.556) (-1339.686) (-1340.134) [-1338.266] -- 0:00:52
      172500 -- (-1339.393) (-1337.103) (-1341.582) [-1340.285] * [-1338.339] (-1339.269) (-1340.467) (-1337.782) -- 0:00:52
      173000 -- (-1340.546) [-1337.573] (-1339.037) (-1338.571) * (-1338.503) (-1339.461) (-1340.029) [-1337.491] -- 0:00:52
      173500 -- (-1340.599) (-1339.185) (-1339.724) [-1337.947] * [-1337.807] (-1346.340) (-1338.437) (-1340.131) -- 0:00:52
      174000 -- (-1337.131) (-1337.950) [-1337.802] (-1339.359) * (-1338.965) [-1336.384] (-1337.735) (-1340.517) -- 0:00:52
      174500 -- (-1338.458) (-1339.714) [-1337.473] (-1339.067) * [-1338.584] (-1338.372) (-1337.537) (-1341.095) -- 0:00:52
      175000 -- (-1338.493) (-1338.283) [-1337.197] (-1338.170) * (-1337.716) (-1340.528) [-1336.489] (-1340.533) -- 0:00:51

      Average standard deviation of split frequencies: 0.023468

      175500 -- (-1338.665) (-1339.761) (-1341.026) [-1338.480] * [-1339.491] (-1339.496) (-1338.892) (-1338.162) -- 0:00:51
      176000 -- (-1338.227) (-1337.839) (-1340.502) [-1337.531] * [-1337.456] (-1336.561) (-1337.271) (-1338.162) -- 0:00:51
      176500 -- (-1337.887) (-1341.650) (-1337.940) [-1338.754] * (-1340.884) (-1338.274) (-1336.616) [-1337.901] -- 0:00:51
      177000 -- (-1340.961) (-1340.056) [-1339.375] (-1336.985) * (-1340.518) (-1336.407) (-1336.994) [-1337.528] -- 0:00:51
      177500 -- (-1341.292) (-1339.725) (-1347.945) [-1339.458] * [-1339.408] (-1338.587) (-1338.323) (-1336.784) -- 0:00:50
      178000 -- [-1341.730] (-1337.234) (-1340.574) (-1337.716) * (-1338.745) (-1338.879) (-1339.295) [-1337.944] -- 0:00:50
      178500 -- [-1341.639] (-1338.243) (-1338.073) (-1339.250) * (-1338.403) (-1337.051) (-1339.552) [-1338.079] -- 0:00:50
      179000 -- (-1340.263) (-1339.604) [-1339.593] (-1340.531) * (-1338.403) (-1338.056) [-1338.701] (-1339.372) -- 0:00:55
      179500 -- (-1338.847) (-1337.289) (-1338.762) [-1340.055] * (-1337.260) (-1338.187) (-1338.666) [-1338.038] -- 0:00:54
      180000 -- (-1337.627) [-1339.403] (-1339.934) (-1341.044) * (-1342.173) (-1338.373) (-1338.877) [-1339.301] -- 0:00:54

      Average standard deviation of split frequencies: 0.022700

      180500 -- (-1336.840) (-1338.853) [-1340.100] (-1338.905) * (-1343.047) (-1338.418) (-1339.042) [-1338.331] -- 0:00:54
      181000 -- (-1336.985) (-1337.660) [-1338.274] (-1336.623) * [-1340.265] (-1338.576) (-1338.064) (-1339.231) -- 0:00:54
      181500 -- (-1338.306) [-1337.276] (-1338.145) (-1336.434) * (-1340.156) [-1339.077] (-1338.269) (-1337.943) -- 0:00:54
      182000 -- (-1340.041) (-1337.405) (-1336.936) [-1337.758] * (-1343.139) (-1341.337) [-1339.517] (-1338.297) -- 0:00:53
      182500 -- (-1340.794) (-1337.703) (-1338.846) [-1337.131] * (-1338.517) (-1338.439) (-1337.843) [-1336.849] -- 0:00:53
      183000 -- [-1343.075] (-1336.999) (-1336.769) (-1338.134) * (-1338.154) (-1338.285) (-1337.790) [-1342.135] -- 0:00:53
      183500 -- (-1338.843) (-1337.125) [-1336.894] (-1337.731) * (-1338.301) (-1338.926) (-1337.935) [-1340.953] -- 0:00:53
      184000 -- (-1342.950) (-1338.639) (-1339.808) [-1339.688] * (-1340.103) [-1340.688] (-1339.884) (-1338.353) -- 0:00:53
      184500 -- [-1339.023] (-1338.702) (-1337.974) (-1338.086) * [-1338.489] (-1339.212) (-1342.417) (-1339.147) -- 0:00:53
      185000 -- [-1341.426] (-1337.031) (-1338.157) (-1338.268) * [-1336.793] (-1338.130) (-1339.817) (-1337.038) -- 0:00:52

      Average standard deviation of split frequencies: 0.022556

      185500 -- (-1339.978) (-1337.245) [-1338.365] (-1339.818) * [-1337.582] (-1340.180) (-1337.803) (-1337.334) -- 0:00:52
      186000 -- [-1339.472] (-1337.231) (-1337.969) (-1338.396) * [-1337.727] (-1339.849) (-1337.427) (-1337.914) -- 0:00:52
      186500 -- (-1339.903) (-1341.562) [-1338.973] (-1337.290) * [-1337.138] (-1338.530) (-1338.389) (-1339.707) -- 0:00:52
      187000 -- (-1339.100) (-1338.150) (-1341.292) [-1338.153] * (-1338.129) (-1336.908) [-1337.266] (-1337.115) -- 0:00:52
      187500 -- [-1338.169] (-1338.297) (-1337.889) (-1338.940) * [-1337.966] (-1339.653) (-1338.700) (-1336.524) -- 0:00:52
      188000 -- (-1341.064) (-1338.995) (-1339.387) [-1342.276] * [-1338.749] (-1338.291) (-1340.429) (-1337.158) -- 0:00:51
      188500 -- (-1337.019) (-1340.953) (-1337.837) [-1337.657] * (-1338.231) (-1338.831) (-1344.049) [-1337.427] -- 0:00:51
      189000 -- (-1339.975) [-1345.543] (-1337.089) (-1337.723) * (-1338.919) (-1338.405) (-1341.034) [-1338.047] -- 0:00:51
      189500 -- (-1341.577) (-1343.027) (-1337.239) [-1338.567] * (-1339.207) (-1338.968) (-1339.129) [-1340.079] -- 0:00:51
      190000 -- [-1342.851] (-1340.040) (-1337.126) (-1341.065) * [-1341.262] (-1337.683) (-1339.767) (-1340.993) -- 0:00:51

      Average standard deviation of split frequencies: 0.023683

      190500 -- (-1338.485) (-1340.508) (-1338.896) [-1339.251] * (-1340.125) (-1336.625) [-1336.798] (-1339.676) -- 0:00:50
      191000 -- (-1337.516) (-1342.118) (-1341.637) [-1339.741] * [-1339.092] (-1338.363) (-1336.244) (-1340.931) -- 0:00:50
      191500 -- (-1337.682) [-1341.650] (-1339.573) (-1338.216) * (-1336.869) [-1337.937] (-1338.975) (-1339.600) -- 0:00:50
      192000 -- [-1342.148] (-1338.522) (-1344.459) (-1338.607) * (-1338.368) (-1336.861) [-1338.160] (-1338.322) -- 0:00:50
      192500 -- (-1343.687) [-1339.598] (-1338.291) (-1341.843) * [-1342.611] (-1337.664) (-1342.017) (-1338.345) -- 0:00:50
      193000 -- (-1339.205) (-1342.447) [-1341.356] (-1344.195) * (-1339.341) [-1337.615] (-1338.800) (-1338.875) -- 0:00:50
      193500 -- (-1337.486) [-1340.558] (-1340.702) (-1336.705) * (-1339.248) [-1338.794] (-1339.917) (-1338.621) -- 0:00:50
      194000 -- (-1337.767) (-1344.150) [-1339.049] (-1338.764) * (-1339.320) [-1337.682] (-1340.409) (-1338.156) -- 0:00:49
      194500 -- [-1339.508] (-1346.404) (-1339.357) (-1336.722) * [-1338.842] (-1337.782) (-1338.590) (-1341.605) -- 0:00:49
      195000 -- (-1339.662) (-1350.540) [-1338.696] (-1336.688) * (-1337.976) (-1342.693) [-1339.369] (-1339.089) -- 0:00:53

      Average standard deviation of split frequencies: 0.024318

      195500 -- (-1338.350) (-1347.636) [-1338.764] (-1337.031) * [-1340.028] (-1339.479) (-1338.612) (-1339.304) -- 0:00:53
      196000 -- [-1337.789] (-1339.255) (-1338.321) (-1337.057) * (-1341.195) (-1337.644) (-1336.860) [-1339.309] -- 0:00:53
      196500 -- (-1336.826) (-1339.614) (-1338.267) [-1337.937] * (-1339.658) (-1337.647) (-1337.455) [-1339.027] -- 0:00:53
      197000 -- [-1338.164] (-1339.611) (-1338.831) (-1337.948) * (-1340.346) (-1339.988) (-1340.451) [-1341.131] -- 0:00:52
      197500 -- (-1339.067) (-1340.017) (-1340.747) [-1337.595] * (-1338.593) (-1338.118) [-1338.019] (-1340.220) -- 0:00:52
      198000 -- (-1338.044) (-1338.540) (-1339.671) [-1338.030] * (-1339.235) (-1338.960) [-1337.770] (-1336.862) -- 0:00:52
      198500 -- [-1338.079] (-1338.506) (-1340.431) (-1338.206) * (-1340.710) (-1339.788) (-1338.909) [-1337.368] -- 0:00:52
      199000 -- [-1337.024] (-1337.738) (-1342.113) (-1338.038) * (-1336.915) (-1339.959) [-1341.236] (-1338.083) -- 0:00:52
      199500 -- (-1337.222) (-1337.058) (-1340.986) [-1336.985] * (-1336.668) (-1341.665) (-1339.857) [-1337.992] -- 0:00:52
      200000 -- (-1336.733) [-1339.535] (-1337.684) (-1337.731) * (-1337.201) (-1337.994) (-1342.760) [-1337.011] -- 0:00:51

      Average standard deviation of split frequencies: 0.024405

      200500 -- [-1336.965] (-1339.535) (-1338.677) (-1337.522) * (-1337.481) (-1337.973) [-1337.748] (-1341.813) -- 0:00:51
      201000 -- [-1337.760] (-1338.175) (-1338.658) (-1337.785) * (-1338.322) [-1337.973] (-1339.740) (-1346.000) -- 0:00:51
      201500 -- [-1337.951] (-1338.033) (-1338.383) (-1338.071) * (-1340.600) (-1337.298) (-1338.518) [-1343.820] -- 0:00:51
      202000 -- (-1339.124) (-1338.274) [-1337.564] (-1339.555) * (-1340.971) (-1338.768) [-1336.431] (-1340.450) -- 0:00:51
      202500 -- (-1343.459) (-1340.055) (-1336.878) [-1340.732] * [-1338.715] (-1340.550) (-1337.526) (-1343.758) -- 0:00:51
      203000 -- (-1338.785) (-1340.413) [-1340.581] (-1336.934) * (-1342.642) (-1337.257) (-1338.275) [-1339.548] -- 0:00:51
      203500 -- (-1337.607) [-1336.873] (-1338.681) (-1337.370) * (-1340.850) [-1336.636] (-1336.662) (-1338.755) -- 0:00:50
      204000 -- [-1336.864] (-1337.763) (-1336.736) (-1338.763) * (-1336.848) [-1341.189] (-1337.750) (-1345.879) -- 0:00:50
      204500 -- (-1336.832) (-1336.805) [-1338.054] (-1339.258) * (-1338.093) [-1337.094] (-1338.426) (-1339.283) -- 0:00:50
      205000 -- (-1339.475) [-1336.868] (-1338.571) (-1339.353) * [-1336.463] (-1338.001) (-1336.372) (-1341.441) -- 0:00:50

      Average standard deviation of split frequencies: 0.022757

      205500 -- [-1340.588] (-1337.171) (-1341.333) (-1338.745) * [-1336.840] (-1338.355) (-1336.377) (-1340.264) -- 0:00:50
      206000 -- (-1341.735) [-1337.884] (-1338.989) (-1337.570) * (-1336.772) [-1338.377] (-1336.468) (-1338.089) -- 0:00:50
      206500 -- (-1337.857) [-1340.282] (-1344.533) (-1337.492) * (-1337.328) (-1337.996) [-1337.611] (-1337.288) -- 0:00:49
      207000 -- (-1337.353) (-1341.362) (-1339.958) [-1336.767] * (-1338.227) (-1337.168) [-1337.817] (-1339.131) -- 0:00:49
      207500 -- (-1339.139) (-1337.964) [-1336.423] (-1338.252) * (-1340.448) [-1336.290] (-1339.246) (-1342.593) -- 0:00:49
      208000 -- (-1339.089) (-1341.572) (-1336.458) [-1338.128] * (-1341.769) (-1337.923) (-1339.324) [-1343.312] -- 0:00:49
      208500 -- (-1338.537) (-1336.202) (-1336.750) [-1340.193] * [-1339.846] (-1337.906) (-1337.477) (-1340.587) -- 0:00:49
      209000 -- [-1341.507] (-1337.274) (-1336.511) (-1339.299) * (-1338.485) (-1337.142) (-1337.178) [-1339.000] -- 0:00:49
      209500 -- (-1339.849) (-1337.940) (-1340.392) [-1337.356] * [-1339.304] (-1337.234) (-1336.897) (-1338.512) -- 0:00:49
      210000 -- (-1338.131) (-1338.214) [-1340.140] (-1337.615) * (-1339.939) [-1336.982] (-1336.083) (-1338.400) -- 0:00:48

      Average standard deviation of split frequencies: 0.021507

      210500 -- (-1343.154) (-1338.538) [-1337.652] (-1337.190) * (-1339.308) (-1339.474) [-1336.083] (-1337.231) -- 0:00:48
      211000 -- (-1342.150) (-1340.812) (-1336.495) [-1336.391] * (-1338.667) [-1338.823] (-1337.162) (-1339.445) -- 0:00:52
      211500 -- (-1339.757) (-1340.575) (-1337.025) [-1340.666] * [-1338.652] (-1338.578) (-1336.575) (-1339.394) -- 0:00:52
      212000 -- (-1339.646) (-1341.869) (-1338.012) [-1338.824] * (-1337.132) (-1338.682) (-1341.415) [-1340.564] -- 0:00:52
      212500 -- (-1342.384) (-1340.164) [-1336.790] (-1339.396) * (-1340.234) (-1338.268) (-1342.310) [-1339.347] -- 0:00:51
      213000 -- (-1340.833) (-1339.777) [-1337.370] (-1339.417) * (-1340.068) (-1338.522) (-1339.410) [-1342.822] -- 0:00:51
      213500 -- (-1342.211) (-1336.579) (-1336.942) [-1336.916] * [-1341.689] (-1338.524) (-1341.067) (-1339.227) -- 0:00:51
      214000 -- (-1338.207) [-1336.579] (-1340.015) (-1337.572) * (-1342.740) [-1336.985] (-1339.991) (-1339.350) -- 0:00:51
      214500 -- (-1339.151) (-1337.487) (-1339.432) [-1341.443] * [-1337.489] (-1339.452) (-1339.226) (-1338.575) -- 0:00:51
      215000 -- (-1338.499) (-1337.339) [-1338.032] (-1338.129) * (-1338.269) [-1337.372] (-1337.201) (-1340.314) -- 0:00:51

      Average standard deviation of split frequencies: 0.021824

      215500 -- [-1339.830] (-1337.062) (-1337.715) (-1339.070) * [-1338.432] (-1337.227) (-1337.489) (-1337.491) -- 0:00:50
      216000 -- (-1339.460) (-1337.962) (-1337.574) [-1339.108] * (-1338.676) (-1339.936) [-1338.769] (-1337.388) -- 0:00:50
      216500 -- (-1337.076) (-1337.412) (-1342.047) [-1338.690] * (-1337.978) (-1341.895) (-1340.091) [-1338.882] -- 0:00:50
      217000 -- (-1338.215) [-1338.540] (-1342.072) (-1337.575) * (-1337.252) (-1343.299) [-1338.158] (-1337.354) -- 0:00:50
      217500 -- (-1340.571) (-1337.221) [-1339.864] (-1338.468) * (-1337.066) [-1337.833] (-1339.696) (-1340.214) -- 0:00:50
      218000 -- [-1340.512] (-1340.000) (-1337.862) (-1337.454) * (-1337.845) (-1341.885) [-1340.690] (-1340.023) -- 0:00:50
      218500 -- (-1338.394) (-1339.192) [-1339.464] (-1338.199) * [-1337.421] (-1337.698) (-1341.730) (-1339.680) -- 0:00:50
      219000 -- [-1337.018] (-1338.474) (-1337.519) (-1336.938) * [-1338.201] (-1340.657) (-1338.757) (-1339.783) -- 0:00:49
      219500 -- [-1339.753] (-1338.787) (-1339.150) (-1337.540) * (-1339.398) (-1338.135) [-1338.123] (-1339.301) -- 0:00:49
      220000 -- (-1344.712) [-1339.199] (-1337.706) (-1339.433) * (-1338.721) (-1337.478) [-1340.458] (-1337.371) -- 0:00:49

      Average standard deviation of split frequencies: 0.021111

      220500 -- (-1345.122) (-1342.078) [-1339.410] (-1339.990) * (-1336.494) (-1337.486) (-1340.883) [-1339.891] -- 0:00:49
      221000 -- (-1342.122) (-1342.564) (-1337.271) [-1336.993] * (-1336.441) (-1336.578) [-1339.723] (-1337.833) -- 0:00:49
      221500 -- [-1341.411] (-1339.511) (-1337.289) (-1338.354) * [-1336.805] (-1337.898) (-1337.615) (-1339.585) -- 0:00:49
      222000 -- (-1342.108) (-1344.317) (-1336.426) [-1336.411] * (-1338.948) (-1336.884) [-1337.138] (-1337.523) -- 0:00:49
      222500 -- (-1346.628) (-1340.113) [-1338.831] (-1337.827) * (-1337.589) [-1338.471] (-1338.443) (-1339.532) -- 0:00:48
      223000 -- (-1338.002) (-1341.218) (-1338.008) [-1339.326] * (-1338.018) (-1340.234) (-1341.498) [-1339.066] -- 0:00:48
      223500 -- (-1336.780) [-1340.102] (-1337.770) (-1338.753) * (-1338.053) [-1340.914] (-1339.877) (-1342.581) -- 0:00:48
      224000 -- (-1337.001) [-1338.458] (-1338.887) (-1337.990) * (-1339.280) (-1339.501) (-1337.833) [-1338.246] -- 0:00:48
      224500 -- (-1341.008) [-1337.136] (-1342.091) (-1337.733) * [-1338.388] (-1338.988) (-1337.525) (-1343.763) -- 0:00:48
      225000 -- (-1340.188) [-1336.364] (-1338.604) (-1338.166) * (-1337.183) (-1338.989) [-1336.567] (-1341.490) -- 0:00:48

      Average standard deviation of split frequencies: 0.020529

      225500 -- [-1339.102] (-1336.499) (-1337.032) (-1340.118) * (-1336.776) (-1337.607) (-1337.065) [-1341.320] -- 0:00:48
      226000 -- (-1338.963) (-1336.604) (-1337.752) [-1336.477] * (-1337.657) (-1336.959) [-1340.753] (-1338.215) -- 0:00:47
      226500 -- (-1338.216) (-1337.452) [-1337.850] (-1337.900) * [-1336.947] (-1338.192) (-1339.338) (-1340.419) -- 0:00:51
      227000 -- [-1338.823] (-1337.565) (-1342.512) (-1338.279) * (-1336.580) [-1338.545] (-1337.121) (-1337.620) -- 0:00:51
      227500 -- (-1338.420) [-1340.394] (-1345.963) (-1338.274) * (-1336.450) (-1337.086) [-1337.176] (-1338.021) -- 0:00:50
      228000 -- (-1337.364) [-1338.055] (-1339.373) (-1337.151) * [-1337.171] (-1338.782) (-1336.518) (-1339.654) -- 0:00:50
      228500 -- (-1338.353) (-1336.880) (-1340.600) [-1338.992] * [-1341.332] (-1338.556) (-1336.817) (-1338.255) -- 0:00:50
      229000 -- (-1337.899) (-1337.549) [-1339.129] (-1343.363) * (-1341.524) (-1338.276) [-1336.613] (-1339.608) -- 0:00:50
      229500 -- (-1338.929) (-1340.157) [-1341.455] (-1340.371) * [-1338.584] (-1339.850) (-1338.474) (-1339.318) -- 0:00:50
      230000 -- (-1337.960) (-1337.720) (-1339.608) [-1336.895] * (-1340.589) (-1338.597) (-1337.034) [-1337.276] -- 0:00:50

      Average standard deviation of split frequencies: 0.020130

      230500 -- [-1337.517] (-1337.463) (-1339.332) (-1336.572) * (-1339.265) (-1338.170) [-1338.257] (-1340.050) -- 0:00:50
      231000 -- (-1338.135) (-1337.450) [-1338.883] (-1336.542) * (-1340.050) [-1336.844] (-1336.813) (-1338.823) -- 0:00:49
      231500 -- [-1337.244] (-1336.645) (-1341.739) (-1336.593) * (-1340.025) (-1340.021) (-1340.342) [-1336.655] -- 0:00:49
      232000 -- (-1340.132) (-1336.722) [-1337.401] (-1338.422) * (-1341.539) (-1344.385) (-1337.637) [-1337.268] -- 0:00:49
      232500 -- (-1339.247) (-1336.766) [-1336.572] (-1337.417) * (-1339.755) (-1344.163) [-1340.434] (-1336.671) -- 0:00:49
      233000 -- (-1339.454) [-1337.082] (-1341.241) (-1339.351) * (-1338.224) [-1340.577] (-1337.281) (-1339.401) -- 0:00:49
      233500 -- (-1338.529) (-1336.928) [-1337.829] (-1339.460) * (-1339.155) (-1338.426) [-1340.409] (-1338.921) -- 0:00:49
      234000 -- (-1337.772) (-1339.592) (-1339.771) [-1339.476] * (-1338.321) [-1337.700] (-1338.040) (-1337.013) -- 0:00:49
      234500 -- [-1336.887] (-1339.798) (-1339.167) (-1339.345) * (-1336.656) [-1337.401] (-1337.465) (-1340.584) -- 0:00:48
      235000 -- (-1336.938) (-1341.079) [-1336.978] (-1339.999) * [-1338.221] (-1337.868) (-1337.874) (-1339.570) -- 0:00:48

      Average standard deviation of split frequencies: 0.020606

      235500 -- (-1336.965) (-1343.353) [-1337.698] (-1337.212) * [-1337.134] (-1339.055) (-1342.002) (-1336.964) -- 0:00:48
      236000 -- (-1337.179) (-1342.627) (-1338.389) [-1339.857] * [-1337.215] (-1340.242) (-1338.608) (-1337.042) -- 0:00:48
      236500 -- (-1339.988) (-1337.895) (-1341.287) [-1337.829] * (-1337.220) [-1337.885] (-1340.619) (-1337.249) -- 0:00:48
      237000 -- (-1339.053) [-1337.830] (-1339.719) (-1342.603) * (-1338.528) [-1339.642] (-1341.910) (-1338.532) -- 0:00:48
      237500 -- (-1336.458) (-1336.562) [-1338.865] (-1341.506) * (-1340.264) (-1337.725) [-1338.310] (-1341.276) -- 0:00:48
      238000 -- (-1338.064) [-1340.882] (-1338.436) (-1341.530) * [-1339.182] (-1336.677) (-1336.938) (-1341.629) -- 0:00:48
      238500 -- (-1341.128) [-1339.419] (-1339.106) (-1342.362) * (-1342.365) [-1336.626] (-1337.802) (-1341.080) -- 0:00:47
      239000 -- [-1336.580] (-1343.315) (-1338.309) (-1342.201) * (-1342.932) (-1338.492) (-1337.763) [-1336.309] -- 0:00:47
      239500 -- [-1336.580] (-1337.297) (-1338.305) (-1338.581) * (-1339.785) [-1340.656] (-1337.427) (-1338.153) -- 0:00:47
      240000 -- [-1336.460] (-1339.568) (-1339.040) (-1338.033) * (-1340.378) (-1337.307) (-1337.988) [-1337.933] -- 0:00:47

      Average standard deviation of split frequencies: 0.020861

      240500 -- [-1337.978] (-1340.518) (-1339.115) (-1341.793) * (-1338.387) [-1339.510] (-1338.754) (-1337.379) -- 0:00:47
      241000 -- (-1339.831) (-1340.929) (-1341.377) [-1338.407] * (-1336.689) (-1337.410) (-1342.487) [-1336.905] -- 0:00:47
      241500 -- (-1339.778) [-1339.728] (-1340.802) (-1338.010) * (-1338.215) (-1336.858) (-1339.726) [-1337.779] -- 0:00:47
      242000 -- (-1340.352) (-1339.099) (-1340.113) [-1337.761] * (-1340.022) [-1338.608] (-1340.863) (-1338.957) -- 0:00:50
      242500 -- (-1339.496) (-1339.816) (-1337.171) [-1337.982] * (-1338.925) [-1339.657] (-1338.426) (-1338.661) -- 0:00:49
      243000 -- (-1336.703) (-1340.031) [-1337.138] (-1337.786) * (-1339.389) (-1339.653) [-1338.347] (-1338.899) -- 0:00:49
      243500 -- (-1336.251) [-1337.187] (-1336.698) (-1337.435) * (-1337.152) (-1338.647) (-1340.961) [-1336.689] -- 0:00:49
      244000 -- [-1338.034] (-1339.453) (-1341.239) (-1337.101) * (-1337.051) [-1336.761] (-1337.495) (-1338.105) -- 0:00:49
      244500 -- (-1341.228) (-1338.224) [-1341.734] (-1339.463) * [-1338.043] (-1337.058) (-1337.083) (-1337.071) -- 0:00:49
      245000 -- (-1339.904) (-1338.438) (-1340.988) [-1338.182] * (-1343.998) [-1336.974] (-1336.853) (-1338.674) -- 0:00:49

      Average standard deviation of split frequencies: 0.020504

      245500 -- (-1338.666) [-1340.389] (-1340.403) (-1337.863) * (-1340.133) [-1337.405] (-1338.389) (-1339.931) -- 0:00:49
      246000 -- (-1338.163) [-1341.035] (-1337.443) (-1338.975) * (-1339.425) (-1340.954) (-1338.865) [-1337.968] -- 0:00:49
      246500 -- (-1339.196) (-1340.411) [-1337.612] (-1338.147) * [-1338.821] (-1342.669) (-1339.031) (-1340.920) -- 0:00:48
      247000 -- (-1341.432) (-1341.006) [-1340.160] (-1337.643) * (-1341.256) (-1340.235) [-1340.335] (-1337.793) -- 0:00:48
      247500 -- (-1338.745) (-1340.234) (-1339.151) [-1337.922] * (-1340.316) (-1339.464) (-1336.950) [-1336.944] -- 0:00:48
      248000 -- (-1338.554) [-1342.434] (-1341.966) (-1341.909) * (-1338.607) (-1340.296) [-1337.644] (-1337.645) -- 0:00:48
      248500 -- (-1337.781) [-1339.259] (-1339.932) (-1337.755) * (-1336.588) (-1341.457) [-1338.442] (-1341.627) -- 0:00:48
      249000 -- (-1337.757) (-1337.114) [-1341.375] (-1337.520) * [-1338.498] (-1349.121) (-1336.756) (-1338.683) -- 0:00:48
      249500 -- (-1336.509) [-1337.755] (-1341.352) (-1338.709) * (-1341.510) (-1337.178) (-1337.578) [-1341.565] -- 0:00:48
      250000 -- (-1337.971) [-1338.830] (-1340.233) (-1339.679) * (-1338.467) [-1336.607] (-1338.428) (-1339.610) -- 0:00:48

      Average standard deviation of split frequencies: 0.020122

      250500 -- (-1336.752) (-1339.416) [-1338.447] (-1341.138) * (-1337.494) [-1338.424] (-1338.279) (-1343.854) -- 0:00:47
      251000 -- (-1337.232) (-1337.684) (-1341.520) [-1337.491] * (-1344.972) [-1338.070] (-1337.045) (-1339.862) -- 0:00:47
      251500 -- (-1337.210) (-1336.108) (-1339.150) [-1337.503] * (-1338.191) (-1341.994) [-1336.739] (-1338.194) -- 0:00:47
      252000 -- (-1337.888) [-1337.111] (-1344.387) (-1337.387) * (-1339.168) (-1338.854) [-1339.996] (-1343.429) -- 0:00:47
      252500 -- (-1337.053) (-1337.808) (-1339.345) [-1337.542] * (-1337.982) (-1338.151) [-1336.898] (-1338.893) -- 0:00:47
      253000 -- (-1338.051) (-1337.799) (-1341.402) [-1337.604] * (-1340.347) (-1341.053) (-1339.177) [-1340.558] -- 0:00:47
      253500 -- (-1337.818) [-1337.212] (-1342.615) (-1339.527) * [-1339.468] (-1341.059) (-1337.619) (-1339.344) -- 0:00:47
      254000 -- (-1338.496) [-1337.661] (-1338.283) (-1337.250) * (-1339.195) (-1338.402) [-1337.313] (-1336.526) -- 0:00:46
      254500 -- (-1340.646) (-1339.698) (-1337.954) [-1338.108] * (-1339.209) (-1337.935) (-1339.969) [-1336.424] -- 0:00:46
      255000 -- (-1336.800) (-1339.468) [-1337.535] (-1338.265) * (-1339.140) (-1338.015) (-1338.779) [-1336.471] -- 0:00:46

      Average standard deviation of split frequencies: 0.019868

      255500 -- (-1337.250) [-1344.362] (-1337.155) (-1338.555) * (-1339.089) [-1337.868] (-1339.189) (-1338.340) -- 0:00:46
      256000 -- (-1338.838) (-1344.607) (-1343.577) [-1339.777] * [-1337.562] (-1341.325) (-1340.624) (-1339.303) -- 0:00:46
      256500 -- (-1338.389) (-1338.921) [-1339.198] (-1342.214) * (-1336.983) (-1337.957) [-1338.213] (-1337.246) -- 0:00:46
      257000 -- (-1336.795) [-1341.370] (-1338.137) (-1340.120) * (-1337.137) (-1338.202) (-1337.853) [-1336.739] -- 0:00:46
      257500 -- (-1337.938) [-1338.520] (-1339.185) (-1338.154) * [-1339.325] (-1341.975) (-1339.566) (-1337.556) -- 0:00:46
      258000 -- (-1336.650) (-1337.629) [-1337.990] (-1337.025) * (-1338.385) (-1340.358) (-1338.044) [-1337.652] -- 0:00:48
      258500 -- (-1337.892) (-1337.815) [-1336.770] (-1337.219) * (-1337.412) [-1336.565] (-1338.908) (-1337.221) -- 0:00:48
      259000 -- (-1340.072) (-1337.622) [-1337.946] (-1339.040) * (-1338.822) (-1340.409) (-1338.076) [-1337.553] -- 0:00:48
      259500 -- [-1338.680] (-1338.798) (-1336.802) (-1338.485) * (-1337.899) (-1338.532) (-1337.113) [-1339.562] -- 0:00:48
      260000 -- (-1339.992) [-1338.107] (-1336.616) (-1340.470) * (-1337.235) (-1336.521) (-1339.774) [-1338.140] -- 0:00:48

      Average standard deviation of split frequencies: 0.019893

      260500 -- (-1339.273) [-1339.520] (-1338.773) (-1337.939) * (-1337.239) (-1337.828) [-1339.949] (-1340.097) -- 0:00:48
      261000 -- [-1337.371] (-1339.719) (-1337.250) (-1337.095) * (-1338.547) (-1341.325) [-1340.250] (-1337.271) -- 0:00:48
      261500 -- [-1338.284] (-1339.157) (-1340.689) (-1338.574) * (-1336.618) (-1339.529) [-1338.264] (-1338.423) -- 0:00:48
      262000 -- [-1339.111] (-1338.009) (-1340.549) (-1337.524) * (-1337.469) [-1339.406] (-1339.565) (-1338.117) -- 0:00:47
      262500 -- (-1338.814) [-1337.863] (-1340.587) (-1337.751) * [-1336.456] (-1339.057) (-1338.663) (-1340.283) -- 0:00:47
      263000 -- (-1341.124) (-1343.728) (-1337.577) [-1337.101] * (-1336.435) (-1342.669) [-1337.407] (-1337.353) -- 0:00:47
      263500 -- (-1339.510) (-1337.907) [-1337.131] (-1337.696) * [-1336.952] (-1338.865) (-1343.488) (-1337.384) -- 0:00:47
      264000 -- (-1337.730) [-1336.511] (-1338.258) (-1342.007) * (-1339.700) (-1339.547) (-1342.285) [-1337.123] -- 0:00:47
      264500 -- [-1338.882] (-1338.518) (-1337.422) (-1341.553) * [-1339.302] (-1341.327) (-1341.997) (-1338.175) -- 0:00:47
      265000 -- [-1340.054] (-1336.960) (-1337.249) (-1344.236) * (-1336.749) (-1340.700) [-1339.856] (-1338.052) -- 0:00:47

      Average standard deviation of split frequencies: 0.019986

      265500 -- [-1338.792] (-1341.173) (-1336.565) (-1340.196) * [-1338.811] (-1340.369) (-1337.534) (-1341.780) -- 0:00:47
      266000 -- [-1339.710] (-1341.388) (-1336.886) (-1337.158) * (-1336.828) [-1337.645] (-1338.634) (-1340.443) -- 0:00:46
      266500 -- (-1338.182) (-1339.081) (-1337.586) [-1337.131] * (-1339.760) (-1342.603) (-1337.557) [-1339.543] -- 0:00:46
      267000 -- [-1338.718] (-1341.863) (-1337.039) (-1337.691) * [-1338.019] (-1341.400) (-1337.422) (-1337.331) -- 0:00:46
      267500 -- (-1339.487) (-1337.023) [-1337.032] (-1337.886) * (-1337.921) (-1341.670) (-1337.806) [-1338.123] -- 0:00:46
      268000 -- (-1336.324) [-1337.483] (-1337.051) (-1342.009) * [-1336.964] (-1338.950) (-1340.771) (-1343.273) -- 0:00:46
      268500 -- (-1336.396) [-1340.199] (-1337.815) (-1338.529) * (-1341.366) (-1340.588) (-1337.970) [-1340.302] -- 0:00:46
      269000 -- (-1336.807) (-1338.064) (-1337.811) [-1337.753] * (-1341.160) [-1339.256] (-1340.083) (-1338.597) -- 0:00:46
      269500 -- (-1337.251) (-1343.997) [-1337.344] (-1338.352) * (-1342.572) (-1338.776) [-1337.145] (-1339.666) -- 0:00:46
      270000 -- [-1336.972] (-1338.762) (-1337.358) (-1341.052) * [-1337.668] (-1337.908) (-1337.536) (-1338.714) -- 0:00:45

      Average standard deviation of split frequencies: 0.019642

      270500 -- (-1337.572) [-1337.137] (-1337.138) (-1340.127) * (-1339.431) (-1337.916) (-1339.716) [-1340.137] -- 0:00:45
      271000 -- (-1340.442) (-1339.439) (-1339.519) [-1341.510] * (-1336.882) (-1337.352) (-1341.249) [-1339.079] -- 0:00:45
      271500 -- (-1340.169) [-1338.469] (-1339.198) (-1339.217) * (-1336.903) (-1341.024) (-1340.265) [-1338.501] -- 0:00:45
      272000 -- (-1338.478) (-1337.125) (-1339.157) [-1340.228] * (-1341.260) (-1338.699) [-1337.701] (-1337.866) -- 0:00:45
      272500 -- (-1345.601) [-1338.611] (-1337.559) (-1337.036) * (-1341.931) (-1341.647) [-1338.457] (-1337.044) -- 0:00:45
      273000 -- (-1340.432) (-1339.207) [-1337.978] (-1337.256) * (-1337.274) (-1339.569) (-1337.460) [-1337.273] -- 0:00:45
      273500 -- [-1338.994] (-1338.595) (-1339.041) (-1337.393) * (-1337.042) (-1339.571) [-1340.088] (-1339.748) -- 0:00:47
      274000 -- (-1338.813) (-1339.016) [-1338.378] (-1337.393) * [-1337.008] (-1339.033) (-1340.267) (-1340.384) -- 0:00:47
      274500 -- (-1337.085) (-1339.470) (-1338.939) [-1339.793] * [-1337.451] (-1338.540) (-1340.601) (-1337.577) -- 0:00:47
      275000 -- (-1337.656) [-1339.924] (-1338.613) (-1338.112) * [-1337.689] (-1341.744) (-1339.278) (-1337.898) -- 0:00:47

      Average standard deviation of split frequencies: 0.020875

      275500 -- (-1337.535) (-1343.301) (-1338.613) [-1337.940] * (-1339.359) [-1339.751] (-1338.082) (-1339.125) -- 0:00:47
      276000 -- [-1338.304] (-1343.717) (-1338.238) (-1338.406) * (-1337.436) (-1344.533) (-1338.773) [-1337.616] -- 0:00:47
      276500 -- (-1337.782) [-1340.793] (-1338.662) (-1344.269) * (-1337.495) [-1337.139] (-1340.676) (-1337.629) -- 0:00:47
      277000 -- [-1337.009] (-1341.842) (-1338.552) (-1337.578) * (-1337.228) [-1337.681] (-1343.118) (-1336.941) -- 0:00:46
      277500 -- (-1338.781) (-1339.435) [-1337.420] (-1338.284) * (-1336.612) [-1336.404] (-1340.495) (-1340.529) -- 0:00:46
      278000 -- (-1339.379) (-1339.311) [-1337.648] (-1338.939) * (-1337.383) [-1337.502] (-1341.666) (-1339.050) -- 0:00:46
      278500 -- (-1338.268) (-1339.765) [-1337.082] (-1340.677) * (-1338.722) [-1341.636] (-1340.198) (-1337.473) -- 0:00:46
      279000 -- (-1339.820) (-1337.306) [-1338.641] (-1339.382) * (-1341.622) [-1338.169] (-1340.693) (-1336.777) -- 0:00:46
      279500 -- (-1337.938) (-1338.402) [-1337.943] (-1338.147) * (-1341.121) (-1339.870) (-1342.747) [-1340.290] -- 0:00:46
      280000 -- (-1337.664) (-1342.904) [-1338.498] (-1338.106) * (-1343.388) (-1337.663) (-1340.645) [-1340.830] -- 0:00:46

      Average standard deviation of split frequencies: 0.019689

      280500 -- (-1337.664) (-1342.012) [-1338.613] (-1339.145) * [-1338.437] (-1338.772) (-1339.043) (-1343.653) -- 0:00:46
      281000 -- (-1336.901) [-1338.838] (-1340.893) (-1342.840) * [-1337.727] (-1338.751) (-1340.328) (-1342.014) -- 0:00:46
      281500 -- (-1337.112) [-1337.859] (-1339.965) (-1339.969) * (-1336.591) [-1336.737] (-1338.547) (-1338.520) -- 0:00:45
      282000 -- (-1338.736) (-1337.746) (-1337.350) [-1338.951] * (-1341.224) (-1336.415) [-1339.171] (-1340.616) -- 0:00:45
      282500 -- (-1338.999) (-1337.687) [-1336.970] (-1340.761) * (-1338.029) (-1339.870) [-1340.499] (-1337.278) -- 0:00:45
      283000 -- (-1338.701) (-1338.752) (-1339.844) [-1342.428] * (-1338.811) (-1337.697) (-1343.488) [-1338.122] -- 0:00:45
      283500 -- (-1338.993) (-1337.664) (-1340.858) [-1340.507] * (-1339.447) [-1339.227] (-1340.193) (-1342.156) -- 0:00:45
      284000 -- (-1338.334) [-1337.218] (-1342.822) (-1340.593) * (-1339.180) [-1338.553] (-1340.304) (-1339.130) -- 0:00:45
      284500 -- (-1336.855) (-1338.715) (-1339.263) [-1336.687] * (-1343.861) (-1339.920) (-1339.076) [-1339.119] -- 0:00:45
      285000 -- [-1339.373] (-1340.417) (-1340.002) (-1336.828) * (-1343.910) (-1339.661) (-1338.213) [-1339.119] -- 0:00:45

      Average standard deviation of split frequencies: 0.019230

      285500 -- (-1336.902) (-1337.572) (-1336.508) [-1336.629] * (-1337.607) (-1337.564) [-1339.225] (-1340.354) -- 0:00:45
      286000 -- (-1340.514) (-1337.957) (-1336.556) [-1338.216] * (-1337.897) (-1338.192) [-1337.989] (-1338.498) -- 0:00:44
      286500 -- (-1336.943) (-1338.206) [-1337.484] (-1343.031) * [-1341.515] (-1337.988) (-1338.869) (-1338.595) -- 0:00:44
      287000 -- (-1336.525) (-1336.869) [-1337.091] (-1342.104) * [-1338.795] (-1337.947) (-1339.354) (-1341.665) -- 0:00:44
      287500 -- (-1337.252) [-1336.910] (-1338.423) (-1339.671) * (-1338.048) [-1338.044] (-1338.781) (-1339.524) -- 0:00:44
      288000 -- (-1336.337) [-1336.774] (-1339.806) (-1340.638) * (-1338.267) [-1338.304] (-1344.504) (-1340.696) -- 0:00:44
      288500 -- (-1336.337) [-1337.783] (-1339.364) (-1346.907) * (-1341.689) (-1340.744) (-1341.542) [-1341.259] -- 0:00:44
      289000 -- (-1336.337) (-1337.111) [-1339.466] (-1339.996) * (-1338.707) (-1339.277) (-1339.220) [-1336.136] -- 0:00:44
      289500 -- (-1336.471) (-1337.992) [-1337.428] (-1337.460) * (-1339.550) (-1338.593) (-1341.157) [-1341.203] -- 0:00:44
      290000 -- [-1341.661] (-1337.230) (-1339.712) (-1337.492) * (-1340.015) (-1339.928) (-1340.272) [-1340.903] -- 0:00:46

      Average standard deviation of split frequencies: 0.018471

      290500 -- (-1341.780) (-1338.172) [-1337.131] (-1337.390) * [-1340.175] (-1337.028) (-1340.049) (-1338.271) -- 0:00:46
      291000 -- (-1340.552) (-1337.467) (-1337.403) [-1339.818] * [-1337.075] (-1337.101) (-1343.324) (-1340.549) -- 0:00:46
      291500 -- (-1344.221) (-1341.198) [-1337.612] (-1339.130) * (-1336.928) (-1337.256) (-1341.272) [-1336.690] -- 0:00:46
      292000 -- (-1341.436) (-1339.649) [-1341.565] (-1338.951) * (-1336.755) [-1337.333] (-1340.978) (-1340.618) -- 0:00:46
      292500 -- [-1338.088] (-1339.208) (-1337.282) (-1339.981) * [-1337.402] (-1337.302) (-1338.573) (-1337.353) -- 0:00:45
      293000 -- [-1337.877] (-1337.541) (-1338.733) (-1336.910) * [-1337.845] (-1340.101) (-1337.484) (-1338.659) -- 0:00:45
      293500 -- [-1338.167] (-1339.058) (-1340.343) (-1338.451) * (-1340.312) (-1338.265) [-1337.987] (-1338.907) -- 0:00:45
      294000 -- (-1339.016) (-1340.231) [-1338.458] (-1339.110) * (-1339.198) (-1341.175) [-1336.667] (-1340.699) -- 0:00:45
      294500 -- (-1337.992) (-1339.788) [-1338.068] (-1339.475) * (-1338.947) (-1339.751) [-1340.762] (-1341.582) -- 0:00:45
      295000 -- (-1337.427) [-1336.583] (-1338.054) (-1342.782) * (-1337.324) (-1337.317) (-1337.963) [-1338.119] -- 0:00:45

      Average standard deviation of split frequencies: 0.018138

      295500 -- [-1338.041] (-1339.844) (-1338.106) (-1339.986) * (-1339.762) [-1337.566] (-1337.527) (-1339.042) -- 0:00:45
      296000 -- [-1338.354] (-1337.509) (-1342.560) (-1338.928) * (-1337.403) [-1337.429] (-1338.125) (-1339.802) -- 0:00:45
      296500 -- (-1338.416) [-1338.679] (-1341.101) (-1341.230) * (-1337.095) (-1339.358) [-1338.147] (-1337.200) -- 0:00:45
      297000 -- (-1341.183) (-1343.195) [-1339.212] (-1341.699) * (-1337.360) [-1337.312] (-1338.410) (-1338.620) -- 0:00:44
      297500 -- (-1338.467) (-1341.080) [-1339.513] (-1345.463) * (-1338.895) (-1336.613) (-1337.484) [-1339.755] -- 0:00:44
      298000 -- (-1338.136) [-1341.323] (-1338.931) (-1338.261) * (-1338.995) [-1336.656] (-1338.980) (-1337.275) -- 0:00:44
      298500 -- (-1339.775) (-1343.227) (-1338.474) [-1339.399] * (-1336.920) (-1337.036) (-1337.533) [-1338.309] -- 0:00:44
      299000 -- (-1342.204) [-1338.931] (-1338.053) (-1340.445) * (-1337.871) (-1336.194) (-1337.802) [-1336.829] -- 0:00:44
      299500 -- (-1337.268) (-1338.210) (-1339.959) [-1337.332] * (-1336.901) [-1336.272] (-1340.664) (-1336.305) -- 0:00:44
      300000 -- (-1339.081) [-1338.597] (-1339.689) (-1337.818) * (-1336.950) (-1336.922) [-1337.811] (-1338.693) -- 0:00:44

      Average standard deviation of split frequencies: 0.018077

      300500 -- (-1337.740) [-1338.843] (-1342.905) (-1340.682) * (-1340.794) [-1336.409] (-1340.099) (-1345.790) -- 0:00:44
      301000 -- (-1339.135) [-1338.647] (-1343.371) (-1341.349) * (-1338.334) [-1340.491] (-1337.714) (-1338.567) -- 0:00:44
      301500 -- [-1336.909] (-1337.724) (-1338.228) (-1344.108) * (-1337.303) (-1341.749) (-1342.859) [-1338.612] -- 0:00:44
      302000 -- (-1338.256) (-1340.783) [-1338.167] (-1344.857) * (-1338.910) (-1338.848) [-1337.618] (-1339.340) -- 0:00:43
      302500 -- (-1340.275) (-1337.976) (-1343.983) [-1338.310] * [-1337.850] (-1338.359) (-1337.171) (-1337.482) -- 0:00:43
      303000 -- (-1344.378) (-1338.742) [-1338.630] (-1338.884) * (-1341.456) (-1339.766) (-1338.724) [-1339.163] -- 0:00:43
      303500 -- (-1339.602) (-1338.730) (-1340.544) [-1338.627] * (-1341.559) (-1341.929) [-1340.255] (-1341.443) -- 0:00:43
      304000 -- (-1339.373) (-1338.625) [-1340.481] (-1339.522) * [-1336.991] (-1337.192) (-1341.186) (-1341.969) -- 0:00:43
      304500 -- (-1338.638) (-1338.881) (-1337.109) [-1339.424] * (-1337.474) [-1336.067] (-1338.605) (-1340.561) -- 0:00:43
      305000 -- [-1336.377] (-1337.497) (-1338.432) (-1339.154) * [-1337.434] (-1336.759) (-1339.572) (-1341.319) -- 0:00:43

      Average standard deviation of split frequencies: 0.017757

      305500 -- (-1336.377) (-1338.878) (-1341.680) [-1339.522] * (-1338.864) (-1340.907) (-1337.046) [-1338.592] -- 0:00:45
      306000 -- (-1337.789) [-1337.857] (-1337.949) (-1338.354) * [-1338.903] (-1337.374) (-1337.414) (-1341.887) -- 0:00:45
      306500 -- (-1341.053) [-1337.399] (-1337.604) (-1338.099) * (-1337.384) [-1338.202] (-1339.027) (-1341.887) -- 0:00:45
      307000 -- (-1340.672) (-1338.614) [-1337.629] (-1337.313) * (-1337.109) [-1337.283] (-1338.515) (-1341.210) -- 0:00:45
      307500 -- (-1337.456) [-1338.800] (-1341.839) (-1336.559) * (-1342.314) [-1337.786] (-1340.206) (-1341.723) -- 0:00:45
      308000 -- (-1337.785) [-1336.980] (-1338.261) (-1336.282) * [-1337.995] (-1340.431) (-1337.176) (-1345.152) -- 0:00:44
      308500 -- (-1340.849) [-1339.795] (-1338.583) (-1339.806) * (-1340.300) (-1339.917) (-1338.791) [-1340.089] -- 0:00:44
      309000 -- (-1339.736) (-1340.391) [-1340.580] (-1337.721) * (-1338.898) [-1337.447] (-1338.602) (-1337.849) -- 0:00:44
      309500 -- (-1338.720) [-1340.552] (-1337.254) (-1338.634) * (-1338.075) [-1336.992] (-1338.640) (-1339.618) -- 0:00:44
      310000 -- (-1339.981) (-1342.456) (-1338.534) [-1338.204] * (-1338.564) [-1337.500] (-1338.494) (-1340.043) -- 0:00:44

      Average standard deviation of split frequencies: 0.016354

      310500 -- (-1339.666) [-1337.994] (-1340.617) (-1339.287) * [-1341.458] (-1338.377) (-1336.750) (-1341.372) -- 0:00:44
      311000 -- (-1338.359) (-1339.021) [-1336.172] (-1340.324) * (-1340.418) [-1337.517] (-1339.253) (-1336.535) -- 0:00:44
      311500 -- (-1338.202) [-1338.906] (-1337.074) (-1337.608) * (-1341.921) (-1337.992) [-1339.117] (-1341.012) -- 0:00:44
      312000 -- (-1340.374) (-1338.203) [-1336.667] (-1339.882) * (-1337.559) (-1338.441) [-1342.434] (-1337.756) -- 0:00:44
      312500 -- (-1339.279) [-1338.650] (-1336.668) (-1339.408) * [-1338.722] (-1338.578) (-1340.628) (-1338.255) -- 0:00:44
      313000 -- (-1339.088) (-1337.682) (-1340.206) [-1338.805] * (-1336.789) [-1338.533] (-1342.423) (-1340.508) -- 0:00:43
      313500 -- (-1340.868) (-1337.314) [-1338.299] (-1338.809) * [-1338.391] (-1342.309) (-1337.883) (-1338.494) -- 0:00:43
      314000 -- (-1337.799) (-1343.534) [-1337.615] (-1339.656) * (-1339.305) (-1336.522) (-1341.227) [-1337.267] -- 0:00:43
      314500 -- (-1340.689) (-1339.289) [-1337.891] (-1338.761) * [-1339.758] (-1338.865) (-1337.958) (-1339.337) -- 0:00:43
      315000 -- [-1338.059] (-1339.663) (-1340.704) (-1342.072) * (-1339.086) (-1337.570) (-1339.291) [-1337.765] -- 0:00:43

      Average standard deviation of split frequencies: 0.015357

      315500 -- (-1340.914) (-1341.875) [-1337.078] (-1338.253) * [-1338.062] (-1338.141) (-1337.238) (-1338.468) -- 0:00:43
      316000 -- [-1339.304] (-1336.830) (-1338.150) (-1339.342) * (-1337.927) (-1338.141) [-1337.244] (-1340.229) -- 0:00:43
      316500 -- (-1337.261) (-1340.768) (-1341.146) [-1338.653] * (-1337.565) (-1339.076) [-1337.298] (-1340.528) -- 0:00:43
      317000 -- (-1337.858) (-1339.263) (-1343.035) [-1337.299] * (-1338.470) (-1337.440) (-1337.200) [-1337.784] -- 0:00:43
      317500 -- (-1336.623) (-1338.493) (-1342.390) [-1339.265] * (-1342.842) (-1336.876) [-1337.486] (-1339.915) -- 0:00:42
      318000 -- [-1341.447] (-1338.585) (-1338.102) (-1339.906) * (-1338.849) (-1337.922) (-1337.182) [-1339.097] -- 0:00:42
      318500 -- (-1340.938) (-1336.803) [-1339.308] (-1338.390) * (-1337.417) (-1338.889) [-1336.859] (-1342.577) -- 0:00:42
      319000 -- (-1342.721) (-1336.895) [-1338.556] (-1339.083) * (-1337.971) (-1337.641) [-1337.076] (-1337.130) -- 0:00:42
      319500 -- (-1340.215) (-1336.837) [-1337.318] (-1338.616) * (-1339.984) [-1337.498] (-1337.551) (-1341.798) -- 0:00:42
      320000 -- [-1338.079] (-1339.765) (-1339.215) (-1338.950) * (-1337.589) (-1337.921) (-1337.162) [-1338.567] -- 0:00:42

      Average standard deviation of split frequencies: 0.016171

      320500 -- [-1339.480] (-1338.028) (-1337.456) (-1339.070) * (-1338.132) (-1339.852) (-1336.879) [-1337.841] -- 0:00:42
      321000 -- (-1337.140) (-1340.315) (-1337.628) [-1341.656] * (-1336.486) (-1337.467) [-1336.674] (-1337.724) -- 0:00:44
      321500 -- (-1337.282) (-1341.466) [-1336.726] (-1338.233) * (-1337.058) (-1338.313) [-1336.809] (-1338.315) -- 0:00:44
      322000 -- (-1338.916) [-1339.261] (-1337.073) (-1337.950) * (-1336.746) [-1338.519] (-1336.864) (-1338.542) -- 0:00:44
      322500 -- (-1338.302) (-1340.711) [-1337.468] (-1338.084) * [-1338.600] (-1338.519) (-1338.995) (-1336.806) -- 0:00:44
      323000 -- (-1338.819) [-1337.234] (-1337.751) (-1338.625) * [-1338.598] (-1342.701) (-1339.270) (-1338.294) -- 0:00:44
      323500 -- [-1339.199] (-1336.713) (-1338.830) (-1336.677) * [-1338.885] (-1337.367) (-1338.867) (-1343.711) -- 0:00:43
      324000 -- (-1337.277) (-1337.162) [-1337.993] (-1339.680) * (-1340.937) (-1339.043) (-1338.396) [-1339.541] -- 0:00:43
      324500 -- (-1341.466) [-1337.570] (-1338.221) (-1340.380) * (-1340.734) (-1343.493) [-1337.397] (-1339.663) -- 0:00:43
      325000 -- [-1341.258] (-1337.164) (-1339.456) (-1342.068) * (-1338.085) (-1343.581) (-1336.998) [-1338.728] -- 0:00:43

      Average standard deviation of split frequencies: 0.014993

      325500 -- (-1336.459) (-1338.363) (-1337.995) [-1337.105] * (-1342.653) [-1338.738] (-1337.172) (-1337.348) -- 0:00:43
      326000 -- [-1338.170] (-1340.917) (-1339.081) (-1339.603) * (-1339.687) (-1339.075) [-1337.007] (-1341.949) -- 0:00:43
      326500 -- (-1340.476) (-1339.421) (-1337.656) [-1341.474] * [-1337.136] (-1337.676) (-1337.389) (-1339.698) -- 0:00:43
      327000 -- [-1338.494] (-1339.073) (-1342.674) (-1338.230) * (-1340.185) (-1339.317) (-1338.028) [-1337.268] -- 0:00:43
      327500 -- (-1340.292) [-1337.711] (-1340.361) (-1338.197) * (-1338.276) [-1338.928] (-1338.388) (-1338.330) -- 0:00:43
      328000 -- (-1338.563) [-1338.299] (-1337.145) (-1336.846) * [-1336.591] (-1338.917) (-1338.932) (-1337.629) -- 0:00:43
      328500 -- (-1339.645) [-1337.480] (-1342.613) (-1336.995) * (-1336.388) [-1339.050] (-1338.539) (-1337.830) -- 0:00:42
      329000 -- (-1338.928) [-1342.228] (-1339.160) (-1339.770) * (-1339.225) [-1337.058] (-1340.149) (-1340.469) -- 0:00:42
      329500 -- (-1336.872) (-1340.960) [-1338.513] (-1339.962) * (-1339.429) (-1338.645) (-1337.464) [-1340.162] -- 0:00:42
      330000 -- (-1338.053) [-1337.926] (-1338.147) (-1340.338) * (-1340.282) (-1338.139) [-1338.132] (-1342.042) -- 0:00:42

      Average standard deviation of split frequencies: 0.016127

      330500 -- (-1341.378) (-1343.966) (-1337.261) [-1337.780] * (-1337.419) (-1339.210) (-1337.568) [-1337.821] -- 0:00:42
      331000 -- (-1342.738) (-1339.773) (-1338.515) [-1337.264] * (-1338.599) (-1344.241) [-1338.265] (-1338.386) -- 0:00:42
      331500 -- (-1338.851) (-1338.223) (-1337.587) [-1336.664] * (-1336.238) [-1340.116] (-1341.902) (-1340.912) -- 0:00:42
      332000 -- (-1337.983) [-1338.985] (-1338.338) (-1337.604) * (-1339.013) [-1339.132] (-1340.667) (-1339.958) -- 0:00:42
      332500 -- (-1336.758) (-1337.415) (-1337.445) [-1339.325] * (-1337.808) (-1337.381) [-1340.767] (-1337.565) -- 0:00:42
      333000 -- (-1336.791) (-1336.175) (-1342.401) [-1342.293] * [-1337.682] (-1339.142) (-1336.702) (-1338.939) -- 0:00:42
      333500 -- (-1336.600) [-1338.128] (-1337.004) (-1345.004) * (-1338.795) (-1340.939) (-1337.373) [-1346.387] -- 0:00:41
      334000 -- (-1341.155) (-1339.473) (-1337.669) [-1339.928] * [-1338.630] (-1338.252) (-1338.513) (-1342.545) -- 0:00:41
      334500 -- [-1341.089] (-1338.466) (-1338.276) (-1342.500) * [-1338.352] (-1337.528) (-1338.262) (-1338.477) -- 0:00:41
      335000 -- (-1340.848) [-1338.008] (-1336.768) (-1346.518) * (-1336.929) (-1337.010) (-1339.351) [-1340.520] -- 0:00:41

      Average standard deviation of split frequencies: 0.015901

      335500 -- (-1337.595) (-1337.804) [-1337.603] (-1342.049) * (-1342.046) [-1339.939] (-1337.891) (-1339.737) -- 0:00:41
      336000 -- (-1338.188) (-1338.365) [-1337.361] (-1338.062) * [-1341.473] (-1340.221) (-1339.030) (-1338.507) -- 0:00:41
      336500 -- (-1341.501) (-1337.982) [-1338.208] (-1340.400) * [-1337.449] (-1338.447) (-1342.487) (-1341.433) -- 0:00:41
      337000 -- (-1339.298) (-1342.401) (-1337.164) [-1341.211] * [-1337.853] (-1337.788) (-1340.114) (-1343.608) -- 0:00:43
      337500 -- (-1337.037) (-1340.286) [-1339.192] (-1336.906) * [-1338.812] (-1338.634) (-1343.534) (-1337.631) -- 0:00:43
      338000 -- [-1340.669] (-1340.454) (-1340.828) (-1336.666) * [-1338.028] (-1338.278) (-1340.149) (-1337.576) -- 0:00:43
      338500 -- (-1338.247) (-1338.068) [-1340.318] (-1339.124) * (-1336.495) (-1338.352) [-1338.767] (-1338.002) -- 0:00:42
      339000 -- (-1338.788) [-1336.986] (-1338.148) (-1338.887) * [-1337.388] (-1337.720) (-1339.748) (-1342.960) -- 0:00:42
      339500 -- (-1344.451) (-1340.332) [-1337.033] (-1339.391) * [-1336.999] (-1336.228) (-1337.146) (-1338.738) -- 0:00:42
      340000 -- (-1342.381) [-1337.980] (-1342.646) (-1337.914) * (-1338.777) (-1338.057) (-1338.212) [-1336.567] -- 0:00:42

      Average standard deviation of split frequencies: 0.015481

      340500 -- (-1342.538) (-1338.479) [-1336.820] (-1337.932) * [-1345.804] (-1338.762) (-1338.605) (-1336.755) -- 0:00:42
      341000 -- [-1338.896] (-1338.237) (-1337.348) (-1338.338) * (-1338.631) (-1339.098) [-1341.593] (-1337.430) -- 0:00:42
      341500 -- [-1341.771] (-1339.661) (-1336.606) (-1339.119) * (-1339.156) (-1337.176) [-1338.079] (-1338.130) -- 0:00:42
      342000 -- (-1344.527) (-1340.599) [-1336.616] (-1337.078) * [-1339.558] (-1336.730) (-1338.489) (-1338.443) -- 0:00:42
      342500 -- (-1340.115) (-1338.965) [-1340.266] (-1342.128) * [-1339.062] (-1337.038) (-1338.064) (-1339.970) -- 0:00:42
      343000 -- (-1341.662) (-1343.752) [-1338.585] (-1340.934) * [-1337.341] (-1337.669) (-1338.870) (-1337.337) -- 0:00:42
      343500 -- (-1343.672) (-1338.475) [-1339.110] (-1337.936) * (-1339.009) [-1339.428] (-1338.813) (-1340.921) -- 0:00:42
      344000 -- [-1339.876] (-1337.677) (-1339.915) (-1337.936) * [-1343.179] (-1337.467) (-1338.276) (-1341.405) -- 0:00:41
      344500 -- [-1337.275] (-1337.261) (-1337.400) (-1337.364) * (-1342.108) [-1337.135] (-1337.583) (-1341.217) -- 0:00:41
      345000 -- (-1336.848) (-1338.144) [-1337.051] (-1336.734) * [-1338.161] (-1338.635) (-1338.921) (-1337.889) -- 0:00:41

      Average standard deviation of split frequencies: 0.016009

      345500 -- (-1336.651) (-1337.575) [-1341.420] (-1337.957) * (-1336.826) (-1339.092) (-1339.529) [-1337.692] -- 0:00:41
      346000 -- (-1337.714) (-1337.977) (-1343.661) [-1336.937] * (-1339.252) (-1338.116) (-1340.206) [-1338.659] -- 0:00:41
      346500 -- [-1340.276] (-1339.023) (-1347.323) (-1338.164) * (-1339.252) (-1340.164) [-1339.509] (-1343.063) -- 0:00:41
      347000 -- (-1339.592) (-1338.330) [-1340.948] (-1337.401) * (-1341.462) (-1341.113) [-1338.282] (-1339.714) -- 0:00:41
      347500 -- [-1337.517] (-1339.253) (-1343.035) (-1339.612) * (-1339.560) [-1339.116] (-1336.879) (-1337.698) -- 0:00:41
      348000 -- (-1341.167) (-1339.256) (-1345.103) [-1339.978] * (-1338.428) (-1339.831) (-1337.311) [-1338.503] -- 0:00:41
      348500 -- [-1337.994] (-1337.905) (-1345.969) (-1339.126) * (-1337.625) (-1339.578) [-1341.338] (-1338.230) -- 0:00:41
      349000 -- (-1338.494) (-1337.793) [-1341.179] (-1337.894) * [-1337.334] (-1341.144) (-1343.393) (-1336.966) -- 0:00:41
      349500 -- (-1337.157) [-1337.522] (-1336.565) (-1336.645) * (-1337.916) [-1338.000] (-1337.663) (-1338.216) -- 0:00:40
      350000 -- [-1337.425] (-1339.175) (-1337.257) (-1338.338) * (-1337.573) (-1337.580) (-1340.177) [-1338.099] -- 0:00:40

      Average standard deviation of split frequencies: 0.016216

      350500 -- (-1337.750) (-1339.854) (-1337.557) [-1339.894] * [-1341.524] (-1338.275) (-1339.070) (-1343.252) -- 0:00:40
      351000 -- (-1338.700) [-1340.516] (-1341.033) (-1342.728) * (-1338.347) [-1337.692] (-1337.029) (-1340.010) -- 0:00:40
      351500 -- (-1338.906) (-1338.185) [-1340.698] (-1338.960) * [-1337.746] (-1340.947) (-1339.746) (-1337.912) -- 0:00:40
      352000 -- (-1341.047) [-1337.496] (-1337.755) (-1337.973) * (-1337.746) (-1337.803) (-1340.693) [-1337.630] -- 0:00:40
      352500 -- (-1342.319) (-1340.188) (-1337.789) [-1340.036] * (-1338.844) (-1337.999) (-1341.295) [-1340.945] -- 0:00:40
      353000 -- [-1344.567] (-1337.689) (-1338.681) (-1342.853) * (-1339.228) (-1337.872) (-1342.426) [-1338.464] -- 0:00:42
      353500 -- (-1340.600) (-1337.346) (-1340.690) [-1338.238] * (-1337.133) (-1339.488) [-1340.967] (-1339.760) -- 0:00:42
      354000 -- [-1337.675] (-1338.485) (-1339.873) (-1339.233) * (-1338.684) (-1336.787) (-1343.499) [-1340.208] -- 0:00:41
      354500 -- (-1336.902) (-1339.799) (-1339.226) [-1336.785] * (-1339.865) (-1338.910) (-1338.561) [-1337.535] -- 0:00:41
      355000 -- (-1338.716) (-1339.861) (-1342.060) [-1336.827] * (-1337.631) [-1338.191] (-1344.057) (-1337.231) -- 0:00:41

      Average standard deviation of split frequencies: 0.015725

      355500 -- [-1337.219] (-1339.203) (-1341.393) (-1338.969) * (-1339.223) (-1337.450) (-1344.217) [-1338.676] -- 0:00:41
      356000 -- (-1336.644) (-1338.782) [-1342.373] (-1338.836) * [-1337.319] (-1338.607) (-1339.164) (-1338.397) -- 0:00:41
      356500 -- (-1336.660) (-1338.539) (-1337.896) [-1339.053] * (-1336.515) (-1339.457) [-1337.886] (-1339.507) -- 0:00:41
      357000 -- (-1339.759) (-1337.625) [-1337.661] (-1337.721) * (-1340.116) (-1340.383) (-1337.433) [-1339.984] -- 0:00:41
      357500 -- (-1338.437) (-1337.520) [-1338.736] (-1338.069) * (-1338.280) [-1339.018] (-1337.478) (-1337.135) -- 0:00:41
      358000 -- (-1340.657) (-1337.546) [-1338.822] (-1339.826) * (-1339.331) [-1339.298] (-1337.894) (-1337.008) -- 0:00:41
      358500 -- (-1341.041) (-1339.982) [-1339.614] (-1336.695) * [-1338.695] (-1340.709) (-1337.362) (-1338.333) -- 0:00:41
      359000 -- (-1338.121) (-1339.159) [-1339.339] (-1336.693) * [-1338.073] (-1345.131) (-1337.923) (-1341.625) -- 0:00:41
      359500 -- (-1337.812) [-1336.850] (-1337.979) (-1336.513) * (-1338.228) (-1340.731) (-1338.491) [-1336.474] -- 0:00:40
      360000 -- [-1338.462] (-1336.883) (-1338.766) (-1338.485) * (-1348.360) (-1344.106) [-1338.120] (-1336.432) -- 0:00:40

      Average standard deviation of split frequencies: 0.016093

      360500 -- [-1337.278] (-1337.808) (-1339.414) (-1339.478) * (-1342.237) (-1340.409) (-1339.653) [-1336.469] -- 0:00:40
      361000 -- (-1338.219) (-1338.333) (-1342.868) [-1337.312] * (-1339.322) [-1337.278] (-1340.222) (-1340.547) -- 0:00:40
      361500 -- (-1340.476) [-1338.256] (-1338.907) (-1338.256) * (-1337.070) (-1340.794) [-1340.186] (-1338.060) -- 0:00:40
      362000 -- [-1340.049] (-1337.347) (-1338.575) (-1339.580) * [-1337.321] (-1339.524) (-1340.014) (-1337.755) -- 0:00:40
      362500 -- [-1341.645] (-1344.066) (-1337.078) (-1340.171) * (-1341.543) (-1338.025) (-1340.555) [-1338.052] -- 0:00:40
      363000 -- (-1337.263) (-1344.804) (-1338.233) [-1337.780] * (-1338.132) [-1337.853] (-1338.260) (-1341.094) -- 0:00:40
      363500 -- (-1336.351) (-1345.029) (-1338.822) [-1338.148] * (-1341.060) (-1338.567) [-1339.960] (-1339.175) -- 0:00:40
      364000 -- [-1340.380] (-1341.884) (-1339.279) (-1338.560) * (-1340.985) (-1337.695) (-1341.135) [-1340.142] -- 0:00:40
      364500 -- [-1343.357] (-1342.964) (-1338.784) (-1337.609) * (-1338.621) [-1338.356] (-1337.672) (-1336.776) -- 0:00:40
      365000 -- (-1338.256) (-1336.871) [-1341.223] (-1337.163) * (-1338.259) (-1336.911) [-1339.219] (-1343.513) -- 0:00:40

      Average standard deviation of split frequencies: 0.016668

      365500 -- (-1339.757) [-1337.250] (-1340.577) (-1339.825) * [-1337.342] (-1346.034) (-1342.746) (-1349.312) -- 0:00:39
      366000 -- [-1340.015] (-1338.195) (-1340.833) (-1338.938) * (-1337.427) [-1337.121] (-1341.266) (-1340.108) -- 0:00:39
      366500 -- (-1338.484) [-1338.608] (-1340.058) (-1339.168) * [-1337.564] (-1337.488) (-1342.763) (-1341.430) -- 0:00:39
      367000 -- (-1338.851) (-1337.885) [-1338.613] (-1340.055) * (-1337.620) (-1336.441) (-1338.143) [-1338.299] -- 0:00:39
      367500 -- (-1338.432) (-1338.820) [-1339.042] (-1341.399) * [-1338.870] (-1337.037) (-1339.110) (-1341.238) -- 0:00:39
      368000 -- (-1340.231) (-1337.721) [-1339.861] (-1339.274) * (-1341.243) (-1337.612) [-1338.442] (-1337.545) -- 0:00:39
      368500 -- (-1342.428) (-1338.264) (-1341.475) [-1337.982] * (-1340.156) (-1338.173) [-1338.246] (-1338.803) -- 0:00:39
      369000 -- [-1336.947] (-1337.956) (-1337.997) (-1338.225) * (-1339.505) (-1337.228) [-1338.799] (-1341.048) -- 0:00:41
      369500 -- (-1337.010) (-1339.219) (-1339.043) [-1338.041] * (-1338.328) (-1338.606) (-1339.331) [-1342.516] -- 0:00:40
      370000 -- (-1337.428) (-1339.111) (-1340.068) [-1338.937] * [-1338.046] (-1338.082) (-1338.147) (-1339.998) -- 0:00:40

      Average standard deviation of split frequencies: 0.015710

      370500 -- (-1337.098) [-1337.626] (-1337.686) (-1342.075) * (-1339.862) (-1336.565) [-1336.893] (-1340.716) -- 0:00:40
      371000 -- (-1341.093) (-1338.872) [-1337.838] (-1338.150) * (-1338.359) (-1337.641) (-1343.454) [-1336.760] -- 0:00:40
      371500 -- [-1337.556] (-1338.188) (-1337.375) (-1337.471) * [-1338.563] (-1340.572) (-1336.182) (-1338.530) -- 0:00:40
      372000 -- (-1340.302) (-1336.868) (-1342.668) [-1338.787] * [-1339.079] (-1336.989) (-1337.111) (-1339.221) -- 0:00:40
      372500 -- (-1344.856) [-1336.992] (-1339.801) (-1338.872) * (-1343.569) (-1339.585) (-1342.174) [-1337.459] -- 0:00:40
      373000 -- (-1341.525) [-1337.081] (-1339.623) (-1338.629) * (-1339.373) [-1338.701] (-1337.380) (-1343.940) -- 0:00:40
      373500 -- (-1338.284) (-1338.264) (-1338.694) [-1338.700] * (-1336.686) (-1338.628) (-1337.923) [-1337.752] -- 0:00:40
      374000 -- [-1337.617] (-1339.307) (-1338.682) (-1341.155) * (-1337.306) (-1337.964) (-1337.713) [-1337.139] -- 0:00:40
      374500 -- (-1337.352) (-1339.143) [-1338.680] (-1339.483) * (-1340.187) [-1339.076] (-1338.760) (-1337.126) -- 0:00:40
      375000 -- [-1337.802] (-1338.733) (-1338.815) (-1338.564) * [-1337.940] (-1338.264) (-1337.749) (-1337.358) -- 0:00:40

      Average standard deviation of split frequencies: 0.017051

      375500 -- (-1337.072) [-1337.721] (-1339.997) (-1338.432) * [-1337.655] (-1340.968) (-1338.231) (-1339.634) -- 0:00:39
      376000 -- [-1337.628] (-1337.605) (-1343.362) (-1338.058) * (-1338.612) [-1337.498] (-1342.136) (-1340.898) -- 0:00:39
      376500 -- (-1338.641) (-1338.919) (-1338.867) [-1337.892] * (-1337.133) [-1337.419] (-1338.005) (-1339.557) -- 0:00:39
      377000 -- [-1338.364] (-1336.372) (-1338.928) (-1336.753) * [-1336.949] (-1338.335) (-1337.626) (-1337.788) -- 0:00:39
      377500 -- (-1341.548) (-1336.547) (-1338.478) [-1336.872] * [-1336.693] (-1336.513) (-1340.895) (-1338.563) -- 0:00:39
      378000 -- (-1340.941) [-1337.541] (-1338.091) (-1336.479) * (-1338.648) (-1337.366) (-1340.198) [-1342.103] -- 0:00:39
      378500 -- (-1341.347) (-1339.506) [-1339.902] (-1338.806) * (-1341.534) (-1336.332) (-1337.613) [-1338.114] -- 0:00:39
      379000 -- [-1337.429] (-1339.008) (-1337.719) (-1338.087) * [-1339.379] (-1336.332) (-1338.737) (-1337.640) -- 0:00:39
      379500 -- (-1339.703) (-1340.138) (-1338.981) [-1337.120] * (-1337.628) [-1336.416] (-1336.724) (-1338.918) -- 0:00:39
      380000 -- [-1339.073] (-1339.307) (-1339.378) (-1339.243) * (-1337.799) [-1336.395] (-1340.678) (-1337.490) -- 0:00:39

      Average standard deviation of split frequencies: 0.016021

      380500 -- [-1340.066] (-1337.351) (-1341.751) (-1339.073) * (-1338.722) (-1341.922) [-1337.277] (-1337.156) -- 0:00:39
      381000 -- [-1337.668] (-1338.658) (-1337.937) (-1337.994) * [-1338.211] (-1338.004) (-1338.463) (-1340.487) -- 0:00:38
      381500 -- [-1339.309] (-1336.753) (-1338.617) (-1338.311) * (-1338.196) (-1342.314) [-1337.644] (-1338.435) -- 0:00:38
      382000 -- [-1339.423] (-1338.291) (-1338.148) (-1339.911) * (-1337.379) (-1344.334) [-1338.487] (-1337.102) -- 0:00:38
      382500 -- (-1338.568) (-1337.462) [-1338.566] (-1337.180) * (-1337.919) (-1338.871) [-1339.905] (-1336.823) -- 0:00:38
      383000 -- [-1336.960] (-1337.494) (-1341.811) (-1338.828) * [-1338.093] (-1344.758) (-1341.359) (-1339.182) -- 0:00:38
      383500 -- (-1341.926) [-1338.294] (-1346.747) (-1337.334) * [-1340.354] (-1337.171) (-1340.824) (-1338.728) -- 0:00:38
      384000 -- (-1337.437) (-1337.701) [-1342.949] (-1339.440) * (-1338.772) (-1337.398) (-1340.335) [-1338.064] -- 0:00:38
      384500 -- (-1338.085) (-1339.609) (-1338.597) [-1338.315] * (-1342.253) [-1339.507] (-1338.075) (-1339.155) -- 0:00:38
      385000 -- (-1337.962) (-1342.001) [-1339.110] (-1338.952) * (-1338.648) (-1336.390) (-1339.319) [-1337.270] -- 0:00:39

      Average standard deviation of split frequencies: 0.015953

      385500 -- (-1337.142) (-1341.094) [-1337.516] (-1337.117) * [-1340.231] (-1339.824) (-1339.574) (-1336.888) -- 0:00:39
      386000 -- (-1336.869) (-1337.727) (-1337.205) [-1337.468] * (-1343.531) (-1341.355) (-1338.360) [-1338.696] -- 0:00:39
      386500 -- (-1336.747) (-1336.708) (-1337.726) [-1337.629] * [-1344.478] (-1337.842) (-1337.985) (-1337.417) -- 0:00:39
      387000 -- [-1336.799] (-1336.535) (-1337.671) (-1339.350) * (-1338.390) (-1343.487) [-1337.555] (-1337.290) -- 0:00:39
      387500 -- (-1336.994) [-1338.619] (-1337.512) (-1339.484) * (-1337.732) (-1341.012) [-1337.312] (-1337.820) -- 0:00:39
      388000 -- (-1336.801) [-1340.218] (-1340.589) (-1339.781) * (-1338.501) (-1336.831) [-1337.424] (-1338.053) -- 0:00:39
      388500 -- [-1336.920] (-1337.236) (-1340.085) (-1336.820) * (-1339.890) (-1339.920) [-1336.778] (-1337.632) -- 0:00:39
      389000 -- (-1337.110) [-1338.941] (-1340.473) (-1336.711) * (-1339.780) (-1336.916) [-1336.614] (-1338.726) -- 0:00:39
      389500 -- (-1337.965) (-1338.648) [-1340.359] (-1339.747) * (-1340.210) (-1339.232) (-1341.207) [-1340.353] -- 0:00:39
      390000 -- (-1338.458) (-1338.600) (-1337.172) [-1341.357] * (-1339.224) [-1337.032] (-1338.516) (-1341.479) -- 0:00:39

      Average standard deviation of split frequencies: 0.015687

      390500 -- (-1338.902) (-1339.570) [-1337.532] (-1340.692) * (-1339.194) (-1337.753) [-1341.832] (-1341.219) -- 0:00:39
      391000 -- (-1337.396) (-1340.305) (-1337.219) [-1341.472] * [-1339.737] (-1337.467) (-1339.143) (-1338.641) -- 0:00:38
      391500 -- [-1338.623] (-1337.834) (-1337.288) (-1344.382) * (-1338.845) (-1336.579) (-1342.369) [-1337.047] -- 0:00:38
      392000 -- [-1339.605] (-1340.468) (-1336.344) (-1346.409) * [-1340.734] (-1338.855) (-1343.973) (-1336.896) -- 0:00:38
      392500 -- (-1338.244) [-1338.105] (-1341.187) (-1343.570) * (-1336.753) (-1338.645) (-1342.688) [-1337.331] -- 0:00:38
      393000 -- (-1341.839) [-1337.898] (-1340.370) (-1341.044) * (-1341.089) (-1337.651) (-1339.684) [-1339.195] -- 0:00:38
      393500 -- (-1342.434) (-1339.971) (-1341.018) [-1340.175] * (-1337.252) (-1337.832) [-1336.583] (-1338.789) -- 0:00:38
      394000 -- [-1342.217] (-1339.577) (-1339.064) (-1337.885) * (-1338.525) (-1339.182) [-1339.361] (-1337.970) -- 0:00:38
      394500 -- (-1338.537) (-1338.267) (-1338.186) [-1338.855] * (-1336.970) (-1340.086) [-1337.263] (-1339.577) -- 0:00:38
      395000 -- (-1338.754) [-1339.674] (-1339.054) (-1337.106) * (-1336.252) (-1338.351) (-1338.897) [-1338.066] -- 0:00:38

      Average standard deviation of split frequencies: 0.015029

      395500 -- (-1338.870) (-1337.609) (-1340.168) [-1336.523] * (-1336.225) (-1337.789) [-1337.953] (-1338.070) -- 0:00:38
      396000 -- [-1336.836] (-1339.085) (-1338.540) (-1337.621) * [-1338.444] (-1339.915) (-1339.776) (-1337.318) -- 0:00:38
      396500 -- (-1336.694) [-1338.499] (-1338.024) (-1338.000) * [-1338.350] (-1337.618) (-1341.260) (-1338.039) -- 0:00:38
      397000 -- [-1338.020] (-1338.628) (-1340.677) (-1339.836) * [-1339.219] (-1337.634) (-1340.546) (-1339.113) -- 0:00:37
      397500 -- (-1337.634) (-1338.231) (-1340.099) [-1341.422] * (-1339.141) (-1339.114) (-1339.823) [-1340.866] -- 0:00:37
      398000 -- (-1338.898) [-1339.898] (-1338.991) (-1337.699) * (-1336.514) (-1340.199) [-1337.851] (-1337.918) -- 0:00:37
      398500 -- (-1338.430) (-1337.680) (-1338.551) [-1339.067] * (-1336.514) [-1339.986] (-1340.035) (-1337.406) -- 0:00:37
      399000 -- [-1339.030] (-1338.510) (-1336.980) (-1342.279) * [-1337.623] (-1339.629) (-1337.620) (-1338.137) -- 0:00:37
      399500 -- [-1337.543] (-1338.146) (-1336.683) (-1341.400) * [-1341.150] (-1340.233) (-1337.568) (-1336.762) -- 0:00:37
      400000 -- (-1338.702) [-1337.534] (-1340.676) (-1338.360) * (-1337.955) (-1336.579) [-1336.478] (-1336.644) -- 0:00:37

      Average standard deviation of split frequencies: 0.015883

      400500 -- (-1338.582) (-1341.041) (-1338.188) [-1338.115] * (-1339.097) (-1338.907) (-1337.879) [-1339.521] -- 0:00:38
      401000 -- [-1338.768] (-1340.923) (-1339.132) (-1344.543) * (-1337.772) (-1338.916) (-1338.071) [-1339.005] -- 0:00:38
      401500 -- (-1340.327) (-1338.975) [-1339.833] (-1337.846) * (-1337.769) [-1336.695] (-1337.791) (-1337.780) -- 0:00:38
      402000 -- (-1338.209) (-1336.889) (-1341.593) [-1337.610] * (-1338.787) (-1336.798) [-1336.641] (-1338.419) -- 0:00:38
      402500 -- [-1337.215] (-1339.254) (-1338.452) (-1337.789) * (-1340.853) (-1338.938) (-1338.358) [-1338.001] -- 0:00:38
      403000 -- (-1342.782) (-1339.183) (-1339.751) [-1338.882] * (-1344.394) (-1340.224) [-1339.266] (-1340.838) -- 0:00:38
      403500 -- [-1337.656] (-1338.937) (-1340.644) (-1337.751) * (-1339.892) [-1339.634] (-1339.270) (-1339.416) -- 0:00:38
      404000 -- (-1339.473) (-1339.033) (-1338.514) [-1338.738] * (-1338.161) (-1338.465) [-1337.671] (-1338.918) -- 0:00:38
      404500 -- [-1339.277] (-1337.914) (-1337.538) (-1339.408) * (-1339.582) (-1338.503) [-1337.382] (-1336.960) -- 0:00:38
      405000 -- (-1339.293) (-1337.684) (-1343.874) [-1339.399] * (-1339.239) (-1340.471) [-1338.147] (-1336.957) -- 0:00:38

      Average standard deviation of split frequencies: 0.015530

      405500 -- (-1337.352) (-1338.681) (-1343.314) [-1338.951] * (-1338.144) (-1338.263) (-1337.228) [-1336.842] -- 0:00:38
      406000 -- (-1341.140) (-1337.395) (-1337.857) [-1341.010] * (-1338.979) (-1338.848) (-1336.388) [-1336.853] -- 0:00:38
      406500 -- [-1340.227] (-1337.352) (-1337.348) (-1340.802) * (-1339.645) (-1338.489) [-1337.348] (-1339.513) -- 0:00:37
      407000 -- (-1340.300) [-1336.750] (-1338.981) (-1341.686) * (-1342.671) (-1339.784) [-1338.132] (-1341.709) -- 0:00:37
      407500 -- [-1340.457] (-1338.980) (-1338.299) (-1338.843) * (-1338.598) [-1339.701] (-1339.289) (-1342.516) -- 0:00:37
      408000 -- (-1340.043) (-1339.664) (-1338.338) [-1339.928] * (-1336.927) [-1336.842] (-1338.551) (-1336.957) -- 0:00:37
      408500 -- (-1340.576) (-1339.387) [-1339.253] (-1339.043) * [-1337.764] (-1338.209) (-1336.553) (-1337.198) -- 0:00:37
      409000 -- (-1337.103) [-1337.422] (-1337.819) (-1340.038) * (-1337.506) (-1338.235) (-1337.779) [-1341.781] -- 0:00:37
      409500 -- (-1337.734) (-1336.864) (-1338.159) [-1337.892] * (-1337.384) (-1339.620) (-1338.989) [-1339.416] -- 0:00:37
      410000 -- (-1339.415) (-1339.813) [-1338.763] (-1340.618) * (-1337.766) (-1338.374) [-1337.420] (-1338.694) -- 0:00:37

      Average standard deviation of split frequencies: 0.015066

      410500 -- (-1338.041) (-1337.478) [-1336.677] (-1337.523) * [-1338.266] (-1339.093) (-1336.987) (-1338.719) -- 0:00:37
      411000 -- (-1339.824) (-1340.676) [-1339.148] (-1339.909) * (-1338.325) (-1340.012) [-1337.308] (-1338.169) -- 0:00:37
      411500 -- (-1337.395) (-1339.937) (-1339.926) [-1339.645] * [-1338.372] (-1339.016) (-1339.109) (-1338.824) -- 0:00:37
      412000 -- (-1336.608) (-1339.217) (-1343.472) [-1337.171] * [-1337.703] (-1341.265) (-1340.761) (-1338.598) -- 0:00:37
      412500 -- (-1336.501) [-1337.544] (-1340.571) (-1340.896) * (-1338.325) (-1338.398) [-1339.800] (-1336.736) -- 0:00:37
      413000 -- (-1337.135) (-1340.730) [-1340.564] (-1339.202) * (-1337.986) [-1338.745] (-1339.971) (-1338.851) -- 0:00:36
      413500 -- (-1337.354) [-1337.328] (-1340.519) (-1339.490) * [-1344.299] (-1338.925) (-1337.997) (-1340.086) -- 0:00:36
      414000 -- (-1337.965) (-1337.352) [-1340.741] (-1340.224) * (-1339.134) (-1338.540) (-1337.345) [-1337.587] -- 0:00:36
      414500 -- [-1337.771] (-1338.020) (-1340.161) (-1338.742) * (-1342.505) [-1336.719] (-1338.605) (-1339.539) -- 0:00:36
      415000 -- (-1338.263) (-1341.823) (-1337.257) [-1338.749] * (-1343.278) (-1338.572) (-1338.404) [-1340.307] -- 0:00:36

      Average standard deviation of split frequencies: 0.015227

      415500 -- (-1338.213) (-1336.938) [-1340.439] (-1339.039) * (-1339.229) (-1336.422) [-1337.754] (-1338.916) -- 0:00:36
      416000 -- (-1338.506) [-1336.197] (-1337.949) (-1338.476) * [-1337.854] (-1340.819) (-1337.582) (-1339.536) -- 0:00:36
      416500 -- (-1337.139) [-1337.570] (-1338.685) (-1337.199) * [-1338.388] (-1338.179) (-1337.573) (-1339.262) -- 0:00:37
      417000 -- (-1336.528) [-1337.258] (-1337.943) (-1341.093) * (-1337.188) (-1340.998) [-1337.077] (-1343.798) -- 0:00:37
      417500 -- (-1336.464) [-1337.012] (-1338.409) (-1339.578) * (-1340.560) (-1337.482) (-1337.472) [-1338.681] -- 0:00:37
      418000 -- [-1336.723] (-1338.732) (-1340.543) (-1337.229) * [-1336.671] (-1337.418) (-1337.300) (-1337.376) -- 0:00:37
      418500 -- (-1338.134) (-1339.331) (-1340.440) [-1338.708] * (-1337.851) [-1337.660] (-1338.025) (-1337.225) -- 0:00:37
      419000 -- (-1339.634) (-1337.253) (-1339.335) [-1340.651] * [-1336.702] (-1339.869) (-1336.784) (-1338.382) -- 0:00:37
      419500 -- [-1337.409] (-1340.087) (-1336.825) (-1340.351) * [-1337.040] (-1336.666) (-1337.214) (-1337.438) -- 0:00:37
      420000 -- (-1338.325) (-1337.994) [-1339.434] (-1337.932) * [-1338.140] (-1336.651) (-1338.519) (-1337.277) -- 0:00:37

      Average standard deviation of split frequencies: 0.015478

      420500 -- (-1340.475) (-1336.916) (-1337.123) [-1337.068] * (-1339.400) [-1339.963] (-1337.680) (-1338.400) -- 0:00:37
      421000 -- (-1339.423) [-1338.921] (-1340.665) (-1336.736) * [-1339.552] (-1336.929) (-1337.610) (-1338.205) -- 0:00:37
      421500 -- [-1339.281] (-1338.342) (-1336.640) (-1337.272) * (-1338.232) (-1336.178) [-1338.324] (-1339.156) -- 0:00:37
      422000 -- (-1337.164) (-1338.727) [-1338.167] (-1337.760) * (-1341.011) (-1338.192) [-1339.733] (-1338.331) -- 0:00:36
      422500 -- (-1339.264) (-1337.804) (-1338.755) [-1339.208] * (-1342.915) [-1337.025] (-1345.541) (-1337.503) -- 0:00:36
      423000 -- (-1336.455) (-1339.861) (-1337.166) [-1338.747] * [-1338.377] (-1337.484) (-1338.732) (-1340.902) -- 0:00:36
      423500 -- [-1336.681] (-1340.958) (-1337.951) (-1338.540) * (-1338.992) [-1337.828] (-1338.920) (-1340.651) -- 0:00:36
      424000 -- (-1337.487) [-1337.948] (-1340.062) (-1336.598) * (-1339.651) (-1338.100) [-1336.852] (-1343.916) -- 0:00:36
      424500 -- (-1336.928) (-1340.580) (-1342.058) [-1336.403] * (-1337.137) (-1336.994) (-1337.943) [-1341.062] -- 0:00:36
      425000 -- (-1337.481) (-1338.256) (-1340.364) [-1340.646] * (-1337.858) [-1337.918] (-1336.966) (-1337.819) -- 0:00:36

      Average standard deviation of split frequencies: 0.015561

      425500 -- (-1338.026) (-1340.443) (-1338.398) [-1339.536] * [-1338.642] (-1340.109) (-1340.849) (-1340.838) -- 0:00:36
      426000 -- (-1337.444) [-1338.213] (-1339.570) (-1339.006) * (-1338.568) (-1340.109) (-1340.499) [-1338.908] -- 0:00:36
      426500 -- (-1337.802) (-1337.278) [-1337.848] (-1337.355) * (-1339.290) (-1339.986) [-1338.542] (-1339.962) -- 0:00:36
      427000 -- (-1342.131) [-1337.245] (-1337.780) (-1337.913) * (-1339.750) (-1346.170) [-1339.079] (-1339.519) -- 0:00:36
      427500 -- [-1341.089] (-1339.515) (-1340.481) (-1342.146) * (-1339.756) [-1339.376] (-1336.373) (-1337.480) -- 0:00:36
      428000 -- [-1339.176] (-1337.425) (-1336.835) (-1340.204) * (-1338.724) (-1337.103) (-1338.072) [-1337.268] -- 0:00:36
      428500 -- (-1338.360) (-1338.416) (-1343.973) [-1342.442] * (-1338.500) (-1337.141) (-1337.424) [-1336.324] -- 0:00:36
      429000 -- (-1339.448) (-1339.801) [-1338.104] (-1341.131) * (-1337.522) (-1336.691) (-1337.180) [-1336.325] -- 0:00:35
      429500 -- [-1340.014] (-1341.622) (-1338.386) (-1338.290) * (-1337.840) [-1337.137] (-1337.032) (-1343.205) -- 0:00:35
      430000 -- (-1338.130) (-1340.953) (-1339.985) [-1337.795] * (-1336.764) [-1337.400] (-1336.766) (-1337.586) -- 0:00:35

      Average standard deviation of split frequencies: 0.016145

      430500 -- (-1339.110) (-1339.779) [-1338.001] (-1339.291) * (-1339.427) [-1337.102] (-1336.876) (-1337.253) -- 0:00:35
      431000 -- (-1336.542) (-1336.790) (-1337.206) [-1337.046] * (-1340.626) [-1337.853] (-1336.863) (-1336.832) -- 0:00:35
      431500 -- (-1342.171) (-1337.999) (-1338.908) [-1337.716] * (-1338.937) (-1341.443) [-1337.437] (-1336.832) -- 0:00:35
      432000 -- [-1336.942] (-1339.635) (-1337.498) (-1338.055) * (-1338.951) (-1336.512) (-1337.146) [-1338.105] -- 0:00:36
      432500 -- (-1338.390) (-1340.072) [-1336.597] (-1339.061) * (-1340.570) (-1337.041) [-1337.515] (-1338.709) -- 0:00:36
      433000 -- (-1341.778) (-1340.936) [-1336.635] (-1339.040) * [-1337.324] (-1339.986) (-1337.554) (-1339.921) -- 0:00:36
      433500 -- (-1341.790) (-1337.818) (-1337.795) [-1340.757] * [-1337.400] (-1340.148) (-1337.408) (-1337.867) -- 0:00:36
      434000 -- (-1337.333) (-1339.163) [-1337.871] (-1339.043) * (-1338.538) (-1340.784) [-1336.865] (-1337.795) -- 0:00:36
      434500 -- (-1338.398) [-1338.493] (-1339.102) (-1336.749) * (-1338.684) (-1338.345) (-1337.793) [-1337.410] -- 0:00:36
      435000 -- [-1340.760] (-1336.793) (-1339.358) (-1338.729) * (-1337.666) (-1339.270) [-1336.639] (-1338.687) -- 0:00:36

      Average standard deviation of split frequencies: 0.015948

      435500 -- [-1337.911] (-1337.474) (-1337.731) (-1338.661) * [-1337.666] (-1338.394) (-1336.710) (-1339.598) -- 0:00:36
      436000 -- (-1348.762) (-1338.908) [-1337.758] (-1339.381) * (-1336.702) (-1339.562) (-1338.352) [-1338.293] -- 0:00:36
      436500 -- (-1338.819) [-1339.393] (-1337.668) (-1342.639) * [-1336.942] (-1337.906) (-1336.576) (-1337.525) -- 0:00:36
      437000 -- (-1338.593) (-1340.900) [-1339.085] (-1343.304) * (-1339.132) (-1338.464) (-1336.365) [-1340.556] -- 0:00:36
      437500 -- (-1339.820) [-1337.907] (-1338.559) (-1338.916) * [-1339.374] (-1337.909) (-1338.722) (-1337.456) -- 0:00:36
      438000 -- (-1339.052) [-1338.941] (-1341.015) (-1337.669) * [-1338.710] (-1338.445) (-1336.278) (-1339.949) -- 0:00:35
      438500 -- (-1338.311) (-1340.244) [-1336.834] (-1338.474) * [-1337.853] (-1338.485) (-1338.031) (-1337.548) -- 0:00:35
      439000 -- (-1338.351) [-1338.332] (-1337.019) (-1338.573) * (-1337.982) (-1339.946) (-1337.817) [-1339.826] -- 0:00:35
      439500 -- (-1336.808) (-1338.314) [-1337.026] (-1337.587) * (-1340.793) [-1338.648] (-1337.175) (-1341.134) -- 0:00:35
      440000 -- (-1337.082) [-1340.337] (-1337.470) (-1338.610) * (-1336.577) (-1339.987) [-1338.212] (-1338.671) -- 0:00:35

      Average standard deviation of split frequencies: 0.015445

      440500 -- (-1338.514) (-1340.179) [-1338.644] (-1337.702) * (-1338.787) (-1340.835) [-1338.018] (-1340.124) -- 0:00:35
      441000 -- (-1337.320) (-1338.011) [-1337.868] (-1338.114) * [-1338.852] (-1339.801) (-1338.048) (-1338.567) -- 0:00:35
      441500 -- (-1337.803) [-1338.340] (-1340.715) (-1336.542) * (-1337.902) [-1339.572] (-1337.623) (-1337.453) -- 0:00:35
      442000 -- [-1336.612] (-1336.856) (-1341.194) (-1338.539) * (-1338.306) (-1337.998) [-1339.586] (-1339.355) -- 0:00:35
      442500 -- (-1336.636) (-1337.729) [-1339.261] (-1339.633) * [-1339.886] (-1338.486) (-1338.128) (-1338.794) -- 0:00:35
      443000 -- [-1336.631] (-1336.810) (-1338.086) (-1337.680) * (-1338.325) (-1337.814) (-1338.624) [-1337.922] -- 0:00:35
      443500 -- (-1341.115) (-1339.824) [-1338.296] (-1336.639) * (-1337.648) [-1339.334] (-1336.910) (-1337.031) -- 0:00:35
      444000 -- (-1338.552) [-1338.084] (-1339.840) (-1344.339) * [-1337.422] (-1340.062) (-1336.723) (-1338.023) -- 0:00:35
      444500 -- [-1338.853] (-1337.168) (-1342.540) (-1338.458) * (-1338.398) (-1341.649) [-1336.524] (-1337.984) -- 0:00:34
      445000 -- (-1341.449) [-1338.928] (-1339.921) (-1342.176) * [-1337.449] (-1339.662) (-1336.524) (-1338.994) -- 0:00:34

      Average standard deviation of split frequencies: 0.015326

      445500 -- (-1336.517) (-1340.849) [-1339.496] (-1342.756) * (-1338.782) (-1339.123) [-1337.107] (-1338.939) -- 0:00:34
      446000 -- (-1336.897) (-1339.273) [-1339.058] (-1343.393) * (-1338.627) (-1338.852) (-1337.012) [-1338.759] -- 0:00:34
      446500 -- (-1337.173) (-1337.616) [-1338.925] (-1342.616) * (-1337.863) (-1338.341) (-1337.067) [-1336.799] -- 0:00:34
      447000 -- (-1337.080) [-1337.038] (-1338.305) (-1338.719) * (-1338.012) (-1341.484) (-1338.043) [-1338.199] -- 0:00:34
      447500 -- (-1338.208) (-1337.213) (-1338.052) [-1340.398] * (-1337.611) (-1339.526) [-1338.168] (-1338.039) -- 0:00:34
      448000 -- (-1339.201) [-1337.093] (-1338.071) (-1341.382) * (-1336.794) [-1337.071] (-1338.105) (-1342.914) -- 0:00:35
      448500 -- (-1337.170) (-1337.280) [-1338.467] (-1339.438) * [-1338.199] (-1338.177) (-1337.593) (-1336.869) -- 0:00:35
      449000 -- [-1337.875] (-1338.033) (-1336.360) (-1338.307) * [-1338.585] (-1339.069) (-1342.385) (-1337.021) -- 0:00:35
      449500 -- [-1338.046] (-1339.038) (-1336.423) (-1340.558) * (-1340.469) [-1339.068] (-1337.728) (-1337.188) -- 0:00:35
      450000 -- (-1340.181) [-1340.951] (-1336.652) (-1340.384) * (-1340.772) [-1337.484] (-1342.074) (-1338.146) -- 0:00:35

      Average standard deviation of split frequencies: 0.015260

      450500 -- [-1338.238] (-1340.971) (-1337.536) (-1340.446) * [-1338.223] (-1340.442) (-1341.436) (-1339.584) -- 0:00:35
      451000 -- [-1338.476] (-1341.694) (-1338.087) (-1336.877) * (-1338.939) (-1343.200) (-1337.758) [-1337.399] -- 0:00:35
      451500 -- [-1338.126] (-1339.021) (-1337.366) (-1336.712) * (-1338.096) (-1340.227) (-1342.529) [-1339.922] -- 0:00:35
      452000 -- [-1339.142] (-1336.463) (-1340.240) (-1336.497) * (-1338.881) (-1337.456) (-1342.731) [-1337.955] -- 0:00:35
      452500 -- (-1342.414) (-1337.732) [-1338.051] (-1337.551) * (-1336.844) (-1336.690) (-1342.580) [-1338.089] -- 0:00:35
      453000 -- [-1340.769] (-1339.243) (-1336.903) (-1339.855) * (-1336.926) (-1338.444) (-1339.480) [-1336.492] -- 0:00:35
      453500 -- (-1337.180) (-1340.145) [-1339.567] (-1337.733) * (-1338.116) (-1342.933) [-1337.520] (-1340.770) -- 0:00:34
      454000 -- [-1337.430] (-1338.757) (-1337.420) (-1338.825) * (-1337.262) (-1339.945) (-1338.479) [-1337.310] -- 0:00:34
      454500 -- (-1336.873) [-1339.534] (-1337.160) (-1340.933) * (-1339.663) [-1338.205] (-1337.174) (-1336.919) -- 0:00:34
      455000 -- [-1337.513] (-1339.078) (-1340.187) (-1340.389) * (-1336.952) [-1336.774] (-1337.243) (-1336.787) -- 0:00:34

      Average standard deviation of split frequencies: 0.015020

      455500 -- [-1337.592] (-1341.142) (-1337.308) (-1340.023) * (-1336.695) (-1341.688) [-1337.048] (-1338.304) -- 0:00:34
      456000 -- (-1336.405) (-1339.951) [-1337.643] (-1341.272) * (-1337.923) [-1341.844] (-1339.368) (-1337.440) -- 0:00:34
      456500 -- (-1343.028) [-1340.118] (-1337.677) (-1338.508) * (-1339.834) (-1337.947) (-1339.453) [-1337.154] -- 0:00:34
      457000 -- (-1341.708) [-1338.480] (-1338.056) (-1337.409) * (-1338.105) (-1337.722) (-1340.789) [-1338.174] -- 0:00:34
      457500 -- (-1342.385) (-1337.407) [-1338.432] (-1338.777) * (-1337.884) (-1338.644) [-1338.453] (-1337.016) -- 0:00:34
      458000 -- (-1337.812) (-1338.820) (-1338.851) [-1338.335] * (-1342.334) (-1337.204) [-1338.314] (-1339.085) -- 0:00:34
      458500 -- (-1337.157) [-1337.194] (-1339.782) (-1337.343) * (-1339.465) [-1339.797] (-1338.301) (-1339.101) -- 0:00:34
      459000 -- [-1341.043] (-1336.406) (-1340.897) (-1338.852) * (-1339.820) (-1342.771) [-1337.102] (-1338.996) -- 0:00:34
      459500 -- (-1339.289) (-1336.609) (-1339.750) [-1337.698] * (-1337.471) (-1341.738) [-1338.080] (-1336.451) -- 0:00:34
      460000 -- [-1340.145] (-1338.094) (-1340.410) (-1339.075) * (-1338.038) (-1339.389) [-1339.603] (-1340.431) -- 0:00:34

      Average standard deviation of split frequencies: 0.015169

      460500 -- [-1339.405] (-1337.425) (-1338.427) (-1337.769) * (-1343.580) (-1340.284) [-1338.267] (-1336.345) -- 0:00:33
      461000 -- (-1341.286) (-1338.683) [-1337.468] (-1340.055) * [-1343.086] (-1339.509) (-1338.439) (-1338.264) -- 0:00:33
      461500 -- (-1339.503) (-1338.660) (-1336.346) [-1339.216] * (-1338.285) (-1337.368) (-1338.096) [-1337.569] -- 0:00:33
      462000 -- (-1338.977) (-1339.391) (-1337.935) [-1337.299] * (-1341.171) (-1339.269) (-1338.349) [-1340.035] -- 0:00:33
      462500 -- (-1338.037) (-1339.507) [-1343.589] (-1338.439) * (-1338.625) (-1342.041) [-1338.068] (-1338.224) -- 0:00:33
      463000 -- (-1337.503) (-1336.948) (-1339.875) [-1340.002] * (-1337.397) (-1339.094) (-1346.515) [-1338.644] -- 0:00:33
      463500 -- [-1337.748] (-1338.817) (-1343.290) (-1342.259) * (-1341.432) [-1336.468] (-1341.146) (-1340.816) -- 0:00:33
      464000 -- (-1336.703) [-1338.429] (-1339.262) (-1337.051) * (-1337.128) (-1336.432) [-1343.096] (-1340.083) -- 0:00:34
      464500 -- [-1338.413] (-1338.579) (-1342.258) (-1336.865) * (-1340.166) (-1338.366) [-1340.190] (-1339.729) -- 0:00:34
      465000 -- (-1336.995) (-1337.364) (-1341.702) [-1338.905] * (-1343.066) (-1339.904) [-1339.985] (-1338.049) -- 0:00:34

      Average standard deviation of split frequencies: 0.014698

      465500 -- (-1338.301) [-1337.836] (-1338.548) (-1339.603) * (-1340.385) (-1338.265) (-1343.012) [-1337.798] -- 0:00:34
      466000 -- (-1340.206) (-1341.310) [-1337.463] (-1338.072) * [-1339.072] (-1338.894) (-1339.573) (-1341.655) -- 0:00:34
      466500 -- (-1336