--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:55:53 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/hemD/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2272.49 -2276.26 2 -2272.50 -2275.81 -------------------------------------- TOTAL -2272.50 -2276.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.891400 0.091442 0.377319 1.519633 0.851852 1438.15 1469.57 1.000 r(A<->C){all} 0.166354 0.020000 0.000049 0.451926 0.129833 197.15 231.09 1.001 r(A<->G){all} 0.164272 0.019354 0.000073 0.445638 0.127429 150.46 250.65 1.000 r(A<->T){all} 0.166717 0.017774 0.000106 0.441825 0.136826 209.88 290.39 1.000 r(C<->G){all} 0.152809 0.018287 0.000002 0.421366 0.116717 150.03 226.33 1.003 r(C<->T){all} 0.170346 0.019032 0.000002 0.445735 0.136949 98.36 184.62 1.002 r(G<->T){all} 0.179501 0.022551 0.000063 0.484256 0.137131 278.99 284.88 1.002 pi(A){all} 0.168852 0.000083 0.151340 0.186492 0.168648 1235.51 1341.13 1.000 pi(C){all} 0.301455 0.000124 0.279348 0.323994 0.301492 1143.94 1152.60 1.000 pi(G){all} 0.339082 0.000136 0.316093 0.361393 0.339265 1163.35 1282.81 1.000 pi(T){all} 0.190610 0.000092 0.172798 0.209644 0.190308 1281.08 1287.61 1.000 alpha{1,2} 0.425952 0.227811 0.000129 1.390623 0.265863 1134.30 1236.46 1.000 alpha{3} 0.474341 0.253273 0.000393 1.436923 0.305297 1212.43 1356.71 1.000 pinvar{all} 0.999122 0.000001 0.997236 0.999999 0.999448 1034.64 1124.97 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2202.494103 Model 2: PositiveSelection -2202.494103 Model 0: one-ratio -2202.494596 Model 7: beta -2202.494103 Model 8: beta&w>1 -2202.494103 Model 0 vs 1 9.860000000116997E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C2 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C3 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C4 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C5 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C6 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=563 C1 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C2 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C3 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C4 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C5 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C6 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD ************************************************** C1 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C2 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C3 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C4 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C5 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C6 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS ************************************************** C1 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C2 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C3 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C4 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C5 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C6 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ************************************************** C1 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C2 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C3 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C4 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C5 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C6 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG ************************************************** C1 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C2 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C3 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C4 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C5 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C6 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ************************************************** C1 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C2 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C3 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C4 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C5 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C6 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR ************************************************** C1 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C2 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C3 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C4 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C5 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C6 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW ************************************************** C1 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C2 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C3 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C4 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C5 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C6 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE ************************************************** C1 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C2 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C3 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C4 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C5 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C6 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW ************************************************** C1 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C2 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C3 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C4 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C5 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C6 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP ************************************************** C1 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C2 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C3 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C4 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C5 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C6 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE ************************************************** C1 GALPPPRKKSRRR C2 GALPPPRKKSRRR C3 GALPPPRKKSRRR C4 GALPPPRKKSRRR C5 GALPPPRKKSRRR C6 GALPPPRKKSRRR ************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 563 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 563 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16890] Library Relaxation: Multi_proc [96] Relaxation Summary: [16890]--->[16890] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.577 Mb, Max= 31.174 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C2 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C3 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C4 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C5 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD C6 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD ************************************************** C1 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C2 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C3 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C4 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C5 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS C6 VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS ************************************************** C1 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C2 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C3 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C4 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C5 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV C6 GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ************************************************** C1 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C2 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C3 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C4 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C5 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG C6 ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG ************************************************** C1 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C2 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C3 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C4 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C5 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL C6 PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ************************************************** C1 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C2 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C3 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C4 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C5 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR C6 ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR ************************************************** C1 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C2 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C3 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C4 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C5 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW C6 TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW ************************************************** C1 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C2 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C3 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C4 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C5 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE C6 VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE ************************************************** C1 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C2 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C3 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C4 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C5 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW C6 LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW ************************************************** C1 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C2 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C3 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C4 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C5 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP C6 EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP ************************************************** C1 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C2 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C3 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C4 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C5 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE C6 HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE ************************************************** C1 GALPPPRKKSRRR C2 GALPPPRKKSRRR C3 GALPPPRKKSRRR C4 GALPPPRKKSRRR C5 GALPPPRKKSRRR C6 GALPPPRKKSRRR ************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG C2 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG C3 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG C4 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG C5 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG C6 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG ************************************************** C1 CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC C2 CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC C3 CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC C4 CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC C5 CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC C6 CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC ************************************************** C1 AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT C2 AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT C3 AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT C4 AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT C5 AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT C6 AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT ************************************************** C1 GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC C2 GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC C3 GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC C4 GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC C5 GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC C6 GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC ************************************************** C1 TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG C2 TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG C3 TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG C4 TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG C5 TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG C6 TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG ************************************************** C1 ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC C2 ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC C3 ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC C4 ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC C5 ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC C6 ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC ************************************************** C1 GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA C2 GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA C3 GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA C4 GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA C5 GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA C6 GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA ************************************************** C1 AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG C2 AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG C3 AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG C4 AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG C5 AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG C6 AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG ************************************************** C1 CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG C2 CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG C3 CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG C4 CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG C5 CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG C6 CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG ************************************************** C1 GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG C2 GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG C3 GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG C4 GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG C5 GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG C6 GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG ************************************************** C1 CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG C2 CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG C3 CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG C4 CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG C5 CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG C6 CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG ************************************************** C1 CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG C2 CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG C3 CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG C4 CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG C5 CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG C6 CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG ************************************************** C1 CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT C2 CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT C3 CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT C4 CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT C5 CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT C6 CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT ************************************************** C1 CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC C2 CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC C3 CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC C4 CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC C5 CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC C6 CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC ************************************************** C1 AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG C2 AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG C3 AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG C4 AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG C5 AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG C6 AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG ************************************************** C1 GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG C2 GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG C3 GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG C4 GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG C5 GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG C6 GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG ************************************************** C1 GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA C2 GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA C3 GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA C4 GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA C5 GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA C6 GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA ************************************************** C1 ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT C2 ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT C3 ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT C4 ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT C5 ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT C6 ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT ************************************************** C1 ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC C2 ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC C3 ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC C4 ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC C5 ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC C6 ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC ************************************************** C1 GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG C2 GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG C3 GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG C4 GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG C5 GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG C6 GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG ************************************************** C1 CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG C2 CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG C3 CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG C4 CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG C5 CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG C6 CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG ************************************************** C1 GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG C2 GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG C3 GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG C4 GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG C5 GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG C6 GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG ************************************************** C1 CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG C2 CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG C3 CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG C4 CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG C5 CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG C6 CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG ************************************************** C1 TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG C2 TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG C3 TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG C4 TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG C5 TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG C6 TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG ************************************************** C1 CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC C2 CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC C3 CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC C4 CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC C5 CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC C6 CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC ************************************************** C1 GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG C2 GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG C3 GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG C4 GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG C5 GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG C6 GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG ************************************************** C1 CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG C2 CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG C3 CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG C4 CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG C5 CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG C6 CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG ************************************************** C1 GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC C2 GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC C3 GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC C4 GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC C5 GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC C6 GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC ************************************************** C1 GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT C2 GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT C3 GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT C4 GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT C5 GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT C6 GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT ************************************************** C1 TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG C2 TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG C3 TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG C4 TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG C5 TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG C6 TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG ************************************************** C1 CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC C2 CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC C3 CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC C4 CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC C5 CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC C6 CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC ************************************************** C1 TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG C2 TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG C3 TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG C4 TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG C5 TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG C6 TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG ************************************************** C1 GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA C2 GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA C3 GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA C4 GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA C5 GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA C6 GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA ************************************************** C1 GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC C2 GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC C3 GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC C4 GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC C5 GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC C6 GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC *************************************** >C1 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC >C2 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC >C3 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC >C4 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC >C5 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC >C6 GTGGTGGGAGCGACAATGACGACGCGAGGGCGTAAGCTTAGACCAGGTCG CATCACATTTGTGGGCGCCGGTCCAGGAGCCCCAGGGTTACTAACTGCTC AGGCTGTAGCGGTGCTAGCAAACGCCGCCCTTGTTTTTATCGACCCCGAT GTACCTGAACCGGTGCTGGCGCTGATTGGCAAGGACTTGCCACCGGTCTC TGGTCCGGCGCCTGCCGGTCCGGCTGCCGTGACCGCCGGCAGGGCTGCTG ACGGTACCCTCGAGGGGGATCACTACCAAGCCGCACCGATGGTCATGTCC GGAGGCGCCGACATCCGCCCTGCGTTGGGTGACCCTACTGAGGTCGCCAA AACGCTGACCGCCGAGGCTCGTTCCGGTGTTGATGTGGTGCGCTTAGTGG CGGGTGATCCGTTGACGGTGGACGCGGTCATAGCCGAGGTGAACGCTGTG GCACGCACCAATCTACAAATCGAGATCGTGCCCGGCTTGGTCACCAGCAG CGTCGTACCAACCTATGCCGGGCTACCCTTGGGTTCGTCGCACACGGTGG CTGATGTACGTGGCGACGTGGACTGGGAAGCGCTAGCCGCGGCTCCTGGG CCGTTGATTCTGCAAGCCACCGCATCACATCTTGCCGACGCGGCGCACAT CTTGATCGACCACGGGCTGGACGACGCCACACCCTGCGTGGTGACCGCTC AGGGCACGACCTGCCAGCAACGTTCTGTCGAAACCACATTGGAGGGATTG GCTGACTCGGCTGTCCTGGTCGGCACCGATACCGCAGGCCCGCTGACCGG GCCGCTGGTGGTGACCATAGGCAAGACGGTGACCAGTCGAGCTAGACTGA ACTGGTGGGAAAGCCGTGCACTCTACGGCTGGACCGTGTTGGTACCGCGT ACCAAGGACCAGGCCGGCGAGATGAGCGAGCGGCTGACGTCGTACGGTGC GTTGCCGGTTGAGGTGCCGACCATCGCTGTCGAGCCGCCGCGCAGTCCCG CTCAGATGGAACGTGCTGTCAAGGGGCTGGTCGACGGTCGTTTCCAATGG GTGGTGTTCACCTCCACCAACGCGGTGCGCGCGGTGTGGGAGAAGTTTGG CGAGTTCGGTCTGGATGCCCGCGCCTTCTCCGGGGTGAAGATCGCCTGTG TCGGAGAAGCGACTGCCGACAGGGTCCGTGCATTCGGGATCAGCCCGGAG CTGGTGCCGGCTGGGGAACAGTCTTCCCTCGGTCTACTGGACGAATTCCC GCCTTATGACAGCGTTTTCGACCCGGTGAACCGTGTTTTGCTGCCGCGCG CTGACATTGCCACCGAAACCCTGGCTGAGGGACTGCGCGGGTGTGGCTGG GAGATCGAGGACGTCACCGCTTATCGGACGGTGCGGGCGGCACCGCCGCC GGCGGCCACCCGGGAAATGATCAAGACGGGTGGCTTCGATGCAGTGTGCT TCACCTCCAGCTCCACGGTGCGTAACTTGGTTGGTATTGCCGGCAAACCG CACGCGCGGACGGTCATTGCCTGCATCGGACCCAAGACTGCTGAGACCGC TTCCGAATTTGGTTTGCGGGTGGATGTCCAGCCCGAAACCGCCGCGGTTG GACCGTTAGTTGATGCGTTGGCCGAACATGTCGCTCGACTGCGCGCCGAA GGCGCGCTGCCTCCACCGCGCAAGAAGAGCCGCAGGCGC >C1 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C2 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C3 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C4 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C5 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR >C6 VVGATMTTRGRKLRPGRITFVGAGPGAPGLLTAQAVAVLANAALVFIDPD VPEPVLALIGKDLPPVSGPAPAGPAAVTAGRAADGTLEGDHYQAAPMVMS GGADIRPALGDPTEVAKTLTAEARSGVDVVRLVAGDPLTVDAVIAEVNAV ARTNLQIEIVPGLVTSSVVPTYAGLPLGSSHTVADVRGDVDWEALAAAPG PLILQATASHLADAAHILIDHGLDDATPCVVTAQGTTCQQRSVETTLEGL ADSAVLVGTDTAGPLTGPLVVTIGKTVTSRARLNWWESRALYGWTVLVPR TKDQAGEMSERLTSYGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRFQW VVFTSTNAVRAVWEKFGEFGLDARAFSGVKIACVGEATADRVRAFGISPE LVPAGEQSSLGLLDEFPPYDSVFDPVNRVLLPRADIATETLAEGLRGCGW EIEDVTAYRTVRAAPPPAATREMIKTGGFDAVCFTSSSTVRNLVGIAGKP HARTVIACIGPKTAETASEFGLRVDVQPETAAVGPLVDALAEHVARLRAE GALPPPRKKSRRR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1689 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579791260 Setting output file names to "/data/2res/hemD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 764610846 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0008285487 Seed = 1681715882 Swapseed = 1579791260 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3780.062749 -- -24.965149 Chain 2 -- -3780.062967 -- -24.965149 Chain 3 -- -3780.062967 -- -24.965149 Chain 4 -- -3780.062967 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3780.062749 -- -24.965149 Chain 2 -- -3780.062967 -- -24.965149 Chain 3 -- -3780.062749 -- -24.965149 Chain 4 -- -3780.062967 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3780.063] (-3780.063) (-3780.063) (-3780.063) * [-3780.063] (-3780.063) (-3780.063) (-3780.063) 500 -- (-2303.463) (-2300.189) [-2287.878] (-2330.780) * (-2323.924) (-2284.178) [-2290.268] (-2321.992) -- 0:00:00 1000 -- (-2290.412) [-2279.166] (-2293.347) (-2297.567) * (-2305.713) [-2290.472] (-2280.338) (-2321.426) -- 0:00:00 1500 -- (-2285.843) (-2279.613) [-2280.640] (-2278.796) * (-2297.924) (-2277.667) [-2279.209] (-2285.628) -- 0:11:05 2000 -- [-2284.691] (-2280.696) (-2276.589) (-2285.875) * (-2289.428) (-2279.843) (-2293.111) [-2277.186] -- 0:08:19 2500 -- [-2280.074] (-2278.638) (-2279.020) (-2287.719) * (-2282.782) [-2277.860] (-2276.797) (-2282.643) -- 0:06:39 3000 -- [-2279.449] (-2286.095) (-2283.140) (-2284.543) * (-2284.608) [-2279.997] (-2279.969) (-2280.593) -- 0:05:32 3500 -- (-2293.358) (-2287.913) (-2277.271) [-2276.764] * (-2283.886) [-2283.787] (-2281.695) (-2282.721) -- 0:04:44 4000 -- (-2278.072) (-2277.898) (-2279.544) [-2281.517] * [-2280.276] (-2286.389) (-2281.759) (-2281.566) -- 0:04:09 4500 -- [-2278.429] (-2283.271) (-2286.820) (-2277.106) * (-2281.080) (-2288.697) [-2284.420] (-2287.347) -- 0:03:41 5000 -- (-2285.600) (-2280.207) (-2286.893) [-2282.239] * [-2277.881] (-2279.925) (-2280.501) (-2276.817) -- 0:03:19 Average standard deviation of split frequencies: 0.086424 5500 -- (-2283.179) (-2279.376) [-2283.126] (-2286.115) * (-2280.358) (-2283.364) (-2281.583) [-2280.407] -- 0:03:00 6000 -- [-2282.685] (-2280.242) (-2284.218) (-2280.581) * (-2283.416) [-2278.597] (-2277.289) (-2283.822) -- 0:02:45 6500 -- (-2280.147) (-2284.526) [-2279.274] (-2284.798) * (-2284.284) [-2281.259] (-2279.633) (-2283.471) -- 0:02:32 7000 -- [-2289.543] (-2282.142) (-2282.263) (-2283.838) * (-2290.406) (-2285.595) (-2283.444) [-2287.687] -- 0:02:21 7500 -- [-2277.427] (-2282.187) (-2284.365) (-2287.589) * [-2282.091] (-2290.844) (-2286.516) (-2285.144) -- 0:02:12 8000 -- (-2279.509) [-2281.152] (-2281.556) (-2283.978) * [-2289.245] (-2285.918) (-2278.793) (-2287.524) -- 0:02:04 8500 -- (-2284.311) [-2275.570] (-2281.127) (-2285.137) * (-2290.596) [-2283.480] (-2280.001) (-2285.908) -- 0:01:56 9000 -- [-2282.802] (-2287.303) (-2283.635) (-2284.925) * (-2276.913) (-2283.248) [-2276.122] (-2283.766) -- 0:01:50 9500 -- [-2282.262] (-2284.403) (-2287.763) (-2280.424) * (-2274.749) (-2281.028) [-2282.625] (-2281.430) -- 0:01:44 10000 -- (-2284.045) (-2284.648) [-2285.535] (-2281.999) * [-2276.629] (-2281.115) (-2282.435) (-2286.475) -- 0:01:39 Average standard deviation of split frequencies: 0.073657 10500 -- (-2279.713) [-2284.059] (-2280.416) (-2286.015) * (-2281.108) (-2284.411) (-2279.077) [-2282.354] -- 0:01:34 11000 -- [-2281.410] (-2280.457) (-2284.659) (-2279.813) * (-2278.095) [-2282.905] (-2285.621) (-2279.220) -- 0:01:29 11500 -- (-2282.861) (-2276.661) (-2286.630) [-2280.865] * (-2281.608) [-2290.346] (-2284.979) (-2279.786) -- 0:01:25 12000 -- (-2278.613) (-2283.590) [-2282.439] (-2283.589) * (-2287.978) (-2282.343) (-2279.868) [-2286.832] -- 0:01:22 12500 -- (-2280.651) (-2286.008) (-2282.338) [-2288.236] * (-2288.718) [-2286.569] (-2280.931) (-2284.326) -- 0:01:19 13000 -- (-2279.838) (-2284.336) (-2285.129) [-2282.314] * (-2284.512) (-2286.301) (-2283.365) [-2282.595] -- 0:01:15 13500 -- [-2279.819] (-2277.923) (-2281.067) (-2282.927) * (-2283.402) [-2284.316] (-2280.340) (-2281.344) -- 0:01:13 14000 -- [-2281.710] (-2288.674) (-2287.535) (-2296.803) * (-2282.063) (-2287.302) [-2275.542] (-2281.486) -- 0:02:20 14500 -- (-2280.673) (-2272.444) (-2280.200) [-2280.280] * (-2283.869) (-2284.301) [-2280.163] (-2277.867) -- 0:02:15 15000 -- (-2289.409) (-2272.088) (-2283.071) [-2278.116] * [-2278.661] (-2278.217) (-2287.110) (-2284.003) -- 0:02:11 Average standard deviation of split frequencies: 0.063578 15500 -- [-2286.126] (-2271.697) (-2281.483) (-2283.640) * (-2281.408) [-2277.954] (-2286.792) (-2279.890) -- 0:02:07 16000 -- (-2278.933) [-2271.771] (-2283.234) (-2285.928) * [-2277.579] (-2287.388) (-2283.334) (-2285.292) -- 0:02:03 16500 -- (-2289.137) [-2273.532] (-2281.980) (-2286.464) * (-2282.471) [-2275.412] (-2286.169) (-2279.401) -- 0:01:59 17000 -- [-2279.843] (-2271.676) (-2282.779) (-2293.029) * (-2288.707) (-2284.444) (-2284.853) [-2280.492] -- 0:01:55 17500 -- (-2281.551) (-2272.592) [-2281.675] (-2283.422) * (-2282.662) (-2284.529) (-2276.280) [-2284.069] -- 0:01:52 18000 -- (-2282.949) [-2272.471] (-2279.116) (-2285.432) * [-2283.488] (-2287.510) (-2293.523) (-2284.263) -- 0:01:49 18500 -- (-2288.022) (-2271.753) (-2278.743) [-2281.262] * [-2286.375] (-2288.007) (-2287.248) (-2282.187) -- 0:01:46 19000 -- (-2279.354) [-2271.858] (-2297.079) (-2289.749) * (-2291.534) (-2285.347) (-2279.707) [-2279.338] -- 0:01:43 19500 -- [-2277.017] (-2272.015) (-2283.702) (-2284.333) * (-2285.829) (-2283.215) [-2286.135] (-2298.085) -- 0:01:40 20000 -- (-2281.430) (-2271.707) [-2276.513] (-2284.913) * [-2278.549] (-2286.343) (-2286.178) (-2280.564) -- 0:01:38 Average standard deviation of split frequencies: 0.067162 20500 -- (-2289.291) [-2271.390] (-2280.068) (-2277.687) * (-2276.545) (-2280.223) [-2284.418] (-2279.730) -- 0:01:35 21000 -- (-2279.401) (-2272.322) (-2290.221) [-2284.267] * (-2287.271) (-2280.429) [-2281.490] (-2279.631) -- 0:01:33 21500 -- [-2276.706] (-2272.316) (-2285.704) (-2280.857) * (-2281.251) [-2282.243] (-2278.752) (-2281.020) -- 0:01:31 22000 -- (-2283.358) (-2273.931) [-2283.881] (-2283.036) * (-2289.437) [-2280.687] (-2286.791) (-2283.070) -- 0:01:28 22500 -- (-2282.869) [-2275.195] (-2282.540) (-2280.165) * [-2281.299] (-2277.836) (-2281.065) (-2277.535) -- 0:01:26 23000 -- (-2282.700) [-2272.320] (-2286.817) (-2284.166) * [-2279.496] (-2278.959) (-2282.691) (-2275.520) -- 0:01:24 23500 -- (-2287.014) (-2273.308) [-2284.139] (-2290.353) * [-2286.421] (-2279.405) (-2283.995) (-2274.879) -- 0:01:23 24000 -- (-2280.411) (-2273.301) [-2280.832] (-2281.883) * (-2281.264) (-2284.048) [-2288.336] (-2274.305) -- 0:01:21 24500 -- [-2278.895] (-2272.960) (-2278.427) (-2281.789) * (-2280.331) (-2281.896) [-2279.336] (-2275.547) -- 0:01:19 25000 -- (-2280.969) (-2275.503) (-2284.431) [-2279.533] * (-2286.778) (-2281.207) [-2283.380] (-2274.609) -- 0:01:18 Average standard deviation of split frequencies: 0.049213 25500 -- (-2279.703) (-2275.032) [-2281.497] (-2280.507) * (-2280.717) [-2283.072] (-2293.090) (-2274.608) -- 0:01:16 26000 -- [-2280.983] (-2274.676) (-2295.061) (-2282.374) * [-2280.465] (-2284.624) (-2282.406) (-2274.511) -- 0:01:14 26500 -- (-2284.281) (-2275.086) [-2282.869] (-2278.271) * (-2287.498) [-2280.770] (-2282.604) (-2272.318) -- 0:01:50 27000 -- [-2271.644] (-2274.010) (-2281.569) (-2288.050) * (-2282.408) (-2279.250) (-2277.487) [-2272.387] -- 0:01:48 27500 -- [-2273.473] (-2275.403) (-2282.462) (-2278.453) * (-2284.850) (-2290.941) (-2275.886) [-2273.297] -- 0:01:46 28000 -- (-2275.480) (-2272.565) (-2284.213) [-2278.465] * (-2281.915) (-2278.274) [-2275.155] (-2272.879) -- 0:01:44 28500 -- (-2274.561) (-2273.223) [-2284.010] (-2280.442) * (-2284.967) (-2291.678) (-2273.094) [-2273.660] -- 0:01:42 29000 -- (-2272.536) (-2272.092) [-2289.209] (-2282.489) * (-2277.216) (-2283.562) (-2272.911) [-2272.836] -- 0:01:40 29500 -- (-2273.033) (-2271.359) [-2280.023] (-2283.322) * (-2277.831) [-2283.302] (-2272.755) (-2271.907) -- 0:01:38 30000 -- (-2274.824) (-2271.883) [-2282.720] (-2285.985) * [-2285.481] (-2286.897) (-2273.499) (-2272.164) -- 0:01:37 Average standard deviation of split frequencies: 0.049959 30500 -- (-2274.523) [-2271.259] (-2279.027) (-2282.639) * (-2301.259) (-2285.418) [-2277.860] (-2272.232) -- 0:01:35 31000 -- (-2274.214) (-2271.257) [-2278.112] (-2287.064) * [-2278.899] (-2281.201) (-2276.499) (-2271.870) -- 0:01:33 31500 -- [-2277.561] (-2271.183) (-2283.773) (-2283.609) * (-2284.215) (-2293.292) [-2271.145] (-2271.963) -- 0:01:32 32000 -- (-2273.443) (-2273.135) [-2280.869] (-2281.925) * (-2281.393) (-2284.885) (-2271.150) [-2272.334] -- 0:01:30 32500 -- [-2272.185] (-2273.135) (-2286.828) (-2290.907) * (-2284.071) [-2276.601] (-2272.603) (-2272.334) -- 0:01:29 33000 -- [-2272.193] (-2273.725) (-2276.728) (-2277.108) * (-2279.237) (-2282.377) (-2272.603) [-2272.334] -- 0:01:27 33500 -- (-2274.025) (-2279.116) (-2279.019) [-2276.093] * (-2292.192) (-2283.774) [-2273.298] (-2272.090) -- 0:01:26 34000 -- (-2273.238) (-2277.088) (-2280.039) [-2276.712] * (-2284.352) (-2281.180) (-2272.489) [-2272.519] -- 0:01:25 34500 -- (-2275.093) [-2274.234] (-2289.283) (-2278.490) * (-2283.485) [-2280.757] (-2274.655) (-2274.987) -- 0:01:23 35000 -- (-2274.442) (-2274.858) (-2276.421) [-2279.825] * (-2290.285) [-2281.486] (-2272.088) (-2274.145) -- 0:01:22 Average standard deviation of split frequencies: 0.044641 35500 -- (-2272.595) (-2275.427) (-2281.513) [-2279.509] * (-2273.211) (-2289.429) (-2272.752) [-2272.872] -- 0:01:21 36000 -- (-2271.993) (-2273.684) [-2282.789] (-2280.344) * [-2272.895] (-2294.260) (-2273.346) (-2272.858) -- 0:01:20 36500 -- (-2273.100) [-2271.467] (-2275.100) (-2276.531) * [-2272.133] (-2281.912) (-2272.646) (-2272.871) -- 0:01:19 37000 -- (-2272.000) (-2271.823) (-2292.159) [-2277.729] * (-2273.056) (-2288.198) [-2273.298] (-2272.033) -- 0:01:18 37500 -- (-2273.444) [-2273.008] (-2280.845) (-2285.970) * [-2272.601] (-2282.081) (-2272.189) (-2273.849) -- 0:01:17 38000 -- [-2272.936] (-2271.963) (-2280.043) (-2277.368) * (-2273.027) (-2279.528) [-2278.683] (-2271.752) -- 0:01:15 38500 -- (-2272.714) (-2272.968) (-2283.839) [-2283.022] * (-2273.796) [-2287.552] (-2281.939) (-2271.419) -- 0:01:14 39000 -- (-2272.148) [-2273.752] (-2284.395) (-2282.674) * (-2273.409) (-2281.406) (-2272.518) [-2271.507] -- 0:01:13 39500 -- (-2272.193) (-2272.042) [-2279.942] (-2294.218) * (-2273.098) (-2279.632) (-2271.408) [-2274.470] -- 0:01:37 40000 -- [-2274.036] (-2273.049) (-2288.075) (-2280.181) * (-2275.434) (-2282.561) [-2271.408] (-2272.205) -- 0:01:36 Average standard deviation of split frequencies: 0.036606 40500 -- (-2275.717) [-2273.795] (-2279.799) (-2277.464) * (-2274.166) (-2281.285) [-2271.331] (-2274.556) -- 0:01:34 41000 -- (-2273.900) (-2271.480) [-2277.782] (-2283.610) * [-2271.799] (-2289.709) (-2273.106) (-2273.728) -- 0:01:33 41500 -- (-2273.907) (-2271.378) [-2277.017] (-2281.436) * [-2273.063] (-2288.774) (-2274.834) (-2272.355) -- 0:01:32 42000 -- (-2274.076) (-2271.328) [-2278.447] (-2280.107) * [-2273.851] (-2273.718) (-2272.904) (-2272.348) -- 0:01:31 42500 -- (-2274.678) (-2271.219) (-2282.118) [-2280.368] * [-2273.695] (-2282.485) (-2273.008) (-2274.167) -- 0:01:30 43000 -- (-2277.198) (-2270.990) (-2283.678) [-2278.685] * (-2275.756) [-2280.187] (-2274.294) (-2274.109) -- 0:01:29 43500 -- [-2275.288] (-2271.707) (-2283.982) (-2285.740) * (-2272.451) [-2281.537] (-2273.537) (-2274.398) -- 0:01:27 44000 -- (-2276.445) (-2271.440) [-2278.384] (-2294.127) * [-2271.429] (-2287.192) (-2272.953) (-2274.804) -- 0:01:26 44500 -- (-2278.033) (-2271.440) [-2281.274] (-2281.998) * [-2271.193] (-2282.605) (-2273.282) (-2272.788) -- 0:01:25 45000 -- (-2276.323) (-2271.371) (-2280.665) [-2275.956] * (-2271.402) (-2281.326) (-2275.998) [-2271.589] -- 0:01:24 Average standard deviation of split frequencies: 0.036380 45500 -- (-2272.325) (-2271.640) [-2280.511] (-2284.686) * [-2271.394] (-2280.625) (-2273.846) (-2273.220) -- 0:01:23 46000 -- [-2272.086] (-2274.228) (-2281.007) (-2283.601) * (-2272.072) (-2278.275) [-2273.832] (-2271.753) -- 0:01:22 46500 -- (-2272.596) (-2272.843) [-2280.218] (-2274.051) * (-2272.224) (-2276.785) (-2274.123) [-2271.414] -- 0:01:22 47000 -- (-2273.009) (-2272.132) (-2279.108) [-2272.141] * [-2272.018] (-2283.163) (-2274.600) (-2271.338) -- 0:01:21 47500 -- (-2272.335) [-2272.443] (-2288.298) (-2271.874) * (-2271.882) (-2288.225) [-2274.794] (-2273.382) -- 0:01:20 48000 -- (-2272.601) (-2271.978) (-2282.684) [-2272.167] * (-2272.370) [-2287.785] (-2274.500) (-2272.769) -- 0:01:19 48500 -- (-2272.768) [-2275.574] (-2282.853) (-2271.628) * (-2272.201) (-2286.516) (-2274.146) [-2275.535] -- 0:01:18 49000 -- (-2271.963) (-2273.029) [-2294.203] (-2273.284) * (-2273.017) (-2281.323) [-2272.612] (-2275.362) -- 0:01:17 49500 -- [-2271.663] (-2272.786) (-2281.883) (-2273.076) * [-2273.017] (-2276.303) (-2272.883) (-2278.016) -- 0:01:16 50000 -- [-2274.076] (-2272.740) (-2285.738) (-2273.983) * (-2272.807) (-2277.238) [-2272.719] (-2277.633) -- 0:01:16 Average standard deviation of split frequencies: 0.029773 50500 -- [-2272.291] (-2272.298) (-2279.542) (-2273.897) * (-2271.847) [-2282.663] (-2273.013) (-2277.804) -- 0:01:15 51000 -- (-2272.225) [-2272.617] (-2278.102) (-2274.331) * (-2275.077) [-2271.513] (-2273.527) (-2274.050) -- 0:01:14 51500 -- (-2272.164) (-2272.947) [-2283.153] (-2272.404) * (-2272.676) (-2272.336) [-2274.611] (-2273.606) -- 0:01:13 52000 -- (-2272.667) (-2273.044) (-2284.126) [-2275.304] * (-2271.840) (-2271.756) (-2273.632) [-2271.619] -- 0:01:12 52500 -- (-2272.667) [-2272.996] (-2293.681) (-2273.952) * [-2272.776] (-2276.195) (-2273.440) (-2271.609) -- 0:01:30 53000 -- (-2275.261) [-2272.639] (-2285.090) (-2278.873) * (-2273.405) (-2279.065) [-2273.440] (-2272.993) -- 0:01:29 53500 -- [-2272.840] (-2272.768) (-2283.571) (-2278.942) * (-2273.833) (-2272.296) (-2273.967) [-2271.221] -- 0:01:28 54000 -- (-2276.132) (-2273.442) [-2279.949] (-2276.509) * [-2273.621] (-2273.299) (-2272.637) (-2271.275) -- 0:01:27 54500 -- (-2274.806) (-2272.373) [-2285.975] (-2276.590) * (-2273.573) (-2274.716) (-2272.642) [-2271.446] -- 0:01:26 55000 -- (-2276.252) [-2272.613] (-2290.052) (-2272.886) * (-2274.843) [-2273.205] (-2272.196) (-2272.134) -- 0:01:25 Average standard deviation of split frequencies: 0.034073 55500 -- [-2273.887] (-2272.002) (-2286.994) (-2272.205) * (-2273.218) (-2272.277) [-2273.267] (-2279.289) -- 0:01:25 56000 -- (-2273.932) [-2272.686] (-2282.671) (-2273.991) * (-2272.283) (-2276.691) [-2274.180] (-2272.924) -- 0:01:24 56500 -- (-2275.345) (-2272.778) (-2278.231) [-2272.284] * (-2272.099) (-2272.108) (-2272.669) [-2276.685] -- 0:01:23 57000 -- (-2276.656) (-2272.453) (-2286.821) [-2274.951] * (-2273.050) (-2272.229) [-2272.331] (-2273.981) -- 0:01:22 57500 -- (-2278.166) [-2276.308] (-2283.606) (-2272.350) * (-2273.591) (-2271.259) [-2273.359] (-2271.307) -- 0:01:21 58000 -- (-2276.678) (-2272.782) [-2284.861] (-2272.349) * (-2273.781) (-2271.268) (-2273.756) [-2273.167] -- 0:01:21 58500 -- (-2275.977) (-2273.901) [-2283.322] (-2271.596) * (-2273.604) (-2274.208) [-2273.638] (-2271.255) -- 0:01:20 59000 -- [-2273.389] (-2273.386) (-2281.734) (-2272.389) * (-2271.846) (-2273.564) (-2277.879) [-2272.333] -- 0:01:19 59500 -- (-2273.227) (-2273.386) (-2280.537) [-2272.583] * [-2274.924] (-2272.132) (-2275.063) (-2272.629) -- 0:01:19 60000 -- (-2274.302) (-2272.542) [-2278.598] (-2274.926) * (-2271.440) [-2273.811] (-2275.547) (-2276.053) -- 0:01:18 Average standard deviation of split frequencies: 0.031082 60500 -- (-2273.225) (-2273.327) [-2282.630] (-2278.329) * (-2271.370) (-2272.693) [-2276.320] (-2273.978) -- 0:01:17 61000 -- [-2273.169] (-2272.908) (-2277.956) (-2271.564) * (-2271.904) [-2275.732] (-2274.208) (-2272.609) -- 0:01:16 61500 -- (-2272.306) (-2275.549) [-2284.934] (-2272.024) * (-2275.170) (-2274.432) [-2275.579] (-2272.970) -- 0:01:16 62000 -- (-2272.910) (-2273.919) (-2290.268) [-2273.202] * [-2275.001] (-2276.360) (-2273.878) (-2275.433) -- 0:01:15 62500 -- (-2275.014) [-2272.940] (-2290.297) (-2275.356) * (-2277.149) (-2275.758) (-2273.750) [-2276.045] -- 0:01:15 63000 -- (-2272.922) [-2273.734] (-2291.122) (-2272.540) * (-2271.213) [-2271.225] (-2275.265) (-2276.703) -- 0:01:14 63500 -- (-2271.220) (-2272.150) (-2281.388) [-2272.503] * [-2275.459] (-2272.167) (-2273.921) (-2277.920) -- 0:01:13 64000 -- (-2271.354) (-2272.237) (-2280.830) [-2275.067] * (-2273.587) (-2273.040) [-2273.705] (-2274.125) -- 0:01:13 64500 -- [-2273.691] (-2272.259) (-2279.147) (-2273.115) * [-2274.078] (-2273.285) (-2273.943) (-2274.043) -- 0:01:12 65000 -- (-2275.536) (-2271.980) (-2273.996) [-2272.449] * [-2272.501] (-2270.837) (-2273.011) (-2273.850) -- 0:01:11 Average standard deviation of split frequencies: 0.028570 65500 -- (-2273.577) (-2272.065) [-2274.160] (-2274.006) * (-2273.160) (-2271.201) (-2272.905) [-2272.312] -- 0:01:11 66000 -- (-2274.891) (-2273.397) [-2274.177] (-2273.356) * (-2272.617) (-2274.143) (-2272.209) [-2272.262] -- 0:01:10 66500 -- (-2277.405) (-2274.328) [-2273.272] (-2272.930) * [-2272.621] (-2271.351) (-2273.902) (-2279.785) -- 0:01:24 67000 -- (-2272.767) (-2273.432) (-2274.679) [-2272.503] * [-2272.153] (-2271.652) (-2277.111) (-2279.222) -- 0:01:23 67500 -- (-2273.450) [-2275.260] (-2275.377) (-2272.802) * (-2271.747) (-2271.012) (-2274.743) [-2272.706] -- 0:01:22 68000 -- (-2273.454) (-2273.511) [-2274.357] (-2271.977) * (-2274.412) (-2271.002) [-2275.295] (-2272.647) -- 0:01:22 68500 -- (-2275.729) (-2274.276) [-2272.509] (-2275.710) * (-2279.808) [-2274.062] (-2276.925) (-2272.559) -- 0:01:21 69000 -- (-2273.507) (-2274.689) [-2272.975] (-2277.385) * (-2274.990) (-2272.134) [-2274.215] (-2272.471) -- 0:01:20 69500 -- (-2273.672) [-2273.588] (-2273.724) (-2272.169) * (-2274.277) (-2272.103) (-2274.427) [-2276.763] -- 0:01:20 70000 -- (-2274.873) [-2273.042] (-2274.102) (-2272.477) * (-2275.254) (-2270.906) (-2272.724) [-2272.350] -- 0:01:19 Average standard deviation of split frequencies: 0.027593 70500 -- (-2274.690) [-2273.871] (-2274.037) (-2272.570) * (-2273.763) (-2271.573) (-2274.103) [-2272.562] -- 0:01:19 71000 -- (-2273.039) (-2275.007) (-2272.975) [-2275.625] * (-2272.996) (-2270.884) (-2275.087) [-2272.648] -- 0:01:18 71500 -- (-2273.074) (-2272.412) [-2276.902] (-2272.989) * (-2273.827) [-2271.320] (-2271.644) (-2273.128) -- 0:01:17 72000 -- (-2272.949) (-2275.319) [-2271.717] (-2273.920) * (-2273.878) (-2272.248) [-2270.805] (-2273.745) -- 0:01:17 72500 -- (-2276.027) (-2275.923) (-2271.514) [-2275.443] * [-2273.034] (-2272.936) (-2271.372) (-2275.930) -- 0:01:16 73000 -- (-2273.606) (-2275.970) (-2272.739) [-2272.216] * [-2273.421] (-2271.032) (-2271.327) (-2275.639) -- 0:01:16 73500 -- [-2276.240] (-2274.904) (-2273.613) (-2272.823) * [-2273.535] (-2272.101) (-2271.980) (-2275.631) -- 0:01:15 74000 -- (-2277.563) (-2274.201) (-2272.315) [-2272.240] * (-2272.042) (-2272.819) (-2280.626) [-2271.091] -- 0:01:15 74500 -- (-2271.793) (-2276.412) (-2275.416) [-2272.549] * (-2271.548) (-2277.169) (-2271.868) [-2273.193] -- 0:01:14 75000 -- [-2272.974] (-2274.163) (-2273.487) (-2271.690) * [-2272.658] (-2272.811) (-2272.656) (-2273.088) -- 0:01:14 Average standard deviation of split frequencies: 0.025790 75500 -- (-2271.217) (-2274.097) [-2272.599] (-2271.827) * [-2272.799] (-2274.045) (-2274.100) (-2274.632) -- 0:01:13 76000 -- (-2271.217) (-2276.000) (-2276.077) [-2271.826] * (-2272.956) [-2273.593] (-2272.541) (-2272.947) -- 0:01:12 76500 -- (-2273.355) (-2275.705) (-2276.722) [-2274.205] * (-2276.861) [-2275.415] (-2274.858) (-2272.945) -- 0:01:12 77000 -- (-2272.517) (-2272.856) (-2282.587) [-2272.214] * (-2275.635) [-2270.982] (-2274.479) (-2272.748) -- 0:01:11 77500 -- [-2271.860] (-2276.202) (-2271.935) (-2275.146) * (-2274.524) (-2271.211) [-2273.641] (-2272.515) -- 0:01:11 78000 -- (-2271.165) (-2272.542) (-2271.109) [-2275.355] * [-2273.883] (-2271.210) (-2274.574) (-2272.894) -- 0:01:10 78500 -- (-2272.378) (-2271.833) [-2271.283] (-2276.129) * [-2272.123] (-2271.427) (-2276.282) (-2273.260) -- 0:01:10 79000 -- (-2271.011) (-2271.711) (-2271.379) [-2274.121] * [-2272.431] (-2271.427) (-2274.797) (-2272.110) -- 0:01:09 79500 -- (-2272.840) (-2271.771) (-2271.339) [-2273.428] * [-2272.707] (-2274.196) (-2273.760) (-2276.471) -- 0:01:09 80000 -- [-2275.940] (-2271.979) (-2271.338) (-2276.495) * (-2272.594) [-2274.774] (-2274.595) (-2275.474) -- 0:01:09 Average standard deviation of split frequencies: 0.025221 80500 -- (-2271.205) [-2271.985] (-2271.429) (-2276.154) * (-2272.611) (-2274.776) [-2272.989] (-2272.557) -- 0:01:19 81000 -- [-2271.256] (-2272.586) (-2271.882) (-2278.180) * (-2272.757) (-2271.503) [-2272.619] (-2272.894) -- 0:01:19 81500 -- (-2272.201) [-2275.236] (-2271.158) (-2284.071) * (-2271.388) (-2273.106) [-2272.527] (-2272.114) -- 0:01:18 82000 -- (-2273.049) (-2276.024) (-2271.385) [-2272.497] * (-2274.697) (-2271.912) (-2273.368) [-2271.758] -- 0:01:18 82500 -- (-2271.829) (-2272.953) [-2273.945] (-2271.967) * (-2271.825) (-2271.662) (-2272.107) [-2272.362] -- 0:01:17 83000 -- (-2272.685) [-2272.348] (-2273.333) (-2273.822) * (-2271.670) (-2275.670) (-2273.660) [-2271.817] -- 0:01:17 83500 -- (-2273.318) (-2272.369) [-2271.685] (-2273.218) * (-2271.561) (-2271.904) [-2274.669] (-2271.840) -- 0:01:16 84000 -- (-2272.359) (-2272.709) [-2272.156] (-2277.167) * (-2273.086) (-2273.090) [-2272.489] (-2271.840) -- 0:01:16 84500 -- (-2272.359) (-2270.892) (-2272.649) [-2277.941] * (-2273.174) [-2271.315] (-2273.483) (-2271.860) -- 0:01:15 85000 -- (-2272.294) (-2270.961) [-2273.135] (-2273.387) * (-2273.260) (-2270.997) (-2271.976) [-2272.738] -- 0:01:15 Average standard deviation of split frequencies: 0.018794 85500 -- (-2273.059) (-2272.815) [-2273.376] (-2274.800) * (-2273.167) (-2272.826) (-2277.683) [-2271.717] -- 0:01:14 86000 -- (-2272.302) (-2272.064) [-2272.345] (-2273.055) * [-2271.602] (-2276.964) (-2274.110) (-2273.129) -- 0:01:14 86500 -- (-2274.601) [-2272.841] (-2274.414) (-2271.573) * [-2274.901] (-2276.964) (-2274.472) (-2273.123) -- 0:01:13 87000 -- (-2275.704) (-2274.069) [-2271.380] (-2272.670) * (-2271.992) (-2272.674) (-2272.986) [-2272.152] -- 0:01:13 87500 -- (-2272.433) (-2273.550) (-2275.151) [-2273.323] * [-2273.125] (-2276.263) (-2281.377) (-2272.479) -- 0:01:13 88000 -- (-2272.070) (-2271.701) (-2271.512) [-2274.270] * (-2271.669) (-2272.076) [-2272.561] (-2272.411) -- 0:01:12 88500 -- (-2274.291) [-2274.789] (-2272.383) (-2274.546) * (-2271.864) (-2272.059) [-2273.095] (-2272.585) -- 0:01:12 89000 -- (-2272.992) [-2272.053] (-2273.113) (-2272.227) * [-2272.107] (-2272.758) (-2273.089) (-2273.402) -- 0:01:11 89500 -- (-2278.183) (-2272.041) (-2271.635) [-2272.535] * (-2276.897) (-2272.436) [-2277.510] (-2273.410) -- 0:01:11 90000 -- (-2276.919) (-2272.093) (-2272.142) [-2272.395] * (-2275.626) [-2272.267] (-2274.636) (-2275.740) -- 0:01:10 Average standard deviation of split frequencies: 0.019143 90500 -- [-2274.083] (-2271.992) (-2272.891) (-2277.195) * (-2273.792) (-2273.103) (-2274.469) [-2271.452] -- 0:01:10 91000 -- (-2274.257) [-2273.020] (-2273.772) (-2277.600) * (-2273.856) [-2272.067] (-2273.753) (-2273.834) -- 0:01:09 91500 -- (-2274.810) (-2272.968) (-2273.426) [-2273.451] * (-2272.381) [-2271.407] (-2273.247) (-2272.606) -- 0:01:09 92000 -- (-2281.132) (-2272.611) (-2271.270) [-2273.408] * [-2271.998] (-2272.326) (-2272.547) (-2273.052) -- 0:01:09 92500 -- (-2276.092) (-2272.584) (-2274.007) [-2274.091] * (-2272.247) (-2272.210) (-2271.709) [-2273.051] -- 0:01:08 93000 -- (-2275.452) (-2272.332) [-2274.300] (-2278.260) * [-2272.405] (-2273.082) (-2271.565) (-2276.395) -- 0:01:08 93500 -- (-2274.753) (-2272.009) [-2273.089] (-2279.459) * (-2272.302) (-2272.766) (-2276.691) [-2274.219] -- 0:01:07 94000 -- [-2276.165] (-2271.568) (-2273.081) (-2275.920) * (-2274.316) (-2271.676) (-2271.380) [-2273.504] -- 0:01:17 94500 -- (-2276.012) [-2271.705] (-2273.360) (-2277.080) * (-2272.254) (-2271.976) [-2273.050] (-2273.237) -- 0:01:16 95000 -- (-2276.412) [-2273.019] (-2273.710) (-2275.532) * (-2273.253) [-2271.937] (-2272.221) (-2275.906) -- 0:01:16 Average standard deviation of split frequencies: 0.019642 95500 -- (-2276.052) [-2275.283] (-2275.252) (-2273.163) * (-2275.699) (-2273.029) (-2271.635) [-2275.135] -- 0:01:15 96000 -- (-2278.691) (-2276.515) [-2274.062] (-2272.370) * (-2272.950) [-2271.962] (-2272.922) (-2275.225) -- 0:01:15 96500 -- (-2275.989) (-2274.876) [-2273.990] (-2273.671) * [-2273.279] (-2273.263) (-2274.255) (-2275.828) -- 0:01:14 97000 -- (-2279.426) (-2274.431) [-2273.757] (-2275.655) * [-2272.615] (-2272.738) (-2273.497) (-2272.823) -- 0:01:14 97500 -- (-2279.024) [-2276.475] (-2276.651) (-2271.997) * (-2273.331) (-2272.115) (-2274.745) [-2276.304] -- 0:01:14 98000 -- (-2276.133) [-2273.942] (-2279.853) (-2274.031) * (-2273.465) [-2273.953] (-2274.059) (-2276.087) -- 0:01:13 98500 -- [-2273.440] (-2272.178) (-2278.174) (-2272.464) * (-2273.597) (-2276.949) (-2273.736) [-2276.261] -- 0:01:13 99000 -- (-2273.594) [-2271.758] (-2272.345) (-2273.085) * [-2273.299] (-2271.349) (-2273.912) (-2276.115) -- 0:01:12 99500 -- (-2273.584) (-2271.621) [-2274.709] (-2271.692) * (-2274.412) (-2271.438) (-2275.591) [-2274.712] -- 0:01:12 100000 -- (-2273.128) (-2272.232) [-2275.361] (-2272.140) * [-2272.818] (-2271.778) (-2276.911) (-2273.521) -- 0:01:12 Average standard deviation of split frequencies: 0.018497 100500 -- [-2271.455] (-2272.579) (-2274.227) (-2271.469) * [-2272.267] (-2273.131) (-2277.964) (-2277.115) -- 0:01:11 101000 -- (-2271.130) (-2272.480) (-2274.040) [-2271.469] * (-2275.564) [-2271.117] (-2274.883) (-2277.950) -- 0:01:11 101500 -- (-2272.034) [-2272.684] (-2274.038) (-2271.192) * (-2275.651) (-2271.117) [-2271.685] (-2271.653) -- 0:01:10 102000 -- [-2272.763] (-2272.355) (-2273.613) (-2271.793) * (-2276.696) (-2270.851) [-2274.365] (-2271.980) -- 0:01:10 102500 -- (-2272.869) [-2273.548] (-2273.696) (-2271.793) * (-2273.714) [-2270.849] (-2273.518) (-2273.112) -- 0:01:10 103000 -- [-2271.740] (-2273.993) (-2272.811) (-2274.054) * (-2275.885) (-2270.941) (-2273.380) [-2273.837] -- 0:01:09 103500 -- (-2271.359) [-2271.804] (-2272.712) (-2272.423) * (-2278.055) (-2273.294) [-2273.396] (-2274.857) -- 0:01:09 104000 -- (-2274.583) (-2272.310) [-2274.044] (-2272.802) * (-2275.661) [-2271.680] (-2273.673) (-2276.478) -- 0:01:08 104500 -- (-2272.208) (-2274.003) (-2274.667) [-2273.744] * (-2276.730) [-2271.616] (-2272.571) (-2275.114) -- 0:01:08 105000 -- (-2272.242) [-2274.165] (-2270.893) (-2275.117) * (-2276.138) (-2271.611) [-2273.098] (-2276.353) -- 0:01:08 Average standard deviation of split frequencies: 0.018636 105500 -- (-2272.182) [-2272.778] (-2270.885) (-2274.891) * (-2276.306) (-2271.024) (-2275.351) [-2271.904] -- 0:01:07 106000 -- [-2274.464] (-2272.779) (-2270.885) (-2274.626) * (-2276.824) (-2272.436) [-2272.294] (-2272.579) -- 0:01:07 106500 -- (-2275.889) [-2275.297] (-2271.667) (-2274.320) * [-2273.708] (-2273.785) (-2272.172) (-2272.641) -- 0:01:07 107000 -- (-2273.250) (-2272.663) [-2271.844] (-2275.967) * (-2273.989) (-2274.070) (-2271.980) [-2271.744] -- 0:01:15 107500 -- (-2273.243) (-2274.064) (-2271.930) [-2274.070] * (-2273.204) (-2272.560) (-2272.138) [-2271.837] -- 0:01:14 108000 -- [-2272.216] (-2274.091) (-2271.281) (-2277.310) * (-2274.348) (-2270.869) (-2273.365) [-2273.876] -- 0:01:14 108500 -- (-2272.217) (-2276.165) [-2273.875] (-2280.490) * (-2272.041) [-2270.901] (-2272.865) (-2272.559) -- 0:01:13 109000 -- (-2272.427) [-2274.831] (-2273.627) (-2276.774) * [-2271.021] (-2271.834) (-2276.913) (-2272.830) -- 0:01:13 109500 -- (-2272.741) (-2275.782) [-2273.497] (-2273.338) * (-2273.453) (-2271.715) [-2272.528] (-2271.389) -- 0:01:13 110000 -- (-2273.553) (-2273.212) (-2273.401) [-2274.742] * (-2271.050) [-2273.777] (-2273.676) (-2271.518) -- 0:01:12 Average standard deviation of split frequencies: 0.020690 110500 -- [-2273.438] (-2273.981) (-2273.867) (-2274.157) * (-2275.043) (-2271.453) [-2272.528] (-2272.982) -- 0:01:12 111000 -- (-2273.635) [-2272.551] (-2274.277) (-2274.337) * (-2271.909) (-2271.195) [-2272.791] (-2271.469) -- 0:01:12 111500 -- (-2277.171) [-2271.804] (-2274.290) (-2274.164) * (-2273.066) (-2272.591) (-2272.285) [-2271.465] -- 0:01:11 112000 -- (-2276.827) (-2271.804) (-2272.624) [-2275.197] * (-2271.920) (-2271.390) (-2275.782) [-2271.464] -- 0:01:11 112500 -- (-2274.706) (-2272.572) [-2272.419] (-2274.783) * (-2271.258) (-2272.951) [-2276.305] (-2272.231) -- 0:01:11 113000 -- [-2275.632] (-2274.453) (-2273.048) (-2275.390) * [-2273.089] (-2272.427) (-2273.296) (-2273.004) -- 0:01:10 113500 -- (-2271.882) (-2274.099) (-2274.577) [-2275.566] * (-2274.557) (-2276.193) (-2272.762) [-2275.790] -- 0:01:10 114000 -- (-2273.112) [-2271.881] (-2277.108) (-2275.184) * (-2272.998) (-2273.397) [-2272.891] (-2273.314) -- 0:01:09 114500 -- [-2273.684] (-2271.881) (-2271.713) (-2272.754) * (-2271.565) [-2272.942] (-2273.338) (-2271.623) -- 0:01:09 115000 -- (-2273.429) [-2271.909] (-2273.372) (-2273.900) * (-2271.784) [-2274.467] (-2273.871) (-2271.541) -- 0:01:09 Average standard deviation of split frequencies: 0.018287 115500 -- (-2274.144) [-2271.060] (-2272.954) (-2273.868) * [-2271.383] (-2273.745) (-2274.051) (-2271.692) -- 0:01:08 116000 -- (-2271.733) [-2271.060] (-2275.078) (-2274.419) * (-2271.351) [-2275.390] (-2273.450) (-2274.974) -- 0:01:08 116500 -- [-2274.253] (-2271.459) (-2275.012) (-2274.385) * (-2271.812) (-2274.489) [-2273.323] (-2274.780) -- 0:01:08 117000 -- (-2272.921) [-2275.695] (-2274.098) (-2278.892) * [-2275.357] (-2274.489) (-2275.167) (-2273.851) -- 0:01:07 117500 -- [-2272.388] (-2275.839) (-2274.377) (-2276.350) * (-2272.617) [-2274.988] (-2273.531) (-2276.299) -- 0:01:07 118000 -- (-2272.731) (-2277.355) [-2271.628] (-2272.827) * (-2271.871) (-2272.378) (-2273.663) [-2271.093] -- 0:01:07 118500 -- (-2271.849) (-2274.541) [-2271.819] (-2274.528) * (-2273.913) (-2272.246) (-2276.070) [-2271.464] -- 0:01:06 119000 -- (-2272.094) (-2274.695) (-2272.034) [-2273.798] * (-2275.501) (-2272.468) (-2273.218) [-2271.056] -- 0:01:06 119500 -- (-2271.836) [-2275.027] (-2275.653) (-2277.704) * (-2274.249) [-2271.584] (-2277.501) (-2271.478) -- 0:01:06 120000 -- [-2273.595] (-2274.437) (-2274.172) (-2275.948) * (-2275.581) (-2271.574) (-2274.068) [-2271.478] -- 0:01:06 Average standard deviation of split frequencies: 0.021704 120500 -- (-2272.766) (-2272.278) (-2273.661) [-2271.353] * (-2275.314) (-2271.754) (-2272.996) [-2271.181] -- 0:01:05 121000 -- (-2275.025) (-2278.055) [-2274.166] (-2272.238) * (-2275.426) [-2271.739] (-2273.554) (-2271.790) -- 0:01:12 121500 -- [-2272.258] (-2278.074) (-2273.090) (-2272.228) * (-2273.647) (-2271.480) (-2272.948) [-2271.225] -- 0:01:12 122000 -- (-2271.804) [-2272.685] (-2274.047) (-2271.323) * (-2274.827) (-2272.021) (-2274.018) [-2271.225] -- 0:01:11 122500 -- (-2272.037) [-2273.127] (-2276.841) (-2272.136) * (-2275.681) [-2272.336] (-2272.320) (-2271.225) -- 0:01:11 123000 -- (-2271.582) [-2272.624] (-2273.690) (-2272.034) * [-2273.543] (-2271.860) (-2272.588) (-2271.659) -- 0:01:11 123500 -- (-2271.379) [-2272.338] (-2277.116) (-2272.406) * (-2274.213) [-2273.573] (-2272.856) (-2271.838) -- 0:01:10 124000 -- (-2271.530) (-2274.662) (-2276.481) [-2272.449] * (-2273.076) [-2274.182] (-2273.531) (-2271.838) -- 0:01:10 124500 -- [-2271.530] (-2272.663) (-2275.785) (-2271.459) * (-2274.748) [-2273.977] (-2272.983) (-2273.800) -- 0:01:10 125000 -- (-2271.594) [-2272.618] (-2272.217) (-2272.179) * (-2271.573) [-2274.444] (-2277.885) (-2274.042) -- 0:01:10 Average standard deviation of split frequencies: 0.021087 125500 -- (-2271.329) (-2273.004) [-2272.645] (-2272.271) * (-2271.624) [-2275.858] (-2275.271) (-2273.806) -- 0:01:09 126000 -- (-2270.926) (-2272.769) [-2271.565] (-2271.688) * (-2271.572) [-2273.671] (-2275.271) (-2276.566) -- 0:01:09 126500 -- (-2271.302) [-2272.640] (-2271.512) (-2271.672) * (-2271.506) [-2273.829] (-2274.419) (-2275.356) -- 0:01:09 127000 -- [-2272.041] (-2273.040) (-2271.633) (-2271.838) * (-2272.894) [-2274.025] (-2272.700) (-2277.706) -- 0:01:08 127500 -- (-2272.593) [-2273.524] (-2272.358) (-2271.618) * [-2272.206] (-2273.000) (-2274.748) (-2275.097) -- 0:01:08 128000 -- (-2279.665) [-2272.005] (-2274.555) (-2271.591) * (-2277.544) (-2272.236) [-2272.168] (-2273.843) -- 0:01:08 128500 -- (-2280.363) (-2272.684) (-2272.386) [-2271.590] * [-2274.515] (-2271.451) (-2271.488) (-2273.684) -- 0:01:07 129000 -- (-2274.841) [-2272.963] (-2271.661) (-2272.404) * [-2276.785] (-2273.116) (-2275.062) (-2274.299) -- 0:01:07 129500 -- (-2274.840) (-2274.105) [-2272.790] (-2272.063) * [-2272.764] (-2273.808) (-2275.079) (-2272.631) -- 0:01:07 130000 -- (-2274.502) [-2275.698] (-2271.647) (-2272.816) * [-2272.118] (-2272.637) (-2275.751) (-2272.855) -- 0:01:06 Average standard deviation of split frequencies: 0.020564 130500 -- (-2270.890) (-2274.084) (-2271.606) [-2278.835] * (-2273.214) [-2272.557] (-2272.356) (-2274.870) -- 0:01:06 131000 -- (-2272.024) [-2272.784] (-2272.038) (-2278.264) * (-2272.830) [-2271.842] (-2272.356) (-2273.777) -- 0:01:06 131500 -- [-2271.072] (-2273.176) (-2277.326) (-2280.734) * (-2271.377) (-2272.258) (-2272.795) [-2272.110] -- 0:01:06 132000 -- [-2271.846] (-2271.725) (-2279.090) (-2273.572) * (-2271.900) (-2272.813) (-2271.907) [-2273.467] -- 0:01:05 132500 -- (-2271.305) [-2273.745] (-2272.224) (-2274.113) * (-2272.171) (-2275.260) [-2275.391] (-2273.501) -- 0:01:05 133000 -- [-2273.486] (-2274.317) (-2271.779) (-2274.167) * (-2272.379) (-2274.827) (-2279.605) [-2273.390] -- 0:01:05 133500 -- (-2272.560) [-2271.820] (-2271.635) (-2272.589) * (-2272.428) (-2275.453) [-2275.368] (-2272.452) -- 0:01:04 134000 -- (-2272.579) (-2272.015) [-2272.032] (-2275.930) * [-2273.407] (-2276.552) (-2278.030) (-2277.801) -- 0:01:04 134500 -- (-2275.221) [-2271.626] (-2275.418) (-2273.179) * (-2273.770) [-2273.212] (-2277.637) (-2277.121) -- 0:01:04 135000 -- (-2274.354) (-2278.806) [-2275.145] (-2277.617) * [-2273.630] (-2273.516) (-2277.843) (-2284.399) -- 0:01:04 Average standard deviation of split frequencies: 0.020797 135500 -- (-2273.961) [-2271.661] (-2275.512) (-2272.252) * (-2272.343) (-2274.387) (-2275.834) [-2274.805] -- 0:01:10 136000 -- (-2274.151) (-2274.574) [-2273.553] (-2274.657) * (-2271.748) (-2276.375) [-2274.519] (-2273.882) -- 0:01:09 136500 -- (-2275.443) (-2272.823) (-2272.874) [-2272.993] * (-2271.998) [-2272.261] (-2273.499) (-2273.768) -- 0:01:09 137000 -- (-2273.437) (-2271.831) (-2274.039) [-2273.028] * [-2271.954] (-2272.319) (-2274.143) (-2275.394) -- 0:01:09 137500 -- (-2273.134) (-2272.577) (-2272.912) [-2274.408] * (-2273.672) (-2272.468) [-2275.194] (-2275.142) -- 0:01:09 138000 -- (-2275.526) (-2275.805) (-2284.394) [-2272.379] * [-2271.404] (-2272.463) (-2275.339) (-2274.647) -- 0:01:08 138500 -- (-2271.206) [-2273.313] (-2282.685) (-2276.468) * [-2271.680] (-2271.393) (-2271.770) (-2272.573) -- 0:01:08 139000 -- (-2271.206) (-2274.613) (-2276.280) [-2271.780] * (-2271.971) (-2272.659) [-2271.773] (-2272.275) -- 0:01:08 139500 -- (-2271.263) (-2274.973) (-2276.328) [-2276.932] * (-2272.714) (-2272.712) [-2272.234] (-2272.858) -- 0:01:07 140000 -- [-2271.263] (-2274.861) (-2277.187) (-2271.669) * [-2272.511] (-2271.997) (-2270.970) (-2272.981) -- 0:01:07 Average standard deviation of split frequencies: 0.022577 140500 -- (-2273.125) (-2275.693) [-2275.858] (-2274.171) * (-2272.027) (-2272.733) [-2271.266] (-2272.212) -- 0:01:07 141000 -- [-2276.429] (-2275.667) (-2273.893) (-2274.493) * (-2276.026) [-2271.726] (-2271.661) (-2274.897) -- 0:01:07 141500 -- [-2276.370] (-2275.667) (-2271.890) (-2274.328) * [-2271.557] (-2271.481) (-2271.712) (-2274.424) -- 0:01:06 142000 -- (-2280.392) (-2277.035) [-2271.930] (-2274.624) * (-2271.333) [-2274.324] (-2272.291) (-2273.570) -- 0:01:06 142500 -- (-2274.237) (-2274.154) [-2272.697] (-2272.764) * (-2272.062) [-2275.166] (-2273.828) (-2274.718) -- 0:01:06 143000 -- (-2272.748) [-2273.817] (-2273.081) (-2273.656) * (-2272.128) [-2275.178] (-2275.015) (-2274.512) -- 0:01:05 143500 -- (-2274.883) [-2273.808] (-2273.227) (-2272.918) * [-2271.934] (-2276.718) (-2273.432) (-2273.074) -- 0:01:05 144000 -- (-2272.549) [-2273.345] (-2272.334) (-2272.719) * (-2276.566) (-2277.439) [-2273.105] (-2274.931) -- 0:01:05 144500 -- (-2273.333) [-2273.537] (-2271.058) (-2272.298) * [-2276.569] (-2278.040) (-2272.297) (-2275.154) -- 0:01:05 145000 -- (-2271.500) (-2274.741) (-2277.286) [-2273.570] * (-2272.015) (-2278.837) [-2271.675] (-2272.099) -- 0:01:04 Average standard deviation of split frequencies: 0.020400 145500 -- [-2272.313] (-2272.132) (-2275.473) (-2274.139) * (-2272.651) (-2276.351) [-2273.201] (-2272.852) -- 0:01:04 146000 -- (-2272.168) (-2273.090) [-2273.554] (-2271.550) * (-2272.603) (-2274.885) [-2274.050] (-2276.453) -- 0:01:04 146500 -- [-2276.213] (-2273.148) (-2275.102) (-2271.697) * (-2272.603) (-2274.708) (-2271.341) [-2275.671] -- 0:01:04 147000 -- (-2276.033) (-2273.748) (-2275.322) [-2271.696] * (-2272.583) (-2274.701) [-2271.582] (-2272.792) -- 0:01:03 147500 -- (-2271.337) (-2278.865) (-2272.040) [-2275.663] * (-2272.679) [-2275.688] (-2273.445) (-2272.719) -- 0:01:03 148000 -- [-2271.566] (-2272.847) (-2273.021) (-2276.169) * (-2274.157) (-2272.815) (-2271.572) [-2272.853] -- 0:01:03 148500 -- (-2271.174) (-2274.925) (-2278.125) [-2272.686] * (-2275.657) [-2275.718] (-2271.636) (-2272.718) -- 0:01:03 149000 -- (-2273.561) [-2275.149] (-2274.020) (-2272.975) * (-2276.624) [-2275.684] (-2272.068) (-2272.457) -- 0:01:02 149500 -- (-2272.581) (-2273.969) (-2271.322) [-2273.228] * [-2276.508] (-2274.855) (-2272.559) (-2274.921) -- 0:01:02 150000 -- (-2272.782) (-2274.448) [-2275.445] (-2272.298) * (-2275.249) (-2275.055) [-2273.428] (-2274.136) -- 0:01:08 Average standard deviation of split frequencies: 0.021475 150500 -- [-2272.313] (-2275.525) (-2278.579) (-2272.965) * (-2275.879) [-2275.596] (-2273.911) (-2274.481) -- 0:01:07 151000 -- [-2271.880] (-2275.257) (-2275.403) (-2272.417) * [-2271.245] (-2274.549) (-2274.397) (-2275.675) -- 0:01:07 151500 -- (-2272.347) [-2275.219] (-2274.380) (-2275.111) * [-2271.239] (-2277.301) (-2272.549) (-2277.626) -- 0:01:07 152000 -- (-2271.045) (-2272.491) (-2274.614) [-2274.007] * [-2271.134] (-2275.781) (-2274.050) (-2272.467) -- 0:01:06 152500 -- (-2271.324) (-2274.566) [-2276.725] (-2272.404) * [-2272.403] (-2273.126) (-2272.533) (-2273.367) -- 0:01:06 153000 -- [-2271.312] (-2272.412) (-2275.584) (-2273.192) * (-2271.261) (-2271.460) (-2273.015) [-2275.003] -- 0:01:06 153500 -- (-2270.879) [-2272.526] (-2274.860) (-2271.593) * (-2271.087) (-2271.397) (-2273.945) [-2273.003] -- 0:01:06 154000 -- (-2270.975) [-2272.647] (-2273.704) (-2271.676) * [-2274.460] (-2271.962) (-2273.067) (-2273.012) -- 0:01:05 154500 -- [-2271.179] (-2272.676) (-2275.257) (-2271.582) * (-2273.630) (-2274.166) [-2273.166] (-2273.850) -- 0:01:05 155000 -- (-2273.592) (-2272.578) (-2273.590) [-2271.331] * (-2274.488) (-2271.546) (-2273.221) [-2273.876] -- 0:01:05 Average standard deviation of split frequencies: 0.020577 155500 -- [-2274.046] (-2272.099) (-2271.923) (-2271.105) * (-2274.393) [-2271.258] (-2274.002) (-2271.841) -- 0:01:05 156000 -- [-2274.649] (-2273.183) (-2272.919) (-2272.273) * (-2271.174) [-2272.195] (-2273.516) (-2272.592) -- 0:01:04 156500 -- (-2274.382) [-2276.252] (-2274.436) (-2273.567) * (-2274.186) (-2272.607) (-2279.733) [-2272.307] -- 0:01:04 157000 -- (-2276.160) (-2274.671) (-2272.129) [-2272.884] * [-2273.295] (-2273.076) (-2275.761) (-2272.955) -- 0:01:04 157500 -- (-2271.207) [-2272.423] (-2272.129) (-2272.257) * [-2272.580] (-2273.773) (-2276.750) (-2271.928) -- 0:01:04 158000 -- (-2275.943) (-2272.397) (-2272.942) [-2270.949] * (-2275.174) [-2272.441] (-2272.530) (-2275.614) -- 0:01:03 158500 -- (-2273.220) [-2272.021] (-2273.121) (-2273.079) * (-2276.401) (-2274.324) [-2273.865] (-2272.604) -- 0:01:03 159000 -- (-2274.680) [-2273.342] (-2273.189) (-2272.220) * [-2274.692] (-2272.448) (-2273.517) (-2272.247) -- 0:01:03 159500 -- (-2275.017) [-2272.669] (-2271.678) (-2272.158) * (-2275.167) (-2273.568) [-2274.038] (-2272.011) -- 0:01:03 160000 -- (-2276.967) (-2273.164) [-2271.476] (-2273.296) * (-2274.534) (-2271.745) (-2274.293) [-2275.342] -- 0:01:02 Average standard deviation of split frequencies: 0.019952 160500 -- (-2273.870) [-2273.362] (-2271.471) (-2273.326) * (-2275.059) (-2271.287) (-2274.230) [-2273.818] -- 0:01:02 161000 -- (-2273.666) [-2271.352] (-2272.567) (-2273.178) * (-2272.785) (-2274.078) [-2274.368] (-2274.089) -- 0:01:02 161500 -- (-2274.346) (-2274.641) (-2275.758) [-2271.886] * (-2272.831) (-2272.766) (-2274.675) [-2273.351] -- 0:01:02 162000 -- (-2276.491) [-2274.204] (-2274.086) (-2271.687) * [-2273.173] (-2272.796) (-2274.632) (-2274.296) -- 0:01:02 162500 -- (-2274.855) (-2275.774) [-2273.867] (-2272.885) * (-2277.511) [-2271.744] (-2276.740) (-2272.614) -- 0:01:01 163000 -- [-2277.378] (-2276.497) (-2273.433) (-2272.009) * (-2273.465) [-2271.458] (-2273.380) (-2271.733) -- 0:01:01 163500 -- (-2275.133) (-2276.835) (-2271.746) [-2271.989] * [-2271.327] (-2272.674) (-2272.637) (-2276.625) -- 0:01:01 164000 -- (-2276.215) (-2281.178) [-2271.730] (-2272.565) * (-2271.734) (-2273.313) [-2274.458] (-2276.536) -- 0:01:06 164500 -- (-2276.292) [-2272.808] (-2271.571) (-2271.634) * (-2271.647) (-2272.898) (-2276.255) [-2273.450] -- 0:01:06 165000 -- (-2274.580) [-2271.885] (-2272.540) (-2271.909) * (-2274.643) (-2271.845) [-2274.004] (-2273.479) -- 0:01:05 Average standard deviation of split frequencies: 0.019027 165500 -- (-2274.370) (-2276.294) [-2272.509] (-2273.966) * (-2275.645) [-2272.522] (-2273.744) (-2275.766) -- 0:01:05 166000 -- [-2274.812] (-2273.178) (-2274.865) (-2273.009) * [-2277.082] (-2272.953) (-2274.553) (-2275.445) -- 0:01:05 166500 -- (-2276.908) (-2273.581) (-2271.776) [-2273.356] * (-2274.405) (-2272.493) (-2275.893) [-2275.423] -- 0:01:05 167000 -- [-2271.180] (-2273.586) (-2276.596) (-2276.613) * [-2272.589] (-2271.318) (-2272.499) (-2278.003) -- 0:01:04 167500 -- [-2271.246] (-2271.920) (-2277.848) (-2273.118) * (-2272.634) (-2274.076) (-2273.791) [-2274.460] -- 0:01:04 168000 -- (-2271.246) (-2275.472) (-2278.887) [-2272.888] * (-2271.807) (-2275.411) [-2274.769] (-2275.379) -- 0:01:04 168500 -- [-2275.448] (-2274.244) (-2273.246) (-2273.381) * [-2275.912] (-2272.494) (-2275.413) (-2273.615) -- 0:01:04 169000 -- (-2271.300) [-2272.225] (-2272.055) (-2273.628) * [-2275.956] (-2273.862) (-2274.463) (-2273.565) -- 0:01:03 169500 -- (-2273.419) (-2276.223) [-2272.621] (-2274.931) * (-2273.575) (-2272.350) (-2275.874) [-2276.672] -- 0:01:03 170000 -- (-2273.025) (-2275.988) (-2272.492) [-2274.794] * (-2275.184) (-2273.313) (-2274.364) [-2276.701] -- 0:01:03 Average standard deviation of split frequencies: 0.020440 170500 -- [-2272.529] (-2272.629) (-2273.181) (-2274.223) * (-2274.382) [-2273.403] (-2276.686) (-2276.709) -- 0:01:03 171000 -- (-2273.310) [-2273.777] (-2271.849) (-2273.712) * [-2273.158] (-2278.766) (-2274.707) (-2272.454) -- 0:01:03 171500 -- [-2273.205] (-2272.932) (-2272.684) (-2273.798) * [-2273.812] (-2278.005) (-2276.650) (-2272.695) -- 0:01:02 172000 -- (-2271.581) (-2273.010) [-2273.459] (-2273.299) * [-2272.487] (-2272.636) (-2273.549) (-2272.553) -- 0:01:02 172500 -- (-2272.387) [-2273.665] (-2271.800) (-2275.902) * (-2272.500) (-2272.564) [-2271.931] (-2273.391) -- 0:01:02 173000 -- [-2272.672] (-2271.755) (-2274.036) (-2273.424) * [-2272.240] (-2272.452) (-2271.198) (-2273.766) -- 0:01:02 173500 -- (-2276.553) (-2271.508) [-2274.194] (-2272.870) * (-2271.926) (-2273.079) (-2271.699) [-2273.624] -- 0:01:01 174000 -- (-2278.172) (-2271.432) (-2271.707) [-2272.758] * (-2272.858) [-2272.936] (-2276.318) (-2274.481) -- 0:01:01 174500 -- (-2271.838) (-2271.862) (-2272.449) [-2273.958] * [-2274.913] (-2272.193) (-2274.637) (-2275.301) -- 0:01:01 175000 -- [-2271.947] (-2271.626) (-2272.290) (-2277.917) * [-2275.764] (-2274.301) (-2273.485) (-2273.243) -- 0:01:01 Average standard deviation of split frequencies: 0.017762 175500 -- [-2273.157] (-2272.864) (-2272.308) (-2273.976) * [-2273.126] (-2278.570) (-2273.121) (-2272.144) -- 0:01:01 176000 -- (-2272.650) (-2271.153) [-2272.978] (-2274.058) * [-2273.248] (-2272.745) (-2278.193) (-2276.176) -- 0:01:00 176500 -- (-2274.024) (-2271.151) (-2272.116) [-2273.721] * (-2273.889) (-2274.101) [-2271.560] (-2275.600) -- 0:01:00 177000 -- (-2271.971) (-2270.783) [-2271.422] (-2273.260) * [-2275.198] (-2273.528) (-2273.672) (-2277.340) -- 0:01:00 177500 -- [-2271.223] (-2271.870) (-2272.766) (-2272.502) * (-2273.968) (-2272.488) [-2275.249] (-2274.129) -- 0:01:00 178000 -- (-2272.517) (-2274.841) (-2272.093) [-2272.546] * (-2275.608) (-2273.057) [-2276.102] (-2274.196) -- 0:01:00 178500 -- [-2273.364] (-2273.033) (-2272.398) (-2276.461) * (-2276.019) (-2273.073) [-2274.351] (-2277.049) -- 0:00:59 179000 -- [-2273.357] (-2271.154) (-2272.054) (-2273.231) * [-2272.692] (-2274.020) (-2273.846) (-2275.112) -- 0:01:04 179500 -- (-2274.068) (-2271.690) [-2271.428] (-2272.842) * [-2271.540] (-2276.563) (-2271.415) (-2274.827) -- 0:01:03 180000 -- (-2272.696) [-2272.562] (-2273.821) (-2271.980) * (-2271.655) (-2275.032) (-2271.301) [-2276.042] -- 0:01:03 Average standard deviation of split frequencies: 0.016342 180500 -- [-2272.399] (-2277.020) (-2278.884) (-2271.929) * (-2274.439) (-2275.069) (-2271.150) [-2274.175] -- 0:01:03 181000 -- [-2272.295] (-2275.969) (-2278.539) (-2271.817) * [-2271.593] (-2276.807) (-2274.301) (-2275.267) -- 0:01:03 181500 -- (-2273.393) [-2276.536] (-2274.312) (-2271.703) * (-2271.746) (-2277.968) (-2272.616) [-2273.912] -- 0:01:03 182000 -- [-2273.735] (-2272.173) (-2274.743) (-2272.876) * (-2278.617) (-2276.152) (-2274.447) [-2271.509] -- 0:01:02 182500 -- (-2272.647) [-2272.575] (-2271.179) (-2273.160) * (-2279.073) (-2273.564) (-2274.269) [-2271.372] -- 0:01:02 183000 -- (-2273.141) (-2274.469) (-2271.222) [-2273.295] * (-2278.743) [-2273.790] (-2272.492) (-2271.133) -- 0:01:02 183500 -- (-2272.573) (-2273.623) (-2273.727) [-2273.378] * (-2277.416) (-2272.566) (-2276.328) [-2271.113] -- 0:01:02 184000 -- (-2271.813) (-2273.747) (-2274.784) [-2273.921] * [-2275.211] (-2273.918) (-2271.312) (-2272.280) -- 0:01:02 184500 -- [-2272.798] (-2273.991) (-2279.241) (-2273.514) * [-2275.039] (-2272.595) (-2271.276) (-2271.463) -- 0:01:01 185000 -- (-2272.265) (-2276.450) (-2273.443) [-2274.913] * (-2275.105) [-2272.594] (-2276.033) (-2271.223) -- 0:01:01 Average standard deviation of split frequencies: 0.016601 185500 -- (-2277.587) [-2279.684] (-2273.231) (-2274.295) * (-2275.812) [-2273.168] (-2272.508) (-2271.433) -- 0:01:01 186000 -- (-2278.646) (-2278.492) [-2273.608] (-2274.294) * (-2275.315) (-2273.676) [-2272.916] (-2274.300) -- 0:01:01 186500 -- (-2273.845) (-2273.408) [-2272.141] (-2272.770) * [-2273.382] (-2273.631) (-2276.303) (-2274.922) -- 0:01:01 187000 -- (-2273.788) (-2271.426) [-2273.260] (-2273.488) * [-2273.303] (-2274.290) (-2272.032) (-2273.424) -- 0:01:00 187500 -- (-2273.980) [-2272.309] (-2273.332) (-2272.358) * (-2273.250) (-2274.647) [-2274.449] (-2273.490) -- 0:01:00 188000 -- (-2273.487) [-2273.086] (-2272.318) (-2272.360) * (-2275.899) (-2272.393) (-2273.162) [-2274.252] -- 0:01:00 188500 -- (-2271.638) [-2271.078] (-2272.447) (-2277.336) * (-2271.809) (-2273.843) [-2275.788] (-2272.571) -- 0:01:00 189000 -- (-2273.805) [-2275.945] (-2273.141) (-2279.013) * (-2273.008) (-2279.136) [-2278.021] (-2277.095) -- 0:01:00 189500 -- (-2272.787) (-2272.425) (-2275.253) [-2273.704] * (-2273.778) (-2276.944) [-2272.408] (-2276.486) -- 0:00:59 190000 -- [-2270.948] (-2272.207) (-2281.325) (-2274.771) * (-2272.516) (-2274.621) [-2273.426] (-2275.816) -- 0:00:59 Average standard deviation of split frequencies: 0.015329 190500 -- (-2272.530) (-2271.134) (-2281.266) [-2273.936] * [-2271.848] (-2273.062) (-2277.761) (-2273.868) -- 0:00:59 191000 -- (-2272.523) (-2273.201) [-2272.356] (-2273.322) * (-2271.547) (-2271.484) (-2275.736) [-2271.545] -- 0:00:59 191500 -- (-2272.339) [-2271.754] (-2273.310) (-2272.815) * (-2272.816) (-2274.737) (-2271.071) [-2271.837] -- 0:00:59 192000 -- [-2271.784] (-2273.525) (-2271.788) (-2272.252) * [-2273.512] (-2273.722) (-2272.532) (-2271.633) -- 0:00:58 192500 -- [-2272.081] (-2276.177) (-2271.053) (-2278.156) * [-2273.364] (-2274.104) (-2272.310) (-2273.494) -- 0:00:58 193000 -- (-2272.120) (-2276.728) [-2271.962] (-2273.370) * (-2273.913) [-2274.108] (-2271.825) (-2274.549) -- 0:00:58 193500 -- (-2272.535) (-2276.389) [-2272.797] (-2273.132) * (-2273.623) [-2272.143] (-2276.149) (-2272.628) -- 0:00:58 194000 -- (-2273.424) (-2273.366) [-2271.723] (-2273.037) * (-2273.210) (-2272.845) [-2272.322] (-2272.484) -- 0:01:02 194500 -- (-2273.424) (-2271.123) [-2271.168] (-2273.106) * (-2275.155) (-2272.002) [-2272.202] (-2272.438) -- 0:01:02 195000 -- [-2275.070] (-2271.149) (-2271.866) (-2272.899) * (-2275.248) (-2271.733) (-2271.890) [-2272.375] -- 0:01:01 Average standard deviation of split frequencies: 0.016583 195500 -- (-2276.720) (-2271.064) (-2271.625) [-2272.044] * (-2273.628) [-2272.403] (-2273.025) (-2274.207) -- 0:01:01 196000 -- (-2274.692) [-2271.989] (-2275.396) (-2272.330) * (-2272.136) [-2272.239] (-2273.189) (-2275.202) -- 0:01:01 196500 -- (-2274.361) [-2271.901] (-2275.486) (-2274.968) * (-2274.098) (-2273.501) [-2272.081] (-2271.603) -- 0:01:01 197000 -- (-2274.278) (-2272.253) [-2274.097] (-2275.054) * (-2275.299) (-2273.676) [-2272.897] (-2272.363) -- 0:01:01 197500 -- (-2274.486) (-2273.246) (-2274.324) [-2271.661] * (-2276.300) [-2272.761] (-2272.897) (-2273.365) -- 0:01:00 198000 -- (-2272.515) [-2272.056] (-2273.370) (-2271.610) * (-2271.433) (-2272.373) (-2273.250) [-2274.072] -- 0:01:00 198500 -- (-2272.196) (-2272.392) [-2272.400] (-2271.465) * (-2273.606) (-2273.181) (-2273.178) [-2273.400] -- 0:01:00 199000 -- (-2271.911) [-2273.234] (-2272.424) (-2273.424) * [-2271.708] (-2272.104) (-2273.213) (-2273.193) -- 0:01:00 199500 -- (-2271.807) [-2273.014] (-2273.087) (-2272.719) * (-2274.486) (-2271.433) (-2273.091) [-2271.388] -- 0:01:00 200000 -- (-2278.472) [-2272.647] (-2277.894) (-2272.729) * (-2273.284) (-2270.926) [-2272.546] (-2271.977) -- 0:00:59 Average standard deviation of split frequencies: 0.014617 200500 -- (-2275.593) [-2271.237] (-2272.461) (-2280.753) * (-2280.979) (-2271.691) (-2274.508) [-2271.278] -- 0:00:59 201000 -- (-2274.036) [-2271.236] (-2272.045) (-2278.646) * (-2272.841) (-2274.493) (-2272.809) [-2273.125] -- 0:00:59 201500 -- [-2272.692] (-2275.148) (-2272.562) (-2272.508) * (-2272.841) (-2275.418) [-2276.910] (-2276.687) -- 0:00:59 202000 -- (-2273.058) [-2274.247] (-2272.243) (-2272.602) * [-2271.794] (-2271.965) (-2276.790) (-2275.626) -- 0:00:59 202500 -- (-2272.480) (-2274.731) [-2271.871] (-2273.745) * [-2273.812] (-2275.939) (-2276.968) (-2276.777) -- 0:00:59 203000 -- (-2272.972) (-2275.870) [-2272.088] (-2274.144) * (-2272.487) [-2271.455] (-2277.065) (-2277.439) -- 0:00:58 203500 -- (-2272.897) [-2272.840] (-2271.956) (-2273.234) * [-2272.554] (-2273.387) (-2276.076) (-2274.712) -- 0:00:58 204000 -- (-2275.264) (-2273.532) [-2272.106] (-2273.302) * (-2273.290) (-2274.164) (-2275.409) [-2276.133] -- 0:00:58 204500 -- (-2274.810) [-2276.141] (-2276.342) (-2273.304) * (-2273.457) (-2272.073) (-2274.224) [-2275.865] -- 0:00:58 205000 -- [-2272.451] (-2276.463) (-2274.667) (-2273.948) * [-2274.551] (-2271.689) (-2278.251) (-2279.555) -- 0:00:58 Average standard deviation of split frequencies: 0.015416 205500 -- [-2273.301] (-2278.419) (-2276.811) (-2272.469) * [-2272.845] (-2271.661) (-2272.950) (-2277.024) -- 0:00:57 206000 -- (-2273.696) (-2273.089) [-2277.290] (-2271.311) * [-2273.020] (-2272.674) (-2272.062) (-2276.142) -- 0:00:57 206500 -- [-2272.766] (-2272.873) (-2272.830) (-2270.880) * [-2271.853] (-2272.630) (-2272.105) (-2276.201) -- 0:00:57 207000 -- [-2272.909] (-2273.174) (-2271.975) (-2272.852) * [-2273.689] (-2275.750) (-2271.910) (-2272.725) -- 0:00:57 207500 -- [-2272.366] (-2272.715) (-2274.575) (-2274.116) * (-2274.050) [-2276.412] (-2271.830) (-2272.028) -- 0:00:57 208000 -- [-2272.324] (-2272.856) (-2274.692) (-2272.045) * [-2272.923] (-2274.538) (-2273.678) (-2272.776) -- 0:00:57 208500 -- (-2273.192) (-2271.445) [-2275.521] (-2273.116) * [-2275.185] (-2274.289) (-2273.400) (-2272.998) -- 0:01:00 209000 -- (-2273.620) (-2273.650) (-2274.200) [-2273.829] * [-2271.917] (-2273.771) (-2273.424) (-2273.783) -- 0:01:00 209500 -- (-2277.031) [-2273.326] (-2274.478) (-2274.410) * (-2272.282) (-2273.685) [-2271.987] (-2273.457) -- 0:01:00 210000 -- (-2273.418) [-2273.297] (-2277.049) (-2275.575) * (-2274.180) (-2275.743) (-2273.502) [-2271.755] -- 0:01:00 Average standard deviation of split frequencies: 0.015428 210500 -- (-2277.249) (-2271.332) [-2277.120] (-2278.262) * (-2273.635) (-2274.805) [-2271.817] (-2271.914) -- 0:01:00 211000 -- (-2272.595) [-2273.592] (-2274.839) (-2277.646) * (-2273.504) (-2273.297) (-2276.842) [-2272.821] -- 0:00:59 211500 -- (-2272.595) (-2274.279) (-2274.872) [-2274.084] * (-2275.221) (-2272.581) [-2272.224] (-2272.894) -- 0:00:59 212000 -- [-2273.915] (-2273.859) (-2272.062) (-2283.849) * (-2272.518) (-2273.675) (-2273.600) [-2272.875] -- 0:00:59 212500 -- (-2278.574) (-2275.192) [-2271.223] (-2274.785) * (-2271.973) (-2273.372) [-2271.248] (-2274.849) -- 0:00:59 213000 -- (-2272.358) (-2275.907) (-2273.526) [-2275.256] * (-2272.281) (-2272.011) [-2272.721] (-2273.958) -- 0:00:59 213500 -- (-2273.195) [-2275.850] (-2275.804) (-2275.430) * (-2274.192) [-2272.565] (-2272.405) (-2275.174) -- 0:00:58 214000 -- (-2273.042) (-2275.932) [-2276.793] (-2274.795) * (-2274.144) [-2272.594] (-2271.989) (-2272.759) -- 0:00:58 214500 -- (-2271.617) [-2273.607] (-2273.631) (-2272.853) * (-2271.510) (-2273.816) [-2271.840] (-2272.755) -- 0:00:58 215000 -- (-2271.427) (-2273.643) [-2272.482] (-2274.124) * [-2271.427] (-2273.742) (-2273.245) (-2271.783) -- 0:00:58 Average standard deviation of split frequencies: 0.016426 215500 -- [-2271.744] (-2272.989) (-2274.510) (-2276.244) * (-2279.733) (-2273.463) (-2272.214) [-2274.313] -- 0:00:58 216000 -- [-2271.818] (-2271.406) (-2275.768) (-2273.459) * (-2277.140) [-2273.541] (-2271.416) (-2273.079) -- 0:00:58 216500 -- (-2271.810) [-2272.173] (-2275.105) (-2273.685) * (-2274.202) (-2273.189) [-2272.656] (-2272.265) -- 0:00:57 217000 -- (-2271.735) [-2275.668] (-2273.288) (-2272.975) * (-2272.709) (-2272.460) (-2272.581) [-2271.519] -- 0:00:57 217500 -- (-2273.065) [-2271.785] (-2272.233) (-2273.109) * (-2272.709) (-2272.482) [-2273.889] (-2274.229) -- 0:00:57 218000 -- [-2271.655] (-2271.785) (-2271.909) (-2272.476) * [-2271.924] (-2271.842) (-2271.814) (-2273.564) -- 0:00:57 218500 -- (-2271.527) [-2271.505] (-2273.837) (-2273.655) * (-2271.353) (-2272.161) [-2271.842] (-2272.721) -- 0:00:57 219000 -- [-2272.693] (-2271.495) (-2271.741) (-2272.626) * (-2271.305) [-2271.343] (-2271.108) (-2272.715) -- 0:00:57 219500 -- (-2273.043) (-2272.263) [-2271.197] (-2273.253) * (-2272.900) (-2273.179) (-2271.325) [-2272.937] -- 0:00:56 220000 -- (-2271.043) (-2272.321) (-2271.419) [-2273.250] * (-2274.466) (-2271.984) (-2275.507) [-2272.246] -- 0:00:56 Average standard deviation of split frequencies: 0.014729 220500 -- (-2271.791) (-2272.299) (-2274.863) [-2273.518] * (-2272.085) (-2271.992) [-2272.060] (-2272.945) -- 0:00:56 221000 -- (-2271.782) [-2273.456] (-2272.480) (-2275.849) * [-2272.387] (-2271.721) (-2275.301) (-2274.502) -- 0:00:56 221500 -- (-2272.262) (-2272.984) [-2271.259] (-2276.240) * (-2273.895) (-2273.383) [-2275.203] (-2274.245) -- 0:00:56 222000 -- [-2270.994] (-2272.185) (-2273.010) (-2275.213) * (-2273.206) (-2275.199) (-2275.227) [-2272.480] -- 0:00:56 222500 -- (-2274.902) (-2271.821) (-2271.636) [-2273.949] * (-2273.970) (-2272.551) (-2274.939) [-2271.170] -- 0:00:55 223000 -- (-2272.964) [-2271.883] (-2271.632) (-2272.192) * (-2273.507) [-2273.613] (-2275.383) (-2271.433) -- 0:00:55 223500 -- (-2274.832) (-2271.883) [-2272.036] (-2275.538) * (-2275.499) (-2273.441) [-2273.102] (-2271.433) -- 0:00:59 224000 -- (-2273.455) [-2271.643] (-2273.095) (-2276.479) * (-2275.101) (-2272.562) [-2272.378] (-2271.753) -- 0:00:58 224500 -- [-2275.488] (-2272.067) (-2272.777) (-2276.947) * (-2274.264) (-2271.921) (-2275.590) [-2271.046] -- 0:00:58 225000 -- [-2273.794] (-2275.832) (-2273.237) (-2277.596) * (-2275.165) (-2271.922) [-2274.329] (-2271.119) -- 0:00:58 Average standard deviation of split frequencies: 0.014601 225500 -- (-2272.117) (-2277.493) [-2274.047] (-2272.548) * [-2274.577] (-2273.019) (-2271.762) (-2271.891) -- 0:00:58 226000 -- [-2271.122] (-2277.804) (-2274.358) (-2274.339) * [-2274.913] (-2273.451) (-2271.592) (-2272.870) -- 0:00:58 226500 -- [-2272.321] (-2274.830) (-2274.216) (-2272.880) * (-2276.436) (-2275.725) [-2272.013] (-2276.378) -- 0:00:58 227000 -- [-2272.638] (-2274.387) (-2273.562) (-2272.839) * (-2275.175) (-2276.129) (-2272.090) [-2272.698] -- 0:00:57 227500 -- (-2274.497) (-2272.353) (-2272.870) [-2274.078] * (-2274.773) (-2273.104) [-2277.050] (-2275.267) -- 0:00:57 228000 -- [-2274.410] (-2275.357) (-2273.989) (-2273.182) * (-2273.941) (-2273.060) (-2272.812) [-2271.449] -- 0:00:57 228500 -- [-2273.662] (-2275.600) (-2275.890) (-2272.241) * (-2275.222) (-2273.469) (-2274.797) [-2277.906] -- 0:00:57 229000 -- (-2271.231) [-2278.729] (-2272.598) (-2273.813) * [-2274.570] (-2273.171) (-2277.693) (-2276.419) -- 0:00:57 229500 -- [-2271.691] (-2276.144) (-2273.092) (-2274.420) * (-2273.165) (-2271.549) [-2272.789] (-2275.880) -- 0:00:57 230000 -- [-2271.691] (-2276.271) (-2272.977) (-2272.303) * (-2275.693) (-2271.549) (-2273.598) [-2276.779] -- 0:00:56 Average standard deviation of split frequencies: 0.016122 230500 -- [-2271.689] (-2273.355) (-2272.103) (-2275.795) * [-2275.318] (-2271.967) (-2273.212) (-2275.128) -- 0:00:56 231000 -- (-2273.110) (-2274.076) [-2272.020] (-2272.997) * (-2273.031) (-2271.231) [-2273.219] (-2271.358) -- 0:00:56 231500 -- (-2271.408) (-2273.931) (-2274.575) [-2272.612] * [-2272.339] (-2272.481) (-2273.559) (-2271.381) -- 0:00:56 232000 -- [-2272.657] (-2273.733) (-2273.085) (-2272.131) * [-2272.452] (-2275.949) (-2272.810) (-2272.116) -- 0:00:56 232500 -- [-2272.981] (-2274.133) (-2275.078) (-2271.588) * (-2273.536) [-2275.333] (-2274.840) (-2272.610) -- 0:00:56 233000 -- [-2273.636] (-2273.098) (-2274.946) (-2273.930) * (-2272.366) (-2275.574) (-2273.886) [-2274.819] -- 0:00:55 233500 -- (-2272.611) [-2273.455] (-2272.297) (-2272.182) * (-2273.070) (-2276.830) (-2274.876) [-2274.857] -- 0:00:55 234000 -- [-2272.826] (-2274.445) (-2274.584) (-2271.501) * [-2272.509] (-2271.696) (-2274.915) (-2272.532) -- 0:00:55 234500 -- (-2274.286) (-2273.506) [-2272.980] (-2271.378) * (-2270.986) (-2272.468) (-2274.466) [-2271.444] -- 0:00:55 235000 -- (-2273.287) (-2272.035) (-2274.168) [-2272.866] * (-2272.246) (-2273.529) (-2272.671) [-2271.501] -- 0:00:55 Average standard deviation of split frequencies: 0.015647 235500 -- (-2272.562) [-2273.989] (-2273.281) (-2271.265) * (-2273.101) [-2273.629] (-2272.621) (-2274.096) -- 0:00:55 236000 -- (-2273.110) (-2274.381) [-2271.247] (-2271.550) * [-2275.358] (-2272.680) (-2272.942) (-2275.023) -- 0:00:55 236500 -- (-2274.696) (-2272.686) (-2271.711) [-2272.595] * (-2274.236) (-2272.168) (-2271.295) [-2272.576] -- 0:00:54 237000 -- (-2275.351) (-2273.076) (-2271.346) [-2273.155] * (-2272.496) (-2274.032) (-2273.408) [-2272.283] -- 0:00:54 237500 -- [-2272.859] (-2275.147) (-2271.346) (-2271.509) * (-2273.049) (-2272.759) (-2275.304) [-2272.120] -- 0:00:54 238000 -- (-2272.413) (-2274.016) [-2271.306] (-2271.547) * [-2273.735] (-2274.273) (-2272.597) (-2271.520) -- 0:00:54 238500 -- (-2277.608) (-2272.179) (-2271.660) [-2274.306] * (-2274.119) (-2272.839) (-2273.811) [-2271.849] -- 0:00:57 239000 -- (-2275.520) (-2274.180) (-2272.629) [-2276.094] * (-2272.728) (-2272.785) [-2273.672] (-2271.848) -- 0:00:57 239500 -- (-2274.402) [-2272.387] (-2273.105) (-2272.689) * (-2271.171) (-2275.979) [-2273.961] (-2271.633) -- 0:00:57 240000 -- (-2273.968) (-2273.101) [-2272.689] (-2273.169) * (-2271.565) (-2272.235) [-2274.074] (-2274.965) -- 0:00:56 Average standard deviation of split frequencies: 0.017302 240500 -- [-2276.849] (-2272.456) (-2272.633) (-2272.352) * (-2272.861) [-2271.987] (-2275.538) (-2279.380) -- 0:00:56 241000 -- (-2274.103) (-2272.775) [-2272.935] (-2274.451) * (-2273.599) (-2274.452) [-2272.243] (-2276.505) -- 0:00:56 241500 -- (-2274.977) (-2277.665) (-2272.165) [-2273.488] * (-2271.543) (-2272.265) [-2271.296] (-2277.067) -- 0:00:56 242000 -- (-2273.994) [-2274.225] (-2275.206) (-2274.909) * (-2271.543) (-2273.952) (-2275.008) [-2274.444] -- 0:00:56 242500 -- (-2274.226) (-2275.835) (-2275.656) [-2272.442] * (-2271.602) (-2271.906) (-2273.099) [-2272.260] -- 0:00:56 243000 -- (-2276.260) [-2271.850] (-2273.345) (-2272.403) * (-2273.244) (-2275.046) (-2275.850) [-2273.986] -- 0:00:56 243500 -- (-2273.382) (-2274.480) (-2274.254) [-2271.545] * (-2273.745) (-2276.076) (-2272.577) [-2274.103] -- 0:00:55 244000 -- (-2273.127) (-2273.956) [-2276.796] (-2272.214) * (-2274.207) (-2276.401) (-2275.799) [-2271.868] -- 0:00:55 244500 -- (-2272.484) (-2274.487) (-2275.614) [-2273.929] * (-2273.547) (-2275.046) (-2278.220) [-2273.096] -- 0:00:55 245000 -- (-2275.728) (-2272.808) [-2274.348] (-2272.843) * [-2274.151] (-2274.345) (-2272.699) (-2273.105) -- 0:00:55 Average standard deviation of split frequencies: 0.016541 245500 -- (-2274.399) [-2274.305] (-2273.611) (-2274.754) * (-2275.458) (-2272.757) (-2279.118) [-2274.223] -- 0:00:55 246000 -- [-2274.722] (-2274.305) (-2271.941) (-2274.035) * (-2276.424) [-2272.980] (-2272.945) (-2274.946) -- 0:00:55 246500 -- (-2272.572) (-2276.106) (-2273.471) [-2273.367] * (-2277.060) [-2273.149] (-2271.415) (-2275.059) -- 0:00:55 247000 -- (-2274.936) (-2275.524) [-2271.689] (-2271.833) * (-2279.215) (-2275.392) (-2270.928) [-2274.604] -- 0:00:54 247500 -- (-2274.956) (-2274.846) [-2275.226] (-2273.412) * [-2277.260] (-2272.965) (-2276.967) (-2274.969) -- 0:00:54 248000 -- (-2274.547) (-2271.864) [-2276.593] (-2272.859) * [-2273.532] (-2274.741) (-2274.257) (-2276.380) -- 0:00:54 248500 -- (-2274.871) (-2271.850) [-2271.748] (-2272.997) * [-2272.211] (-2275.309) (-2271.793) (-2278.097) -- 0:00:54 249000 -- [-2276.708] (-2276.734) (-2271.565) (-2272.464) * (-2272.969) (-2274.347) [-2272.437] (-2274.614) -- 0:00:54 249500 -- (-2276.841) (-2274.743) [-2272.352] (-2272.631) * [-2274.096] (-2272.937) (-2273.611) (-2273.906) -- 0:00:54 250000 -- [-2274.287] (-2274.163) (-2275.804) (-2275.639) * (-2273.785) (-2275.680) (-2273.760) [-2273.425] -- 0:00:54 Average standard deviation of split frequencies: 0.015985 250500 -- (-2273.370) (-2271.962) [-2273.324] (-2274.390) * (-2275.283) (-2276.133) (-2273.361) [-2272.073] -- 0:00:53 251000 -- (-2274.637) [-2273.472] (-2275.440) (-2275.241) * (-2275.603) (-2273.155) [-2272.959] (-2272.128) -- 0:00:53 251500 -- (-2275.539) [-2273.072] (-2276.043) (-2273.506) * (-2275.029) (-2274.689) (-2272.803) [-2274.351] -- 0:00:53 252000 -- (-2276.023) (-2277.769) (-2274.857) [-2273.783] * (-2275.110) (-2275.729) [-2272.749] (-2273.410) -- 0:00:53 252500 -- (-2276.683) [-2275.487] (-2274.656) (-2275.825) * (-2274.912) (-2277.315) (-2272.649) [-2271.522] -- 0:00:53 253000 -- (-2273.581) (-2272.666) (-2278.495) [-2273.416] * (-2276.128) (-2275.775) (-2273.179) [-2272.375] -- 0:00:53 253500 -- (-2274.680) (-2273.337) (-2276.295) [-2272.108] * (-2273.731) (-2274.621) (-2275.784) [-2272.452] -- 0:00:55 254000 -- [-2275.202] (-2276.170) (-2276.324) (-2273.233) * [-2278.097] (-2273.229) (-2275.203) (-2272.155) -- 0:00:55 254500 -- (-2271.971) (-2274.452) [-2273.218] (-2274.482) * (-2274.572) (-2273.236) [-2273.533] (-2275.167) -- 0:00:55 255000 -- (-2271.636) (-2271.796) (-2275.218) [-2274.639] * [-2272.653] (-2271.231) (-2276.304) (-2278.251) -- 0:00:55 Average standard deviation of split frequencies: 0.016789 255500 -- [-2272.085] (-2271.043) (-2273.499) (-2272.833) * (-2274.029) (-2271.661) [-2277.434] (-2275.322) -- 0:00:55 256000 -- (-2271.961) [-2272.467] (-2273.525) (-2276.057) * (-2274.881) (-2273.023) [-2278.580] (-2275.038) -- 0:00:55 256500 -- [-2271.411] (-2273.323) (-2274.442) (-2272.137) * (-2271.413) (-2272.111) (-2274.671) [-2276.370] -- 0:00:55 257000 -- (-2276.423) (-2271.478) (-2274.691) [-2271.274] * (-2271.492) (-2270.944) (-2276.065) [-2273.069] -- 0:00:54 257500 -- (-2272.325) (-2271.367) [-2273.591] (-2272.185) * [-2272.513] (-2274.466) (-2276.341) (-2274.881) -- 0:00:54 258000 -- (-2271.569) (-2271.830) (-2271.800) [-2272.942] * (-2271.765) [-2271.801] (-2274.751) (-2275.059) -- 0:00:54 258500 -- (-2272.141) (-2272.173) (-2271.984) [-2273.887] * (-2275.515) [-2272.396] (-2273.144) (-2275.958) -- 0:00:54 259000 -- (-2272.121) (-2274.479) (-2272.033) [-2275.754] * (-2273.786) [-2276.722] (-2275.085) (-2273.955) -- 0:00:54 259500 -- [-2272.078] (-2274.275) (-2271.971) (-2273.802) * (-2274.813) (-2271.353) (-2274.179) [-2271.683] -- 0:00:54 260000 -- (-2271.924) (-2276.239) (-2273.555) [-2273.630] * (-2273.872) (-2272.983) (-2276.525) [-2274.466] -- 0:00:54 Average standard deviation of split frequencies: 0.015319 260500 -- [-2271.971] (-2275.133) (-2274.762) (-2273.626) * [-2274.477] (-2273.223) (-2275.280) (-2272.372) -- 0:00:53 261000 -- [-2271.997] (-2274.580) (-2274.755) (-2275.601) * (-2273.480) [-2273.496] (-2272.846) (-2273.137) -- 0:00:53 261500 -- (-2272.041) [-2272.661] (-2271.781) (-2274.340) * (-2273.289) [-2271.378] (-2274.122) (-2274.151) -- 0:00:53 262000 -- (-2272.220) [-2272.993] (-2271.771) (-2274.147) * [-2274.105] (-2276.194) (-2273.939) (-2274.511) -- 0:00:53 262500 -- (-2272.615) (-2272.026) [-2271.816] (-2272.436) * (-2273.279) (-2278.738) [-2273.936] (-2276.236) -- 0:00:53 263000 -- (-2273.705) (-2273.798) [-2275.388] (-2273.078) * [-2271.889] (-2273.065) (-2272.293) (-2272.847) -- 0:00:53 263500 -- (-2278.655) (-2271.463) (-2280.969) [-2274.855] * (-2273.493) (-2271.903) (-2274.382) [-2273.273] -- 0:00:53 264000 -- (-2278.286) (-2275.160) (-2283.449) [-2276.131] * [-2274.329] (-2272.442) (-2274.582) (-2273.315) -- 0:00:52 264500 -- (-2275.346) (-2275.393) (-2276.587) [-2276.126] * (-2274.356) [-2272.121] (-2273.775) (-2272.916) -- 0:00:52 265000 -- [-2272.379] (-2273.628) (-2273.564) (-2275.836) * (-2273.311) (-2274.849) [-2272.648] (-2273.266) -- 0:00:52 Average standard deviation of split frequencies: 0.015064 265500 -- (-2272.231) (-2273.560) (-2274.390) [-2274.169] * (-2273.829) (-2274.326) [-2275.373] (-2273.379) -- 0:00:52 266000 -- (-2272.124) [-2273.405] (-2272.055) (-2273.780) * (-2273.975) (-2277.472) [-2272.777] (-2272.513) -- 0:00:52 266500 -- (-2273.674) (-2272.678) (-2276.767) [-2274.879] * [-2272.384] (-2283.222) (-2274.324) (-2274.554) -- 0:00:52 267000 -- [-2271.952] (-2271.523) (-2276.423) (-2271.776) * [-2271.926] (-2280.002) (-2273.283) (-2278.429) -- 0:00:52 267500 -- (-2271.934) [-2271.868] (-2276.101) (-2277.300) * [-2277.913] (-2275.661) (-2272.723) (-2273.848) -- 0:00:52 268000 -- (-2273.850) [-2274.431] (-2275.421) (-2272.425) * (-2281.630) [-2274.222] (-2276.914) (-2273.047) -- 0:00:54 268500 -- [-2272.888] (-2275.242) (-2274.019) (-2272.699) * (-2283.031) [-2275.011] (-2272.485) (-2273.173) -- 0:00:54 269000 -- [-2272.353] (-2272.328) (-2275.039) (-2274.680) * (-2277.167) (-2274.539) (-2272.935) [-2275.096] -- 0:00:54 269500 -- (-2273.140) [-2272.714] (-2275.951) (-2273.996) * (-2277.304) (-2276.061) (-2274.010) [-2275.890] -- 0:00:54 270000 -- (-2272.820) (-2272.595) (-2274.961) [-2272.670] * (-2277.832) (-2275.913) [-2271.783] (-2276.191) -- 0:00:54 Average standard deviation of split frequencies: 0.016062 270500 -- [-2271.928] (-2272.366) (-2275.185) (-2276.288) * [-2274.642] (-2273.563) (-2273.552) (-2273.858) -- 0:00:53 271000 -- (-2271.433) [-2272.605] (-2273.292) (-2274.834) * (-2273.183) [-2278.417] (-2279.435) (-2275.140) -- 0:00:53 271500 -- (-2272.740) (-2275.926) (-2274.781) [-2274.738] * [-2274.411] (-2271.887) (-2272.754) (-2274.557) -- 0:00:53 272000 -- (-2274.616) (-2273.752) (-2271.833) [-2275.570] * (-2274.564) (-2272.320) [-2272.813] (-2274.042) -- 0:00:53 272500 -- (-2273.862) (-2274.936) [-2271.255] (-2273.812) * (-2273.283) (-2272.663) [-2272.241] (-2274.359) -- 0:00:53 273000 -- [-2274.310] (-2271.145) (-2272.995) (-2274.720) * (-2272.025) (-2273.877) [-2272.522] (-2275.655) -- 0:00:53 273500 -- (-2275.064) (-2272.244) [-2273.196] (-2277.643) * [-2273.685] (-2276.519) (-2273.781) (-2273.943) -- 0:00:53 274000 -- (-2273.493) [-2271.412] (-2271.829) (-2273.568) * [-2271.297] (-2271.778) (-2272.157) (-2272.629) -- 0:00:52 274500 -- (-2273.539) (-2273.052) [-2271.908] (-2272.284) * (-2271.305) (-2275.676) [-2275.342] (-2271.606) -- 0:00:52 275000 -- (-2274.012) (-2275.592) (-2271.926) [-2271.213] * (-2272.054) [-2273.806] (-2274.307) (-2272.189) -- 0:00:52 Average standard deviation of split frequencies: 0.014897 275500 -- (-2275.612) (-2276.551) [-2272.247] (-2275.507) * (-2273.543) (-2272.986) [-2275.628] (-2272.856) -- 0:00:52 276000 -- [-2272.182] (-2272.367) (-2271.643) (-2275.920) * (-2273.175) (-2272.914) [-2271.343] (-2274.759) -- 0:00:52 276500 -- (-2274.066) (-2273.868) (-2271.418) [-2273.225] * (-2274.326) (-2274.544) [-2271.343] (-2274.830) -- 0:00:52 277000 -- (-2272.481) [-2274.544] (-2272.127) (-2274.077) * (-2283.985) (-2277.645) [-2272.912] (-2274.661) -- 0:00:52 277500 -- (-2277.725) (-2274.728) [-2272.089] (-2272.773) * (-2281.987) [-2276.455] (-2271.762) (-2275.454) -- 0:00:52 278000 -- [-2274.010] (-2275.677) (-2272.309) (-2272.359) * (-2274.284) (-2273.197) [-2271.714] (-2277.661) -- 0:00:51 278500 -- (-2274.602) (-2274.018) (-2273.789) [-2273.108] * [-2272.456] (-2278.194) (-2273.889) (-2278.768) -- 0:00:51 279000 -- (-2274.122) (-2273.864) [-2272.971] (-2272.796) * [-2274.279] (-2277.731) (-2273.022) (-2277.014) -- 0:00:51 279500 -- (-2276.195) (-2273.142) [-2270.872] (-2273.002) * (-2273.769) [-2274.182] (-2275.840) (-2275.969) -- 0:00:51 280000 -- (-2273.898) (-2276.664) [-2271.445] (-2278.397) * [-2275.436] (-2275.645) (-2275.656) (-2271.972) -- 0:00:51 Average standard deviation of split frequencies: 0.014277 280500 -- (-2271.603) (-2271.330) [-2271.072] (-2275.305) * (-2277.972) [-2279.994] (-2272.837) (-2272.899) -- 0:00:51 281000 -- (-2271.425) (-2271.517) [-2271.846] (-2272.821) * [-2271.419] (-2271.509) (-2272.849) (-2271.504) -- 0:00:51 281500 -- (-2271.299) (-2272.784) (-2276.416) [-2273.497] * (-2271.419) (-2271.481) (-2272.964) [-2272.824] -- 0:00:51 282000 -- (-2271.667) [-2272.023] (-2278.886) (-2274.304) * (-2271.419) (-2272.946) [-2272.832] (-2270.771) -- 0:00:50 282500 -- (-2271.572) [-2271.762] (-2275.677) (-2274.384) * (-2273.285) (-2276.054) (-2275.335) [-2271.265] -- 0:00:50 283000 -- (-2273.141) (-2271.765) [-2271.852] (-2273.891) * (-2272.056) (-2275.848) [-2273.568] (-2271.714) -- 0:00:53 283500 -- (-2275.216) (-2271.398) (-2272.009) [-2275.903] * (-2272.540) (-2276.082) (-2272.166) [-2271.712] -- 0:00:53 284000 -- (-2275.382) [-2271.535] (-2273.189) (-2275.223) * (-2272.013) [-2273.956] (-2275.745) (-2275.164) -- 0:00:52 284500 -- (-2271.711) [-2275.181] (-2272.733) (-2271.592) * [-2273.615] (-2275.366) (-2277.025) (-2274.027) -- 0:00:52 285000 -- (-2274.130) (-2276.098) [-2275.020] (-2272.799) * (-2272.541) (-2274.337) (-2275.086) [-2276.134] -- 0:00:52 Average standard deviation of split frequencies: 0.014054 285500 -- (-2272.843) (-2273.916) (-2274.010) [-2271.682] * (-2272.246) (-2273.771) (-2274.854) [-2276.421] -- 0:00:52 286000 -- (-2272.911) [-2273.223] (-2274.131) (-2273.421) * (-2272.084) (-2271.925) [-2272.053] (-2275.178) -- 0:00:52 286500 -- (-2274.093) (-2273.744) (-2276.447) [-2272.388] * (-2275.750) (-2274.040) (-2272.542) [-2276.689] -- 0:00:52 287000 -- [-2272.312] (-2274.212) (-2277.491) (-2273.792) * [-2274.894] (-2272.946) (-2272.270) (-2277.112) -- 0:00:52 287500 -- (-2272.041) (-2277.179) (-2277.461) [-2271.305] * (-2272.438) (-2273.394) (-2271.634) [-2273.727] -- 0:00:52 288000 -- [-2272.678] (-2274.660) (-2279.536) (-2272.447) * [-2272.759] (-2271.241) (-2272.310) (-2271.798) -- 0:00:51 288500 -- (-2271.584) (-2276.867) (-2273.638) [-2275.015] * (-2272.722) (-2271.811) (-2276.677) [-2274.505] -- 0:00:51 289000 -- [-2272.038] (-2273.068) (-2273.731) (-2274.074) * (-2271.683) (-2272.280) (-2271.821) [-2273.388] -- 0:00:51 289500 -- (-2272.509) [-2271.085] (-2273.785) (-2272.017) * (-2272.390) [-2272.004] (-2272.239) (-2273.960) -- 0:00:51 290000 -- (-2278.010) (-2271.085) (-2275.013) [-2273.066] * (-2271.999) (-2277.520) (-2272.224) [-2272.514] -- 0:00:51 Average standard deviation of split frequencies: 0.014255 290500 -- (-2273.282) [-2271.085] (-2275.070) (-2271.952) * (-2272.764) [-2275.261] (-2272.795) (-2272.814) -- 0:00:51 291000 -- (-2273.717) [-2271.101] (-2272.842) (-2271.761) * (-2272.468) [-2273.726] (-2271.357) (-2272.839) -- 0:00:51 291500 -- [-2273.082] (-2271.864) (-2271.891) (-2273.037) * (-2271.138) (-2277.889) (-2271.696) [-2272.866] -- 0:00:51 292000 -- (-2273.988) [-2271.668] (-2275.396) (-2273.471) * (-2272.780) (-2276.170) (-2271.696) [-2274.998] -- 0:00:50 292500 -- (-2271.915) (-2272.207) (-2275.538) [-2273.996] * (-2273.909) (-2273.977) (-2271.080) [-2272.781] -- 0:00:50 293000 -- (-2272.379) (-2272.837) (-2272.753) [-2272.497] * (-2274.486) (-2273.116) (-2271.942) [-2271.834] -- 0:00:50 293500 -- (-2274.132) (-2276.654) (-2271.413) [-2273.966] * [-2275.179] (-2275.532) (-2271.331) (-2273.943) -- 0:00:50 294000 -- (-2271.471) [-2272.325] (-2274.020) (-2273.091) * (-2273.189) [-2274.258] (-2273.042) (-2272.666) -- 0:00:50 294500 -- [-2273.048] (-2271.587) (-2272.227) (-2274.591) * [-2271.143] (-2274.483) (-2274.755) (-2273.573) -- 0:00:50 295000 -- (-2271.542) (-2271.267) [-2273.111] (-2275.128) * [-2272.893] (-2279.579) (-2272.370) (-2272.867) -- 0:00:50 Average standard deviation of split frequencies: 0.014501 295500 -- (-2271.727) (-2271.386) (-2272.322) [-2273.820] * [-2272.419] (-2275.838) (-2272.194) (-2272.844) -- 0:00:50 296000 -- (-2274.932) [-2271.628] (-2275.648) (-2274.906) * (-2272.493) (-2273.225) (-2272.194) [-2272.412] -- 0:00:49 296500 -- [-2277.744] (-2271.625) (-2274.468) (-2272.675) * [-2273.398] (-2273.983) (-2271.939) (-2273.207) -- 0:00:49 297000 -- (-2273.452) (-2273.897) [-2273.732] (-2272.454) * [-2272.090] (-2273.511) (-2271.320) (-2271.848) -- 0:00:49 297500 -- [-2271.794] (-2273.888) (-2274.831) (-2272.332) * [-2275.944] (-2273.128) (-2273.131) (-2271.858) -- 0:00:49 298000 -- (-2277.078) [-2273.927] (-2274.893) (-2271.931) * [-2272.007] (-2273.796) (-2272.547) (-2272.745) -- 0:00:51 298500 -- (-2274.336) (-2272.806) [-2273.913] (-2272.609) * [-2272.007] (-2275.163) (-2272.555) (-2272.255) -- 0:00:51 299000 -- [-2273.307] (-2276.840) (-2275.168) (-2273.160) * (-2273.498) (-2272.845) (-2273.803) [-2271.047] -- 0:00:51 299500 -- (-2271.977) (-2276.453) [-2273.553] (-2272.617) * (-2273.250) (-2272.437) (-2276.143) [-2271.192] -- 0:00:51 300000 -- [-2271.870] (-2275.349) (-2276.095) (-2273.522) * (-2271.205) [-2276.975] (-2275.783) (-2271.889) -- 0:00:51 Average standard deviation of split frequencies: 0.014193 300500 -- (-2272.834) [-2271.829] (-2274.283) (-2273.997) * [-2273.027] (-2279.224) (-2276.274) (-2272.904) -- 0:00:51 301000 -- (-2275.439) [-2273.707] (-2273.647) (-2273.937) * (-2278.838) (-2272.579) (-2274.297) [-2272.040] -- 0:00:51 301500 -- (-2274.922) (-2271.369) [-2277.042] (-2273.754) * (-2272.018) (-2273.322) (-2273.475) [-2273.029] -- 0:00:50 302000 -- (-2279.476) [-2273.097] (-2272.441) (-2275.602) * [-2271.150] (-2273.024) (-2273.382) (-2275.085) -- 0:00:50 302500 -- (-2283.323) [-2273.919] (-2272.509) (-2272.216) * (-2271.458) (-2274.753) [-2275.294] (-2272.886) -- 0:00:50 303000 -- (-2277.846) [-2272.919] (-2272.195) (-2273.881) * [-2272.359] (-2272.182) (-2273.741) (-2274.912) -- 0:00:50 303500 -- (-2272.144) (-2273.686) (-2272.374) [-2271.658] * [-2276.372] (-2272.346) (-2274.268) (-2276.837) -- 0:00:50 304000 -- (-2274.755) (-2274.230) [-2272.199] (-2272.441) * [-2275.187] (-2275.872) (-2276.181) (-2275.122) -- 0:00:50 304500 -- [-2274.605] (-2277.030) (-2272.147) (-2276.287) * (-2273.400) (-2274.039) [-2271.635] (-2273.700) -- 0:00:50 305000 -- (-2274.528) (-2276.652) (-2273.001) [-2272.542] * (-2271.710) (-2273.994) (-2271.345) [-2272.214] -- 0:00:50 Average standard deviation of split frequencies: 0.014108 305500 -- (-2272.296) (-2274.217) (-2273.006) [-2274.648] * [-2271.592] (-2273.999) (-2273.970) (-2272.595) -- 0:00:50 306000 -- (-2274.300) [-2273.146] (-2272.745) (-2273.198) * (-2274.725) (-2272.447) [-2275.134] (-2272.367) -- 0:00:49 306500 -- [-2273.394] (-2278.357) (-2273.782) (-2273.803) * [-2272.870] (-2275.352) (-2272.536) (-2273.410) -- 0:00:49 307000 -- (-2280.375) (-2278.380) (-2272.673) [-2271.216] * (-2273.401) (-2272.339) [-2272.970] (-2274.180) -- 0:00:49 307500 -- (-2272.274) (-2273.810) [-2272.935] (-2278.640) * (-2272.453) (-2274.594) (-2273.667) [-2274.083] -- 0:00:49 308000 -- [-2272.246] (-2277.688) (-2274.181) (-2271.405) * [-2275.560] (-2275.242) (-2273.728) (-2271.210) -- 0:00:49 308500 -- (-2272.867) (-2276.553) [-2272.818] (-2270.899) * (-2271.903) (-2273.134) [-2273.673] (-2271.532) -- 0:00:49 309000 -- (-2274.850) [-2277.201] (-2271.771) (-2273.849) * [-2273.367] (-2273.414) (-2271.929) (-2273.699) -- 0:00:49 309500 -- (-2274.303) [-2279.605] (-2271.664) (-2272.802) * (-2275.833) [-2273.051] (-2272.437) (-2272.843) -- 0:00:49 310000 -- (-2274.305) (-2272.864) (-2272.457) [-2276.292] * (-2275.884) (-2273.067) [-2277.963] (-2272.826) -- 0:00:48 Average standard deviation of split frequencies: 0.013657 310500 -- (-2274.913) (-2273.464) [-2272.918] (-2272.807) * (-2277.811) (-2273.001) (-2273.797) [-2272.843] -- 0:00:48 311000 -- (-2274.450) [-2271.808] (-2273.282) (-2273.629) * [-2274.058] (-2276.527) (-2272.482) (-2271.625) -- 0:00:48 311500 -- (-2274.980) (-2271.750) [-2273.228] (-2276.296) * (-2280.210) (-2274.633) [-2272.486] (-2271.781) -- 0:00:48 312000 -- (-2274.861) [-2274.896] (-2272.676) (-2272.036) * (-2277.823) (-2273.927) [-2272.337] (-2275.350) -- 0:00:48 312500 -- (-2276.024) [-2274.829] (-2273.005) (-2271.221) * (-2274.699) (-2274.644) [-2272.626] (-2274.200) -- 0:00:50 313000 -- (-2275.203) [-2273.922] (-2275.238) (-2271.778) * [-2273.251] (-2274.393) (-2277.066) (-2272.160) -- 0:00:50 313500 -- (-2275.754) (-2275.263) (-2275.605) [-2272.238] * (-2276.328) [-2274.294] (-2277.976) (-2274.187) -- 0:00:50 314000 -- (-2273.723) (-2273.633) (-2276.642) [-2271.862] * [-2278.812] (-2274.645) (-2273.497) (-2272.405) -- 0:00:50 314500 -- [-2275.232] (-2273.832) (-2272.355) (-2273.404) * (-2273.957) (-2271.931) (-2273.926) [-2273.969] -- 0:00:50 315000 -- (-2277.202) (-2275.394) [-2272.855] (-2271.323) * (-2276.364) (-2271.434) (-2276.156) [-2277.981] -- 0:00:50 Average standard deviation of split frequencies: 0.012763 315500 -- (-2273.125) (-2275.851) (-2271.247) [-2273.402] * [-2277.942] (-2272.681) (-2275.799) (-2273.247) -- 0:00:49 316000 -- (-2272.795) [-2275.026] (-2272.216) (-2274.370) * (-2274.187) (-2271.511) (-2271.126) [-2272.708] -- 0:00:49 316500 -- (-2272.545) [-2273.371] (-2273.315) (-2275.188) * [-2274.516] (-2272.866) (-2273.337) (-2273.527) -- 0:00:49 317000 -- (-2272.353) (-2273.908) [-2278.341] (-2271.182) * (-2273.654) [-2272.594] (-2271.378) (-2273.936) -- 0:00:49 317500 -- [-2272.711] (-2274.460) (-2274.439) (-2272.027) * [-2273.358] (-2274.002) (-2272.129) (-2273.732) -- 0:00:49 318000 -- (-2273.429) (-2275.067) [-2275.370] (-2273.879) * (-2273.607) (-2271.993) (-2271.940) [-2271.483] -- 0:00:49 318500 -- (-2275.741) (-2272.884) [-2270.979] (-2273.874) * [-2273.607] (-2273.762) (-2273.710) (-2272.737) -- 0:00:49 319000 -- [-2273.651] (-2274.927) (-2274.875) (-2277.631) * (-2273.600) (-2273.728) (-2274.365) [-2272.457] -- 0:00:49 319500 -- [-2274.611] (-2273.598) (-2273.124) (-2275.486) * (-2273.915) (-2274.642) [-2271.914] (-2274.709) -- 0:00:48 320000 -- (-2279.098) (-2273.334) (-2273.790) [-2274.210] * (-2273.924) [-2274.620] (-2272.991) (-2273.111) -- 0:00:48 Average standard deviation of split frequencies: 0.013231 320500 -- (-2277.263) [-2273.358] (-2274.559) (-2273.128) * (-2271.717) (-2272.330) [-2271.597] (-2272.546) -- 0:00:48 321000 -- (-2271.359) (-2271.918) [-2273.039] (-2271.836) * (-2272.495) [-2271.772] (-2274.006) (-2272.335) -- 0:00:48 321500 -- [-2271.496] (-2275.325) (-2272.819) (-2275.203) * (-2272.387) [-2273.203] (-2273.590) (-2272.353) -- 0:00:48 322000 -- [-2274.276] (-2276.933) (-2274.160) (-2275.863) * [-2272.617] (-2273.535) (-2272.150) (-2275.225) -- 0:00:48 322500 -- [-2272.965] (-2274.192) (-2273.385) (-2276.438) * (-2272.369) (-2273.697) [-2271.831] (-2274.724) -- 0:00:48 323000 -- (-2274.115) (-2272.167) [-2272.443] (-2273.909) * (-2272.610) [-2273.055] (-2273.750) (-2273.508) -- 0:00:48 323500 -- [-2273.317] (-2273.128) (-2274.757) (-2275.237) * [-2272.797] (-2272.916) (-2273.740) (-2273.422) -- 0:00:48 324000 -- (-2272.622) (-2272.573) (-2271.611) [-2274.504] * [-2274.199] (-2273.068) (-2274.193) (-2276.822) -- 0:00:47 324500 -- (-2271.355) (-2273.465) (-2272.254) [-2272.971] * [-2272.449] (-2274.499) (-2272.243) (-2274.845) -- 0:00:47 325000 -- (-2276.169) (-2272.904) [-2273.344] (-2273.535) * [-2271.746] (-2271.122) (-2275.716) (-2278.357) -- 0:00:47 Average standard deviation of split frequencies: 0.013471 325500 -- (-2272.437) [-2271.947] (-2274.021) (-2270.963) * [-2272.269] (-2271.122) (-2271.745) (-2277.674) -- 0:00:47 326000 -- (-2272.460) (-2273.680) [-2274.151] (-2272.615) * (-2281.780) (-2271.554) (-2271.415) [-2276.150] -- 0:00:47 326500 -- (-2273.122) (-2273.852) [-2274.050] (-2273.573) * (-2277.601) (-2273.863) [-2272.933] (-2271.930) -- 0:00:47 327000 -- (-2274.006) (-2272.221) (-2275.418) [-2271.100] * (-2272.633) (-2275.236) [-2274.259] (-2273.469) -- 0:00:47 327500 -- (-2272.781) [-2271.713] (-2277.163) (-2271.029) * (-2272.030) (-2273.900) [-2271.623] (-2273.324) -- 0:00:49 328000 -- [-2274.406] (-2273.519) (-2275.095) (-2271.895) * (-2272.493) (-2274.429) (-2271.678) [-2272.762] -- 0:00:49 328500 -- (-2272.674) [-2273.094] (-2275.479) (-2275.407) * (-2275.097) (-2274.753) [-2271.329] (-2274.737) -- 0: