--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:07:41 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/hisI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -473.76 -478.17
2 -473.76 -476.65
--------------------------------------
TOTAL -473.76 -477.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894479 0.086450 0.360527 1.479809 0.863748 1333.35 1417.18 1.000
r(A<->C){all} 0.174471 0.020861 0.000076 0.456536 0.136866 216.66 254.69 1.001
r(A<->G){all} 0.166253 0.019610 0.000370 0.449344 0.129846 202.95 311.46 1.001
r(A<->T){all} 0.173759 0.019991 0.000035 0.447257 0.142760 208.38 331.07 1.000
r(C<->G){all} 0.160721 0.019228 0.000038 0.435920 0.124018 205.43 209.94 1.004
r(C<->T){all} 0.165997 0.019000 0.000006 0.446956 0.131803 153.13 188.60 1.000
r(G<->T){all} 0.158799 0.017882 0.000029 0.426625 0.126487 316.67 320.39 1.002
pi(A){all} 0.208972 0.000450 0.167617 0.249308 0.208984 1235.09 1299.92 1.000
pi(C){all} 0.304392 0.000613 0.256720 0.353295 0.304088 1161.74 1193.01 1.000
pi(G){all} 0.289402 0.000590 0.240927 0.333854 0.289060 1246.35 1373.68 1.000
pi(T){all} 0.197233 0.000462 0.153252 0.236785 0.197080 1268.99 1297.95 1.001
alpha{1,2} 0.412959 0.233241 0.000166 1.368643 0.238711 1110.23 1126.94 1.000
alpha{3} 0.444289 0.248938 0.000174 1.439089 0.271827 1254.40 1377.70 1.001
pinvar{all} 0.995270 0.000035 0.984840 0.999999 0.996989 1175.89 1243.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -457.38655
Model 2: PositiveSelection -457.386506
Model 0: one-ratio -457.386507
Model 7: beta -457.386582
Model 8: beta&w>1 -457.386507
Model 0 vs 1 8.600000001024455E-5
Model 2 vs 1 8.800000000519503E-5
Model 8 vs 7 1.4999999996234692E-4
>C1
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C2
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C3
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C4
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C5
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C6
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=115
C1 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C2 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C3 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C4 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C5 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C6 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
**************************************************
C1 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C2 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C3 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C4 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C5 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C6 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
**************************************************
C1 AHSCFDSAMLLAPQD
C2 AHSCFDSAMLLAPQD
C3 AHSCFDSAMLLAPQD
C4 AHSCFDSAMLLAPQD
C5 AHSCFDSAMLLAPQD
C6 AHSCFDSAMLLAPQD
***************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3450]--->[3450]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.458 Mb, Max= 30.642 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C2 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C3 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C4 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C5 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C6 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
**************************************************
C1 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C2 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C3 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C4 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C5 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C6 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
**************************************************
C1 AHSCFDSAMLLAPQD
C2 AHSCFDSAMLLAPQD
C3 AHSCFDSAMLLAPQD
C4 AHSCFDSAMLLAPQD
C5 AHSCFDSAMLLAPQD
C6 AHSCFDSAMLLAPQD
***************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C2 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C3 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C4 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C5 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C6 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
**************************************************
C1 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C2 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C3 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C4 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C5 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C6 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
**************************************************
C1 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C2 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C3 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C4 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C5 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C6 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
**************************************************
C1 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C2 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C3 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C4 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C5 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C6 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
**************************************************
C1 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C2 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C3 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C4 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C5 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C6 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
**************************************************
C1 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C2 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C3 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C4 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C5 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C6 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
**************************************************
C1 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C2 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C3 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C4 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C5 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C6 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
*********************************************
>C1
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C2
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C3
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C4
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C5
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C6
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C1
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C2
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C3
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C4
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C5
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C6
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 345 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791985
Setting output file names to "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1981071593
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0483566634
Seed = 257141974
Swapseed = 1579791985
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -772.126541 -- -24.965149
Chain 2 -- -772.126541 -- -24.965149
Chain 3 -- -772.126541 -- -24.965149
Chain 4 -- -772.126541 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -772.126541 -- -24.965149
Chain 2 -- -772.126496 -- -24.965149
Chain 3 -- -772.126496 -- -24.965149
Chain 4 -- -772.126541 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-772.127] (-772.127) (-772.127) (-772.127) * [-772.127] (-772.126) (-772.126) (-772.127)
500 -- (-479.542) (-491.734) [-484.012] (-482.560) * (-486.208) (-483.921) (-478.041) [-479.113] -- 0:00:00
1000 -- (-485.953) (-487.372) [-480.782] (-480.273) * (-483.232) (-484.294) [-478.544] (-485.064) -- 0:00:00
1500 -- (-484.878) (-488.313) (-483.252) [-493.922] * (-485.049) (-483.950) (-483.905) [-482.727] -- 0:00:00
2000 -- (-484.949) (-482.026) [-484.445] (-482.492) * (-482.597) (-483.638) (-481.484) [-483.142] -- 0:00:00
2500 -- (-481.296) (-487.931) (-483.590) [-475.192] * (-483.772) (-497.275) (-485.842) [-483.005] -- 0:00:00
3000 -- [-482.854] (-481.947) (-481.405) (-491.499) * (-481.887) [-485.748] (-483.462) (-491.190) -- 0:00:00
3500 -- (-484.949) (-486.825) (-482.155) [-483.611] * [-479.973] (-484.718) (-486.993) (-483.822) -- 0:00:00
4000 -- (-495.485) (-486.299) [-486.922] (-483.688) * [-485.910] (-486.065) (-480.498) (-483.872) -- 0:00:00
4500 -- [-482.883] (-484.768) (-486.951) (-483.391) * (-484.813) (-496.421) (-482.139) [-486.205] -- 0:00:00
5000 -- (-480.572) (-485.161) (-489.519) [-481.154] * [-480.313] (-484.989) (-488.630) (-482.433) -- 0:00:00
Average standard deviation of split frequencies: 0.096027
5500 -- (-485.762) (-484.213) (-480.902) [-484.370] * (-483.104) (-487.910) (-489.053) [-483.306] -- 0:00:00
6000 -- (-482.145) (-477.243) (-488.257) [-481.525] * [-477.160] (-480.474) (-478.903) (-491.252) -- 0:00:00
6500 -- (-490.002) (-484.434) (-491.022) [-481.756] * [-488.877] (-499.782) (-493.274) (-482.619) -- 0:00:00
7000 -- (-483.655) (-485.530) (-479.597) [-482.577] * (-487.710) [-484.369] (-486.561) (-489.126) -- 0:00:00
7500 -- (-484.283) [-480.867] (-479.046) (-482.598) * (-482.942) [-481.452] (-487.585) (-485.619) -- 0:00:00
8000 -- (-484.941) (-492.398) [-484.545] (-480.594) * (-482.871) (-488.790) (-479.845) [-491.524] -- 0:00:00
8500 -- (-486.226) [-478.435] (-479.163) (-483.908) * (-480.220) [-480.302] (-482.153) (-493.916) -- 0:00:00
9000 -- (-482.197) [-482.794] (-485.629) (-481.653) * [-480.184] (-493.523) (-482.863) (-482.241) -- 0:00:00
9500 -- (-477.746) (-480.845) (-487.032) [-483.456] * (-489.706) (-487.316) (-481.177) [-475.719] -- 0:00:00
10000 -- (-483.658) (-482.853) [-480.901] (-489.836) * [-481.932] (-490.149) (-484.750) (-479.888) -- 0:00:00
Average standard deviation of split frequencies: 0.080589
10500 -- (-489.404) [-484.420] (-486.475) (-484.434) * [-491.708] (-482.354) (-478.359) (-476.218) -- 0:00:00
11000 -- (-479.357) [-482.398] (-483.776) (-479.929) * (-485.593) (-478.412) [-482.046] (-491.351) -- 0:00:00
11500 -- (-483.533) [-479.576] (-484.257) (-483.333) * (-490.958) [-480.386] (-484.805) (-485.397) -- 0:00:00
12000 -- [-480.926] (-485.112) (-478.267) (-490.531) * [-483.388] (-480.367) (-486.880) (-489.661) -- 0:00:00
12500 -- (-480.980) [-482.668] (-485.048) (-482.491) * (-481.985) (-484.531) [-486.635] (-487.540) -- 0:00:00
13000 -- (-486.712) (-484.611) (-478.429) [-481.800] * [-486.976] (-483.833) (-491.224) (-482.273) -- 0:00:00
13500 -- (-487.835) [-488.342] (-484.235) (-483.070) * [-477.805] (-493.374) (-479.329) (-486.657) -- 0:01:13
14000 -- (-486.677) (-482.275) [-489.131] (-485.525) * [-477.207] (-488.426) (-481.137) (-487.463) -- 0:01:10
14500 -- (-478.891) [-481.885] (-487.733) (-483.080) * (-491.308) [-485.255] (-484.512) (-488.018) -- 0:01:07
15000 -- [-484.887] (-487.310) (-485.546) (-482.571) * (-483.218) [-482.677] (-492.758) (-481.095) -- 0:01:05
Average standard deviation of split frequencies: 0.045831
15500 -- (-485.241) (-474.895) [-487.395] (-484.543) * (-479.527) (-483.132) (-485.421) [-484.517] -- 0:01:03
16000 -- (-482.855) (-485.468) [-483.707] (-482.843) * (-491.764) [-482.705] (-487.058) (-490.330) -- 0:01:01
16500 -- (-490.065) (-480.095) [-483.614] (-503.218) * (-482.936) [-483.813] (-486.268) (-494.565) -- 0:00:59
17000 -- (-490.301) (-486.787) [-487.011] (-490.346) * (-481.318) [-478.539] (-485.967) (-489.421) -- 0:00:57
17500 -- (-485.946) [-483.712] (-481.304) (-489.607) * [-478.570] (-482.685) (-482.904) (-485.613) -- 0:00:56
18000 -- (-489.152) [-490.542] (-479.438) (-498.887) * [-480.245] (-488.889) (-488.059) (-483.721) -- 0:00:54
18500 -- (-482.862) (-492.493) (-484.661) [-479.125] * (-483.867) (-477.202) (-491.876) [-485.980] -- 0:00:53
19000 -- [-479.440] (-490.447) (-483.451) (-472.722) * (-487.361) (-485.123) (-486.190) [-482.428] -- 0:00:51
19500 -- (-485.650) (-489.222) [-479.513] (-474.300) * (-481.205) [-487.966] (-479.440) (-485.261) -- 0:00:50
20000 -- [-489.632] (-490.182) (-484.675) (-475.731) * (-490.385) [-492.930] (-484.455) (-486.815) -- 0:00:49
Average standard deviation of split frequencies: 0.038492
20500 -- (-485.602) (-489.174) [-478.887] (-475.872) * (-485.350) (-502.408) [-483.759] (-479.850) -- 0:00:47
21000 -- (-481.687) [-478.441] (-485.921) (-474.585) * (-480.145) (-496.970) [-483.893] (-478.443) -- 0:00:46
21500 -- (-482.735) [-479.938] (-485.034) (-472.555) * [-480.952] (-493.676) (-487.040) (-482.461) -- 0:00:45
22000 -- (-485.195) (-482.276) [-482.210] (-472.795) * (-487.904) (-489.002) (-486.128) [-480.271] -- 0:00:44
22500 -- [-478.980] (-485.466) (-486.311) (-476.838) * (-484.799) [-476.668] (-486.060) (-492.051) -- 0:00:43
23000 -- (-490.742) (-490.114) [-481.165] (-473.627) * (-485.178) (-474.419) [-482.613] (-489.683) -- 0:00:42
23500 -- (-482.938) (-486.925) (-481.897) [-474.259] * [-479.920] (-472.751) (-490.858) (-489.253) -- 0:00:41
24000 -- (-479.052) (-489.405) [-480.205] (-475.816) * [-483.727] (-472.780) (-480.451) (-485.268) -- 0:00:40
24500 -- (-483.409) (-482.663) (-483.815) [-476.326] * (-486.487) [-472.214] (-510.961) (-495.421) -- 0:00:39
25000 -- [-485.052] (-480.296) (-480.616) (-477.097) * [-486.730] (-472.684) (-486.334) (-486.161) -- 0:00:39
Average standard deviation of split frequencies: 0.039715
25500 -- (-478.442) [-489.499] (-478.867) (-473.229) * (-478.792) [-472.572] (-498.891) (-482.327) -- 0:00:38
26000 -- [-484.312] (-483.534) (-484.646) (-475.225) * (-492.226) (-473.254) [-475.939] (-483.633) -- 0:00:37
26500 -- (-487.911) (-479.324) [-482.121] (-476.379) * (-481.640) [-473.098] (-474.249) (-495.286) -- 0:00:36
27000 -- (-486.286) (-478.511) (-486.190) [-474.143] * (-480.546) (-473.231) [-475.142] (-490.514) -- 0:00:36
27500 -- (-485.804) [-481.707] (-483.381) (-473.659) * (-486.776) [-476.618] (-472.973) (-481.956) -- 0:00:35
28000 -- (-484.300) [-485.560] (-483.422) (-480.381) * (-479.006) (-478.213) [-475.231] (-480.420) -- 0:00:34
28500 -- (-482.524) (-481.640) [-483.627] (-474.812) * (-486.288) (-474.032) [-474.344] (-485.797) -- 0:00:34
29000 -- (-488.811) [-482.904] (-479.906) (-475.532) * [-477.819] (-476.016) (-478.245) (-482.658) -- 0:00:33
29500 -- (-481.163) [-482.118] (-486.449) (-476.337) * [-481.595] (-475.790) (-472.596) (-482.592) -- 0:01:05
30000 -- (-497.994) [-481.991] (-483.255) (-476.971) * [-493.301] (-477.425) (-475.429) (-478.983) -- 0:01:04
Average standard deviation of split frequencies: 0.045211
30500 -- (-486.373) (-478.183) [-484.117] (-474.772) * (-484.870) [-473.565] (-478.218) (-479.539) -- 0:01:03
31000 -- [-478.103] (-481.833) (-484.840) (-473.901) * (-483.114) [-472.244] (-480.829) (-484.084) -- 0:01:02
31500 -- [-483.505] (-486.015) (-483.588) (-474.152) * (-484.379) (-475.544) (-475.573) [-482.987] -- 0:01:01
32000 -- (-482.862) (-481.617) [-482.492] (-474.982) * (-485.353) [-477.156] (-473.738) (-486.637) -- 0:01:00
32500 -- [-478.204] (-506.271) (-486.343) (-473.663) * (-482.280) (-473.927) [-473.327] (-485.652) -- 0:00:59
33000 -- (-483.363) (-507.968) (-476.879) [-476.547] * (-481.030) (-475.210) [-473.239] (-478.358) -- 0:00:58
33500 -- (-486.308) (-491.253) (-488.765) [-476.893] * (-486.200) (-473.283) (-472.939) [-481.048] -- 0:00:57
34000 -- (-486.204) (-487.903) [-481.018] (-474.074) * [-480.638] (-476.456) (-475.554) (-489.884) -- 0:00:56
34500 -- [-480.053] (-484.454) (-482.507) (-474.743) * (-494.179) (-473.600) (-481.263) [-483.704] -- 0:00:55
35000 -- (-484.933) (-483.341) (-483.430) [-478.154] * (-488.156) [-472.876] (-477.243) (-488.318) -- 0:00:55
Average standard deviation of split frequencies: 0.048741
35500 -- (-484.385) [-473.595] (-485.696) (-476.256) * (-495.207) [-474.315] (-475.278) (-483.775) -- 0:00:54
36000 -- [-485.365] (-473.723) (-482.337) (-477.725) * (-492.714) (-473.773) [-476.864] (-486.931) -- 0:00:53
36500 -- (-494.358) [-473.415] (-486.377) (-477.080) * (-489.769) (-473.952) [-476.026] (-479.867) -- 0:00:52
37000 -- (-485.996) [-476.735] (-479.518) (-475.311) * (-482.926) (-474.846) [-473.622] (-492.838) -- 0:00:52
37500 -- (-484.491) [-474.006] (-485.931) (-476.607) * [-472.721] (-473.336) (-472.590) (-489.124) -- 0:00:51
38000 -- (-483.470) (-479.303) [-483.011] (-474.010) * (-472.390) (-475.492) [-472.172] (-483.193) -- 0:00:50
38500 -- (-481.674) [-474.010] (-490.860) (-473.209) * [-472.189] (-473.969) (-475.669) (-491.919) -- 0:00:49
39000 -- (-489.067) (-475.874) (-482.237) [-473.411] * (-473.634) (-473.384) (-473.747) [-478.718] -- 0:00:49
39500 -- [-485.177] (-472.981) (-484.627) (-474.700) * (-478.931) (-477.243) (-475.125) [-478.095] -- 0:00:48
40000 -- (-489.804) (-473.394) [-479.520] (-473.013) * [-473.800] (-475.123) (-473.458) (-480.034) -- 0:00:48
Average standard deviation of split frequencies: 0.036606
40500 -- (-480.840) [-474.156] (-485.108) (-474.251) * [-473.266] (-475.245) (-474.027) (-483.721) -- 0:00:47
41000 -- [-481.008] (-474.604) (-486.556) (-474.275) * (-473.501) [-476.434] (-476.934) (-484.673) -- 0:00:46
41500 -- (-482.582) (-475.355) [-483.267] (-473.759) * (-473.101) (-476.098) [-477.625] (-480.241) -- 0:00:46
42000 -- [-489.475] (-472.755) (-480.847) (-475.914) * (-473.709) (-472.791) (-474.303) [-485.355] -- 0:00:45
42500 -- (-482.428) (-473.004) [-482.553] (-473.928) * (-474.919) [-476.101] (-477.603) (-485.741) -- 0:00:45
43000 -- (-487.356) (-475.987) (-479.766) [-472.861] * (-476.302) (-475.605) (-476.060) [-484.046] -- 0:00:44
43500 -- (-484.732) (-473.707) (-485.280) [-475.225] * (-475.239) (-475.893) (-472.263) [-483.362] -- 0:00:43
44000 -- (-483.203) (-478.075) (-479.304) [-476.973] * (-474.060) (-479.826) [-473.321] (-479.403) -- 0:00:43
44500 -- (-478.291) (-473.983) (-482.545) [-474.415] * (-473.468) [-476.944] (-478.049) (-495.194) -- 0:00:42
45000 -- (-487.201) (-475.135) (-487.203) [-476.331] * (-477.651) [-475.178] (-473.682) (-483.049) -- 0:00:42
Average standard deviation of split frequencies: 0.038197
45500 -- [-483.213] (-472.913) (-480.521) (-473.743) * (-475.364) (-473.100) (-474.162) [-482.368] -- 0:01:02
46000 -- (-489.360) [-473.517] (-486.972) (-475.099) * (-474.892) [-473.688] (-474.452) (-489.443) -- 0:01:02
46500 -- (-481.970) [-474.214] (-487.057) (-477.482) * (-474.777) (-473.837) [-474.461] (-486.372) -- 0:01:01
47000 -- (-493.452) [-474.747] (-478.822) (-473.166) * [-480.822] (-473.209) (-476.668) (-482.138) -- 0:01:00
47500 -- (-487.652) (-475.405) (-481.775) [-472.600] * (-474.331) [-476.388] (-476.662) (-490.762) -- 0:01:00
48000 -- (-483.311) [-474.366] (-480.944) (-476.958) * (-473.405) (-477.740) (-477.511) [-489.514] -- 0:00:59
48500 -- (-483.525) [-473.326] (-491.395) (-473.008) * (-477.002) [-476.729] (-477.103) (-492.885) -- 0:00:58
49000 -- (-482.758) (-475.795) [-482.189] (-473.391) * (-473.833) (-475.582) (-474.253) [-483.099] -- 0:00:58
49500 -- [-480.643] (-474.745) (-486.160) (-474.825) * (-473.445) (-476.091) [-473.742] (-492.785) -- 0:00:57
50000 -- (-489.390) (-477.870) [-484.439] (-473.341) * (-472.195) (-476.351) [-472.848] (-484.952) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
50500 -- (-479.176) (-478.541) (-477.061) [-476.347] * (-473.519) [-475.596] (-478.497) (-492.806) -- 0:00:56
51000 -- (-474.239) (-483.509) (-489.259) [-473.345] * (-474.041) [-473.012] (-473.284) (-486.216) -- 0:00:55
51500 -- (-474.678) (-473.639) (-481.412) [-473.556] * (-476.493) (-474.775) (-473.159) [-484.639] -- 0:00:55
52000 -- [-475.770] (-477.994) (-477.741) (-474.785) * (-473.921) [-473.328] (-474.048) (-490.808) -- 0:00:54
52500 -- (-475.321) [-476.064] (-473.082) (-474.884) * (-475.063) (-474.582) [-473.367] (-485.543) -- 0:00:54
53000 -- [-474.963] (-478.642) (-472.944) (-476.451) * (-474.606) [-475.997] (-472.806) (-483.608) -- 0:00:53
53500 -- (-474.146) (-474.417) (-472.720) [-473.233] * (-475.132) (-473.819) [-474.724] (-488.921) -- 0:00:53
54000 -- (-474.524) (-473.339) (-475.651) [-474.056] * (-473.699) [-479.666] (-478.275) (-490.014) -- 0:00:52
54500 -- (-474.285) (-473.514) [-472.772] (-475.370) * (-475.979) (-477.950) (-479.881) [-483.649] -- 0:00:52
55000 -- (-472.698) (-475.133) [-475.135] (-473.607) * [-473.853] (-476.886) (-481.231) (-480.379) -- 0:00:51
Average standard deviation of split frequencies: 0.031988
55500 -- [-474.454] (-475.415) (-474.208) (-474.529) * (-473.946) (-475.114) [-474.023] (-485.430) -- 0:00:51
56000 -- [-473.975] (-475.515) (-473.226) (-475.405) * [-476.194] (-472.306) (-473.380) (-483.470) -- 0:00:50
56500 -- [-472.986] (-475.511) (-477.025) (-477.498) * (-475.027) [-477.379] (-473.128) (-483.743) -- 0:00:50
57000 -- (-473.980) (-479.193) (-478.617) [-472.876] * (-474.184) [-474.756] (-477.737) (-489.282) -- 0:00:49
57500 -- (-472.963) [-474.815] (-475.737) (-476.219) * (-473.637) (-474.399) (-473.555) [-479.587] -- 0:00:49
58000 -- (-475.089) (-473.284) (-473.702) [-473.512] * (-473.374) [-473.022] (-473.220) (-489.466) -- 0:00:48
58500 -- (-480.209) (-475.729) [-472.783] (-473.982) * [-473.277] (-475.656) (-472.533) (-477.309) -- 0:00:48
59000 -- (-474.984) (-475.279) [-473.721] (-474.468) * (-477.165) (-475.410) [-472.965] (-480.337) -- 0:00:47
59500 -- (-475.314) (-475.539) [-475.411] (-475.215) * [-474.185] (-479.744) (-476.762) (-482.886) -- 0:00:47
60000 -- (-474.847) [-472.724] (-474.490) (-477.012) * [-476.943] (-478.310) (-473.243) (-480.167) -- 0:00:47
Average standard deviation of split frequencies: 0.028219
60500 -- (-475.425) [-472.881] (-473.767) (-474.773) * (-479.885) (-474.766) (-474.425) [-480.216] -- 0:00:46
61000 -- (-475.360) (-475.308) [-474.037] (-472.804) * [-474.343] (-473.958) (-474.406) (-488.590) -- 0:00:46
61500 -- (-474.485) (-474.596) (-476.153) [-472.510] * (-474.595) [-473.201] (-475.634) (-488.249) -- 0:01:01
62000 -- (-472.604) [-474.058] (-476.025) (-473.746) * (-474.993) (-475.189) (-476.991) [-481.657] -- 0:01:00
62500 -- (-473.248) (-475.061) [-475.075] (-474.081) * (-473.990) [-476.425] (-473.729) (-499.717) -- 0:01:00
63000 -- [-473.059] (-475.781) (-473.167) (-475.689) * (-474.452) (-475.247) (-474.242) [-474.373] -- 0:00:59
63500 -- [-473.539] (-473.824) (-476.869) (-473.537) * (-478.418) (-476.696) (-474.782) [-476.228] -- 0:00:58
64000 -- (-474.694) (-474.143) [-474.213] (-475.668) * (-475.953) (-473.396) [-480.598] (-473.259) -- 0:00:58
64500 -- (-474.947) [-474.699] (-474.579) (-473.788) * (-474.039) (-473.830) [-473.034] (-472.850) -- 0:00:58
65000 -- (-477.197) (-474.212) (-473.061) [-473.938] * (-472.857) (-476.021) [-474.646] (-477.030) -- 0:00:57
Average standard deviation of split frequencies: 0.030450
65500 -- (-477.769) [-473.505] (-478.731) (-475.652) * (-475.084) [-477.193] (-474.003) (-480.103) -- 0:00:57
66000 -- (-472.923) (-477.368) [-473.045] (-475.756) * (-476.013) (-479.139) (-473.708) [-474.310] -- 0:00:56
66500 -- (-472.690) (-475.210) [-476.921] (-476.110) * [-475.209] (-476.235) (-472.302) (-473.717) -- 0:00:56
67000 -- (-472.721) [-472.644] (-477.500) (-474.565) * (-474.818) (-475.002) (-474.666) [-473.847] -- 0:00:55
67500 -- [-473.138] (-474.552) (-474.098) (-474.665) * (-476.571) (-475.492) (-475.447) [-472.517] -- 0:00:55
68000 -- (-474.842) (-474.277) (-477.319) [-474.307] * (-473.066) (-480.852) (-476.046) [-476.839] -- 0:00:54
68500 -- (-474.473) [-473.550] (-476.448) (-477.712) * (-476.399) [-473.996] (-474.471) (-473.245) -- 0:00:54
69000 -- (-472.530) (-474.881) [-476.999] (-472.656) * (-474.286) [-473.344] (-474.309) (-476.958) -- 0:00:53
69500 -- [-473.183] (-473.667) (-475.813) (-473.355) * (-473.775) (-474.473) [-476.112] (-476.500) -- 0:00:53
70000 -- (-473.686) [-479.487] (-478.915) (-475.161) * (-473.893) (-476.028) (-477.895) [-476.216] -- 0:00:53
Average standard deviation of split frequencies: 0.027737
70500 -- (-474.414) (-475.795) (-476.755) [-473.710] * (-475.353) (-476.337) (-475.272) [-473.745] -- 0:00:52
71000 -- (-476.193) (-476.090) [-478.177] (-473.502) * (-480.062) [-474.042] (-476.067) (-473.083) -- 0:00:52
71500 -- (-481.453) (-481.402) (-479.522) [-474.380] * (-473.497) (-473.763) [-473.066] (-473.429) -- 0:00:51
72000 -- (-473.620) [-475.481] (-477.410) (-473.531) * [-473.592] (-476.356) (-473.238) (-476.059) -- 0:00:51
72500 -- [-472.716] (-474.110) (-472.995) (-477.657) * (-474.402) [-474.583] (-473.136) (-474.286) -- 0:00:51
73000 -- (-476.719) [-474.902] (-477.049) (-475.270) * (-472.843) [-474.415] (-472.944) (-472.836) -- 0:00:50
73500 -- (-473.984) (-477.759) [-472.934] (-474.435) * (-472.761) [-472.801] (-475.986) (-474.176) -- 0:00:50
74000 -- (-475.368) (-476.210) [-475.557] (-472.495) * (-476.254) [-472.878] (-475.339) (-482.627) -- 0:00:50
74500 -- (-478.069) (-473.204) (-473.966) [-472.159] * (-474.205) (-472.632) (-481.628) [-475.785] -- 0:00:49
75000 -- [-473.752] (-476.408) (-474.967) (-473.567) * (-475.911) (-474.712) (-476.566) [-475.863] -- 0:00:49
Average standard deviation of split frequencies: 0.027096
75500 -- (-474.987) [-472.707] (-477.078) (-473.010) * (-476.509) [-473.927] (-477.432) (-476.470) -- 0:00:48
76000 -- (-479.004) (-473.810) (-477.151) [-475.524] * (-478.245) (-473.678) [-476.982] (-476.256) -- 0:00:48
76500 -- (-477.886) (-474.353) (-472.534) [-472.966] * (-472.798) (-476.306) (-476.895) [-477.757] -- 0:00:48
77000 -- (-476.755) (-475.539) (-472.494) [-475.150] * (-472.436) (-475.322) [-474.320] (-475.122) -- 0:00:47
77500 -- (-472.525) (-475.044) (-476.878) [-472.789] * (-477.688) [-473.527] (-479.415) (-475.652) -- 0:00:59
78000 -- (-473.752) (-474.324) [-475.520] (-472.889) * (-474.964) [-475.070] (-476.652) (-475.698) -- 0:00:59
78500 -- [-476.787] (-476.371) (-475.637) (-474.216) * (-475.276) [-474.532] (-478.408) (-473.933) -- 0:00:58
79000 -- (-473.109) [-475.703] (-474.681) (-477.671) * [-473.591] (-472.395) (-474.492) (-476.061) -- 0:00:58
79500 -- (-472.734) (-476.508) (-473.476) [-476.801] * (-474.400) (-472.640) [-476.726] (-476.570) -- 0:00:57
80000 -- (-474.044) (-475.327) [-474.127] (-475.063) * (-476.102) (-474.603) [-477.752] (-474.637) -- 0:00:57
Average standard deviation of split frequencies: 0.026451
80500 -- (-473.558) (-473.961) (-472.561) [-473.661] * (-475.184) (-474.104) [-476.529] (-474.671) -- 0:00:57
81000 -- (-473.827) (-474.205) [-472.386] (-478.877) * [-475.275] (-473.933) (-472.744) (-474.118) -- 0:00:56
81500 -- (-473.595) (-473.408) (-475.553) [-480.266] * (-472.780) (-473.293) [-472.567] (-474.338) -- 0:00:56
82000 -- [-474.584] (-474.951) (-474.826) (-473.496) * [-474.762] (-472.953) (-472.881) (-474.418) -- 0:00:55
82500 -- [-474.646] (-476.326) (-475.196) (-473.213) * (-472.893) (-473.711) [-473.880] (-473.800) -- 0:00:55
83000 -- (-473.209) [-474.179] (-474.569) (-473.209) * [-474.520] (-473.750) (-473.858) (-477.112) -- 0:00:55
83500 -- (-472.948) [-474.839] (-474.278) (-474.382) * (-475.990) (-475.918) [-474.629] (-472.364) -- 0:00:54
84000 -- (-475.993) (-474.639) [-472.664] (-475.248) * (-477.610) [-475.383] (-474.267) (-473.472) -- 0:00:54
84500 -- (-476.277) (-473.188) [-476.271] (-477.222) * (-476.594) [-477.674] (-473.660) (-476.952) -- 0:00:54
85000 -- (-474.271) (-472.648) (-476.739) [-477.499] * (-473.312) (-475.768) (-473.049) [-472.897] -- 0:00:53
Average standard deviation of split frequencies: 0.026624
85500 -- (-473.754) (-472.467) [-474.568] (-474.429) * (-475.435) (-474.230) [-473.507] (-476.737) -- 0:00:53
86000 -- (-473.106) (-473.271) (-476.012) [-472.952] * [-476.266] (-473.212) (-474.915) (-474.903) -- 0:00:53
86500 -- (-472.892) (-479.781) (-477.952) [-473.895] * (-474.723) (-473.376) (-473.822) [-475.181] -- 0:00:52
87000 -- (-475.014) (-475.041) (-476.440) [-474.266] * (-476.016) [-474.888] (-472.882) (-474.878) -- 0:00:52
87500 -- (-475.206) (-476.484) [-477.664] (-472.660) * (-474.620) (-476.303) (-473.355) [-477.603] -- 0:00:52
88000 -- (-474.797) (-473.739) [-473.828] (-473.913) * (-474.328) (-475.490) (-472.891) [-473.597] -- 0:00:51
88500 -- [-476.243] (-473.395) (-478.657) (-473.902) * (-473.971) (-473.873) [-473.038] (-473.377) -- 0:00:51
89000 -- (-476.739) [-473.126] (-477.129) (-475.073) * (-476.702) (-475.098) (-476.251) [-472.907] -- 0:00:51
89500 -- (-473.646) (-473.920) (-472.608) [-473.456] * (-474.704) [-474.497] (-476.108) (-474.403) -- 0:00:50
90000 -- (-477.677) [-475.026] (-473.449) (-473.129) * (-477.263) (-476.306) (-475.867) [-472.777] -- 0:00:50
Average standard deviation of split frequencies: 0.026244
90500 -- (-477.357) (-473.732) (-477.951) [-474.135] * (-475.812) (-474.795) (-475.752) [-481.236] -- 0:00:50
91000 -- (-473.575) [-473.370] (-477.131) (-473.721) * (-476.817) [-473.234] (-472.964) (-479.231) -- 0:00:49
91500 -- (-473.245) [-474.951] (-476.532) (-472.893) * (-476.857) (-476.739) (-474.887) [-473.765] -- 0:00:49
92000 -- (-473.764) (-474.060) [-474.434] (-474.233) * [-474.192] (-473.412) (-478.036) (-477.140) -- 0:00:49
92500 -- (-475.613) (-473.993) [-474.220] (-475.981) * [-472.344] (-472.796) (-473.453) (-475.575) -- 0:00:49
93000 -- [-474.181] (-474.119) (-473.715) (-475.078) * [-473.170] (-477.912) (-474.441) (-474.637) -- 0:00:48
93500 -- [-472.786] (-475.909) (-474.334) (-475.632) * (-473.629) [-472.592] (-477.565) (-473.296) -- 0:00:48
94000 -- [-473.558] (-473.334) (-473.525) (-473.422) * (-475.760) [-472.790] (-478.332) (-476.895) -- 0:00:57
94500 -- (-474.897) [-472.552] (-474.241) (-475.427) * (-473.789) (-475.648) (-483.429) [-473.138] -- 0:00:57
95000 -- (-477.068) (-473.202) (-479.123) [-474.406] * [-476.732] (-473.630) (-477.721) (-476.390) -- 0:00:57
Average standard deviation of split frequencies: 0.026891
95500 -- [-474.636] (-473.905) (-474.024) (-472.659) * [-474.823] (-474.694) (-473.635) (-474.645) -- 0:00:56
96000 -- [-474.379] (-474.490) (-478.274) (-473.358) * (-473.524) [-482.110] (-474.517) (-476.416) -- 0:00:56
96500 -- (-474.318) (-474.368) (-476.533) [-472.653] * (-475.169) (-481.913) [-475.169] (-475.016) -- 0:00:56
97000 -- (-473.684) (-477.547) (-474.153) [-476.515] * (-473.256) (-482.104) (-473.462) [-473.614] -- 0:00:55
97500 -- (-477.514) (-473.213) [-473.830] (-476.047) * (-472.747) (-479.338) (-474.389) [-472.917] -- 0:00:55
98000 -- (-475.199) (-476.701) [-472.600] (-479.956) * [-472.668] (-479.145) (-472.266) (-474.678) -- 0:00:55
98500 -- [-475.113] (-472.260) (-476.721) (-476.291) * [-475.522] (-475.769) (-473.100) (-472.796) -- 0:00:54
99000 -- (-476.125) (-474.193) [-473.130] (-472.497) * (-473.886) (-472.035) (-476.115) [-474.171] -- 0:00:54
99500 -- (-483.076) (-473.241) [-475.542] (-474.726) * (-475.030) (-476.117) (-473.616) [-473.603] -- 0:00:54
100000 -- (-475.105) (-475.693) [-472.438] (-474.269) * [-474.592] (-476.874) (-474.336) (-474.491) -- 0:00:54
Average standard deviation of split frequencies: 0.026276
100500 -- (-473.108) (-476.943) [-473.624] (-474.234) * (-474.998) (-472.963) (-477.972) [-476.386] -- 0:00:53
101000 -- (-474.980) [-474.739] (-476.937) (-473.513) * (-476.066) [-473.684] (-476.320) (-472.974) -- 0:00:53
101500 -- (-474.555) [-472.907] (-474.210) (-474.074) * (-474.622) (-475.082) (-473.466) [-473.499] -- 0:00:53
102000 -- (-473.074) (-474.201) (-476.140) [-474.173] * (-472.983) (-477.082) (-474.668) [-474.340] -- 0:00:52
102500 -- (-476.929) (-473.360) (-474.354) [-474.137] * [-473.081] (-474.450) (-473.709) (-473.136) -- 0:00:52
103000 -- [-475.666] (-473.283) (-475.496) (-478.646) * (-473.025) (-476.373) (-472.961) [-473.435] -- 0:00:52
103500 -- (-473.814) (-475.208) (-473.793) [-472.847] * [-474.724] (-472.337) (-475.374) (-476.080) -- 0:00:51
104000 -- (-476.094) [-475.459] (-474.303) (-478.663) * (-480.000) (-472.210) [-474.586] (-472.434) -- 0:00:51
104500 -- [-473.810] (-474.723) (-476.142) (-473.192) * (-478.934) (-475.254) [-472.512] (-472.934) -- 0:00:51
105000 -- (-474.529) (-475.189) (-477.679) [-477.054] * (-473.458) [-473.719] (-474.122) (-473.880) -- 0:00:51
Average standard deviation of split frequencies: 0.025045
105500 -- (-477.104) (-473.839) [-474.602] (-475.184) * (-476.399) (-478.047) [-473.545] (-473.325) -- 0:00:50
106000 -- [-474.556] (-477.086) (-472.777) (-478.063) * (-474.891) (-481.305) [-472.770] (-473.778) -- 0:00:50
106500 -- (-476.214) (-475.861) [-476.108] (-478.490) * [-477.833] (-477.159) (-478.640) (-474.093) -- 0:00:50
107000 -- [-474.339] (-475.883) (-475.973) (-477.807) * [-474.074] (-473.982) (-476.176) (-476.192) -- 0:00:50
107500 -- [-473.198] (-474.820) (-476.997) (-474.738) * (-474.383) [-473.853] (-474.702) (-474.047) -- 0:00:49
108000 -- [-473.354] (-474.615) (-472.899) (-476.742) * (-476.663) (-473.268) [-473.406] (-475.640) -- 0:00:49
108500 -- (-474.907) (-475.398) [-473.610] (-474.935) * (-474.000) (-473.757) [-473.938] (-477.234) -- 0:00:49
109000 -- [-476.302] (-473.672) (-472.656) (-474.550) * [-473.545] (-475.122) (-475.933) (-472.007) -- 0:00:49
109500 -- (-476.572) (-475.758) (-474.418) [-474.515] * [-472.495] (-475.359) (-481.845) (-472.807) -- 0:00:48
110000 -- (-474.736) (-476.684) (-474.643) [-474.448] * (-475.007) (-474.510) (-473.870) [-472.851] -- 0:00:48
Average standard deviation of split frequencies: 0.023540
110500 -- (-474.936) (-474.975) [-475.231] (-473.785) * [-473.765] (-479.057) (-476.062) (-472.915) -- 0:00:56
111000 -- (-473.596) [-472.857] (-476.661) (-477.280) * (-475.419) (-473.264) (-476.099) [-473.270] -- 0:00:56
111500 -- (-473.214) (-472.781) (-476.873) [-472.826] * (-474.457) (-475.110) (-474.624) [-473.652] -- 0:00:55
112000 -- (-473.986) [-473.956] (-474.399) (-472.366) * [-472.862] (-473.297) (-473.138) (-475.481) -- 0:00:55
112500 -- (-474.420) [-476.819] (-473.658) (-473.711) * (-473.629) (-474.914) (-474.079) [-473.869] -- 0:00:55
113000 -- (-477.692) (-473.884) (-473.064) [-474.515] * (-476.734) (-472.761) (-478.748) [-472.891] -- 0:00:54
113500 -- (-478.384) (-473.116) [-473.227] (-473.254) * [-472.551] (-474.677) (-478.725) (-473.576) -- 0:00:54
114000 -- (-477.141) [-473.154] (-473.329) (-472.771) * (-473.010) (-473.435) [-474.143] (-472.876) -- 0:00:54
114500 -- (-475.003) [-473.614] (-477.390) (-476.690) * (-475.481) (-473.124) (-473.700) [-473.868] -- 0:00:54
115000 -- (-474.704) (-474.963) (-473.132) [-476.394] * (-473.718) (-472.355) [-473.785] (-473.332) -- 0:00:53
Average standard deviation of split frequencies: 0.022448
115500 -- (-472.766) (-476.716) (-473.575) [-472.437] * (-472.753) (-479.306) (-476.619) [-478.550] -- 0:00:53
116000 -- [-472.699] (-474.851) (-473.853) (-474.510) * (-473.725) (-472.772) (-480.900) [-478.093] -- 0:00:53
116500 -- [-472.675] (-473.553) (-475.900) (-472.727) * (-474.825) [-473.522] (-483.141) (-474.724) -- 0:00:53
117000 -- (-473.865) (-472.994) [-474.964] (-482.292) * (-474.313) (-475.333) (-476.092) [-479.494] -- 0:00:52
117500 -- (-473.096) (-473.085) (-474.584) [-473.522] * (-473.387) (-474.569) (-473.434) [-473.039] -- 0:00:52
118000 -- (-477.125) (-473.324) [-474.054] (-474.490) * [-475.182] (-474.071) (-473.392) (-472.825) -- 0:00:52
118500 -- [-475.205] (-474.984) (-472.905) (-478.537) * [-472.485] (-474.548) (-473.888) (-473.321) -- 0:00:52
119000 -- (-475.194) (-475.060) (-474.451) [-473.071] * (-472.735) [-474.241] (-473.818) (-474.921) -- 0:00:51
119500 -- (-476.430) [-472.761] (-477.377) (-472.588) * (-475.093) (-476.722) [-472.572] (-478.160) -- 0:00:51
120000 -- (-475.711) [-476.101] (-473.276) (-475.175) * (-473.844) [-473.660] (-472.376) (-474.633) -- 0:00:51
Average standard deviation of split frequencies: 0.021178
120500 -- (-473.420) (-474.836) (-473.759) [-474.300] * (-476.724) [-473.158] (-473.699) (-473.875) -- 0:00:51
121000 -- (-475.621) (-477.365) [-476.505] (-474.496) * (-473.041) [-475.004] (-474.037) (-472.825) -- 0:00:50
121500 -- (-473.685) (-475.739) (-474.797) [-473.747] * [-473.919] (-474.694) (-472.524) (-473.477) -- 0:00:50
122000 -- (-472.339) (-477.416) [-472.367] (-474.319) * (-476.124) (-477.408) [-474.020] (-475.432) -- 0:00:50
122500 -- (-473.282) (-473.304) (-472.708) [-475.860] * [-476.610] (-473.701) (-473.575) (-474.091) -- 0:00:50
123000 -- (-474.897) (-476.363) (-474.261) [-472.887] * [-472.951] (-476.825) (-473.718) (-473.294) -- 0:00:49
123500 -- (-473.231) (-473.174) (-473.730) [-476.196] * (-477.532) [-472.534] (-473.172) (-474.419) -- 0:00:49
124000 -- (-475.072) [-473.721] (-477.782) (-473.878) * (-473.177) [-476.276] (-473.496) (-474.790) -- 0:00:49
124500 -- (-475.412) (-472.627) [-477.122] (-474.408) * [-473.724] (-474.046) (-477.854) (-479.277) -- 0:00:49
125000 -- (-473.337) (-474.848) [-476.696] (-473.968) * (-476.997) (-474.206) (-473.959) [-475.184] -- 0:00:49
Average standard deviation of split frequencies: 0.020488
125500 -- (-476.446) (-474.676) (-475.107) [-476.870] * [-473.930] (-472.716) (-475.185) (-474.707) -- 0:00:48
126000 -- (-475.995) (-474.997) (-477.973) [-472.805] * (-474.369) (-476.165) (-473.788) [-476.325] -- 0:00:48
126500 -- (-478.844) (-475.603) (-473.933) [-475.052] * (-478.596) (-472.321) (-478.528) [-473.190] -- 0:00:55
127000 -- [-473.113] (-473.691) (-473.366) (-473.765) * [-474.309] (-472.723) (-474.406) (-473.465) -- 0:00:54
127500 -- (-473.857) (-474.446) [-475.070] (-472.945) * [-477.925] (-472.619) (-473.387) (-474.133) -- 0:00:54
128000 -- (-473.068) [-473.605] (-475.925) (-473.521) * (-477.581) [-473.297] (-474.589) (-476.592) -- 0:00:54
128500 -- (-474.125) [-472.916] (-473.060) (-474.727) * [-476.651] (-478.068) (-475.475) (-473.346) -- 0:00:54
129000 -- (-473.713) [-475.035] (-476.002) (-473.207) * (-477.924) (-473.790) (-474.359) [-473.277] -- 0:00:54
129500 -- [-473.225] (-472.591) (-474.787) (-473.006) * (-479.865) [-477.684] (-472.703) (-473.868) -- 0:00:53
130000 -- (-475.560) (-472.955) (-475.873) [-472.372] * (-475.036) (-478.678) (-472.586) [-474.474] -- 0:00:53
Average standard deviation of split frequencies: 0.017678
130500 -- [-473.271] (-472.716) (-473.255) (-473.293) * [-477.829] (-477.613) (-472.544) (-474.053) -- 0:00:53
131000 -- (-474.405) (-473.565) [-473.611] (-473.268) * [-476.373] (-475.369) (-473.277) (-474.605) -- 0:00:53
131500 -- (-475.545) [-474.415] (-475.270) (-472.277) * [-475.090] (-474.590) (-474.005) (-474.996) -- 0:00:52
132000 -- (-473.518) (-475.462) (-472.813) [-473.646] * (-476.593) (-480.381) (-473.819) [-476.716] -- 0:00:52
132500 -- (-477.086) (-476.789) (-474.989) [-474.838] * [-478.742] (-477.488) (-473.919) (-472.907) -- 0:00:52
133000 -- (-476.347) [-475.087] (-473.862) (-475.547) * (-474.341) (-477.380) (-473.888) [-476.809] -- 0:00:52
133500 -- (-477.452) (-473.609) [-474.337] (-473.055) * (-479.535) (-475.013) [-476.328] (-475.630) -- 0:00:51
134000 -- [-473.047] (-473.014) (-472.480) (-478.985) * (-477.990) (-476.620) [-472.903] (-473.645) -- 0:00:51
134500 -- [-474.495] (-472.640) (-473.229) (-473.894) * (-472.589) (-477.679) (-473.825) [-473.989] -- 0:00:51
135000 -- [-474.975] (-477.195) (-475.144) (-474.705) * (-474.387) (-474.240) [-474.839] (-472.561) -- 0:00:51
Average standard deviation of split frequencies: 0.017331
135500 -- (-480.425) (-473.781) (-472.884) [-473.194] * (-472.425) (-476.348) [-472.912] (-474.292) -- 0:00:51
136000 -- [-473.251] (-474.194) (-477.086) (-473.128) * (-472.767) (-476.055) [-473.157] (-474.067) -- 0:00:50
136500 -- [-474.215] (-475.413) (-473.301) (-475.837) * (-473.972) [-476.818] (-473.388) (-475.508) -- 0:00:50
137000 -- (-472.774) (-475.635) [-473.323] (-475.322) * (-472.694) (-474.927) [-473.810] (-476.532) -- 0:00:50
137500 -- (-473.930) [-474.049] (-474.407) (-475.715) * (-472.778) (-472.897) (-473.102) [-475.771] -- 0:00:50
138000 -- (-474.542) (-473.486) [-475.350] (-475.652) * [-474.643] (-472.669) (-473.421) (-473.600) -- 0:00:49
138500 -- (-474.306) (-473.732) [-473.135] (-473.640) * (-474.913) (-473.183) [-472.718] (-475.903) -- 0:00:49
139000 -- (-477.644) (-474.985) [-472.913] (-472.750) * (-474.621) (-473.618) (-476.209) [-474.168] -- 0:00:49
139500 -- [-473.399] (-472.282) (-473.084) (-474.582) * (-476.174) [-472.785] (-473.506) (-475.208) -- 0:00:49
140000 -- (-476.055) (-478.164) (-473.706) [-474.219] * (-474.699) (-473.583) (-476.505) [-475.268] -- 0:00:49
Average standard deviation of split frequencies: 0.017761
140500 -- (-475.942) (-473.900) [-473.661] (-473.419) * (-476.365) (-472.943) [-473.733] (-478.341) -- 0:00:48
141000 -- [-474.067] (-478.739) (-477.795) (-475.224) * (-475.370) (-476.105) [-473.602] (-477.866) -- 0:00:48
141500 -- (-474.739) (-472.699) [-475.640] (-477.181) * (-475.266) [-473.643] (-475.521) (-476.885) -- 0:00:48
142000 -- (-475.951) (-472.350) [-477.468] (-473.627) * (-475.166) (-475.642) (-477.014) [-474.034] -- 0:00:48
142500 -- (-473.649) (-474.979) (-474.015) [-475.973] * (-473.995) (-474.293) (-475.371) [-477.723] -- 0:00:48
143000 -- (-478.164) (-475.447) [-475.618] (-473.147) * (-475.650) (-478.061) (-475.579) [-475.904] -- 0:00:47
143500 -- (-478.443) [-476.723] (-472.722) (-473.417) * (-478.403) [-476.481] (-473.539) (-473.913) -- 0:00:53
144000 -- (-472.903) (-475.724) (-472.313) [-472.397] * (-479.386) (-473.888) [-473.316] (-473.889) -- 0:00:53
144500 -- [-474.896] (-479.420) (-472.721) (-473.535) * (-479.208) (-481.291) [-474.201] (-475.113) -- 0:00:53
145000 -- (-477.932) (-476.498) [-476.894] (-473.259) * (-475.805) (-475.687) [-474.337] (-475.295) -- 0:00:53
Average standard deviation of split frequencies: 0.016951
145500 -- (-480.599) [-472.486] (-475.454) (-472.486) * (-477.549) (-474.237) [-475.011] (-472.379) -- 0:00:52
146000 -- (-473.401) [-473.269] (-473.376) (-473.898) * (-474.078) [-472.906] (-473.759) (-475.031) -- 0:00:52
146500 -- [-473.633] (-474.015) (-473.616) (-473.355) * [-476.626] (-472.849) (-479.000) (-479.056) -- 0:00:52
147000 -- (-476.116) (-473.367) (-476.146) [-478.314] * (-473.090) (-473.874) [-476.991] (-473.473) -- 0:00:52
147500 -- (-473.964) (-473.318) [-476.350] (-474.126) * (-476.898) (-473.387) [-477.860] (-472.930) -- 0:00:52
148000 -- (-477.488) [-473.853] (-473.023) (-473.004) * [-474.077] (-473.282) (-475.225) (-473.822) -- 0:00:51
148500 -- (-476.273) (-473.155) (-474.971) [-472.688] * (-474.045) (-474.027) (-476.077) [-475.890] -- 0:00:51
149000 -- (-474.172) [-472.934] (-473.877) (-472.672) * [-476.801] (-474.525) (-475.489) (-473.886) -- 0:00:51
149500 -- (-477.161) (-473.601) [-474.891] (-475.472) * (-478.065) (-473.326) (-476.144) [-475.536] -- 0:00:51
150000 -- (-476.006) (-473.804) (-472.925) [-475.574] * (-476.783) (-473.567) [-474.151] (-477.081) -- 0:00:51
Average standard deviation of split frequencies: 0.017134
150500 -- [-474.839] (-472.338) (-474.191) (-473.802) * (-475.088) [-475.938] (-475.324) (-472.842) -- 0:00:50
151000 -- (-476.099) (-474.239) [-473.306] (-476.928) * (-473.838) (-476.135) (-474.573) [-473.874] -- 0:00:50
151500 -- (-476.822) (-474.492) [-473.997] (-476.649) * (-474.389) [-474.236] (-473.203) (-474.275) -- 0:00:50
152000 -- (-475.500) [-475.646] (-474.253) (-474.426) * (-475.738) [-473.040] (-475.096) (-473.273) -- 0:00:50
152500 -- [-473.329] (-472.623) (-472.618) (-476.561) * (-481.501) (-476.008) (-477.100) [-475.065] -- 0:00:50
153000 -- (-475.301) (-472.838) [-473.765] (-474.531) * (-474.871) [-472.799] (-472.994) (-475.083) -- 0:00:49
153500 -- (-479.070) [-472.318] (-475.113) (-478.982) * [-473.034] (-474.428) (-476.748) (-475.499) -- 0:00:49
154000 -- [-475.605] (-476.424) (-475.217) (-474.537) * [-475.368] (-477.881) (-475.604) (-473.695) -- 0:00:49
154500 -- (-475.592) (-474.180) [-474.293] (-474.025) * (-476.444) [-475.395] (-472.531) (-473.254) -- 0:00:49
155000 -- (-473.210) (-476.899) (-473.856) [-475.925] * [-473.926] (-475.106) (-474.392) (-476.321) -- 0:00:49
Average standard deviation of split frequencies: 0.016063
155500 -- [-476.598] (-474.695) (-473.863) (-475.571) * (-476.948) (-474.496) [-473.465] (-473.423) -- 0:00:48
156000 -- [-472.355] (-477.087) (-473.472) (-479.316) * (-475.262) [-474.097] (-474.759) (-476.992) -- 0:00:48
156500 -- [-474.636] (-477.351) (-472.872) (-479.461) * (-473.516) (-475.472) (-474.108) [-473.904] -- 0:00:48
157000 -- (-474.885) (-475.118) (-476.399) [-477.337] * (-476.472) [-474.838] (-475.267) (-473.945) -- 0:00:48
157500 -- (-475.005) (-473.577) (-475.401) [-475.697] * (-472.882) (-473.218) [-476.333] (-476.272) -- 0:00:48
158000 -- (-476.793) (-477.483) [-475.878] (-478.385) * (-475.838) [-475.083] (-474.949) (-478.973) -- 0:00:47
158500 -- (-476.628) (-477.833) [-474.168] (-473.482) * (-473.212) (-475.098) (-473.965) [-475.116] -- 0:00:47
159000 -- (-476.154) (-475.522) [-474.539] (-473.348) * [-473.287] (-473.384) (-476.536) (-474.071) -- 0:00:47
159500 -- [-477.225] (-473.260) (-474.316) (-475.523) * [-472.399] (-475.114) (-474.129) (-473.111) -- 0:00:47
160000 -- (-473.312) [-474.056] (-476.092) (-474.496) * (-472.932) (-475.065) [-474.647] (-473.151) -- 0:00:47
Average standard deviation of split frequencies: 0.016832
160500 -- (-476.821) (-474.550) (-474.801) [-476.743] * (-473.921) [-474.946] (-476.234) (-475.497) -- 0:00:52
161000 -- (-474.223) (-475.327) (-476.779) [-474.012] * (-473.952) (-474.668) (-480.521) [-474.165] -- 0:00:52
161500 -- [-476.095] (-473.819) (-473.587) (-473.590) * (-476.819) (-475.661) (-476.194) [-472.834] -- 0:00:51
162000 -- (-475.436) (-473.533) [-472.414] (-473.079) * (-480.466) [-473.864] (-472.539) (-472.943) -- 0:00:51
162500 -- (-476.022) (-475.093) [-475.472] (-480.291) * (-483.883) (-479.199) [-474.549] (-473.992) -- 0:00:51
163000 -- (-473.761) [-473.362] (-475.045) (-473.800) * (-475.362) (-473.851) (-476.817) [-473.495] -- 0:00:51
163500 -- [-475.935] (-473.541) (-476.704) (-473.092) * (-477.111) [-472.289] (-479.515) (-479.231) -- 0:00:51
164000 -- (-472.524) [-473.345] (-473.752) (-473.949) * (-473.656) (-477.731) (-475.928) [-475.500] -- 0:00:50
164500 -- (-473.344) [-476.285] (-475.271) (-474.102) * [-473.658] (-478.889) (-473.971) (-475.728) -- 0:00:50
165000 -- (-475.726) (-477.132) (-475.193) [-476.307] * (-473.478) (-473.955) [-474.479] (-474.532) -- 0:00:50
Average standard deviation of split frequencies: 0.014348
165500 -- (-482.203) [-473.766] (-474.439) (-473.946) * (-472.050) (-474.682) [-474.500] (-473.063) -- 0:00:50
166000 -- (-475.562) [-473.471] (-474.986) (-474.477) * (-473.555) (-474.392) (-474.875) [-474.728] -- 0:00:50
166500 -- (-475.733) [-474.543] (-476.763) (-475.129) * (-473.567) (-472.999) [-475.221] (-474.372) -- 0:00:50
167000 -- [-477.038] (-478.255) (-472.363) (-477.013) * [-474.424] (-473.850) (-476.848) (-473.491) -- 0:00:49
167500 -- (-473.748) [-474.976] (-473.485) (-474.599) * (-473.503) (-472.939) (-475.847) [-472.919] -- 0:00:49
168000 -- (-476.184) (-474.193) [-473.134] (-474.788) * [-473.281] (-472.352) (-475.203) (-474.030) -- 0:00:49
168500 -- (-472.372) [-473.359] (-474.926) (-474.714) * [-472.801] (-476.138) (-472.682) (-473.439) -- 0:00:49
169000 -- [-472.970] (-474.162) (-475.052) (-475.542) * [-476.280] (-477.719) (-474.608) (-473.106) -- 0:00:49
169500 -- [-473.215] (-474.178) (-473.846) (-477.885) * (-474.409) (-475.802) (-475.791) [-473.048] -- 0:00:48
170000 -- [-472.708] (-473.171) (-475.202) (-476.652) * (-472.949) (-477.601) (-477.712) [-472.742] -- 0:00:48
Average standard deviation of split frequencies: 0.014885
170500 -- (-476.354) (-475.683) [-475.517] (-473.963) * (-473.127) [-473.673] (-475.318) (-473.564) -- 0:00:48
171000 -- [-473.432] (-473.364) (-475.188) (-474.788) * (-477.167) (-473.574) (-473.317) [-473.195] -- 0:00:48
171500 -- (-473.165) (-473.681) (-474.092) [-474.871] * [-475.825] (-477.219) (-474.172) (-475.943) -- 0:00:48
172000 -- (-472.698) (-472.748) (-475.266) [-474.350] * (-476.850) (-474.297) (-472.694) [-473.521] -- 0:00:48
172500 -- (-480.049) (-473.180) (-475.650) [-475.483] * (-473.370) (-475.707) (-474.678) [-476.224] -- 0:00:47
173000 -- (-472.517) [-472.320] (-476.008) (-473.430) * (-473.306) [-478.021] (-476.785) (-473.836) -- 0:00:47
173500 -- (-475.101) (-476.269) (-475.936) [-476.963] * [-473.129] (-475.559) (-475.821) (-474.447) -- 0:00:47
174000 -- [-474.241] (-473.723) (-476.435) (-478.030) * (-472.985) [-474.198] (-474.536) (-473.723) -- 0:00:47
174500 -- [-472.499] (-481.724) (-475.740) (-474.850) * (-477.816) (-473.812) [-473.684] (-474.253) -- 0:00:47
175000 -- (-473.234) (-474.224) [-472.953] (-473.576) * (-474.731) (-477.299) (-475.291) [-472.546] -- 0:00:47
Average standard deviation of split frequencies: 0.013541
175500 -- (-474.760) (-473.618) [-475.051] (-472.618) * (-472.510) (-474.138) (-475.546) [-472.848] -- 0:00:46
176000 -- (-473.085) (-476.229) (-475.914) [-473.278] * (-476.333) (-476.561) (-481.173) [-475.051] -- 0:00:46
176500 -- [-472.234] (-477.918) (-474.463) (-474.045) * (-482.499) (-477.562) [-478.574] (-481.609) -- 0:00:46
177000 -- (-472.895) (-474.676) (-473.814) [-474.002] * (-474.297) (-473.884) [-475.786] (-476.695) -- 0:00:46
177500 -- [-472.816] (-478.756) (-477.089) (-475.564) * (-474.178) (-473.949) (-473.000) [-475.247] -- 0:00:50
178000 -- [-474.678] (-473.986) (-472.357) (-474.534) * (-472.545) (-473.557) [-472.452] (-472.914) -- 0:00:50
178500 -- (-473.682) (-474.859) [-473.916] (-476.056) * (-474.125) (-474.371) (-473.252) [-472.214] -- 0:00:50
179000 -- (-478.371) (-476.196) [-473.825] (-476.697) * (-473.731) [-476.103] (-477.512) (-476.585) -- 0:00:50
179500 -- (-475.216) (-475.056) (-476.367) [-476.917] * [-473.165] (-478.024) (-476.332) (-477.398) -- 0:00:50
180000 -- [-473.148] (-474.498) (-474.633) (-480.121) * (-476.677) (-475.738) [-474.099] (-472.549) -- 0:00:50
Average standard deviation of split frequencies: 0.013916
180500 -- [-473.156] (-472.409) (-476.313) (-473.694) * (-474.014) (-474.434) (-474.189) [-473.444] -- 0:00:49
181000 -- [-473.289] (-475.636) (-476.759) (-474.812) * (-474.976) (-473.280) [-476.674] (-472.962) -- 0:00:49
181500 -- (-472.871) [-477.904] (-474.978) (-476.442) * (-475.390) (-473.219) (-475.401) [-475.639] -- 0:00:49
182000 -- [-474.581] (-475.056) (-478.899) (-473.178) * (-473.833) (-472.534) [-473.994] (-472.930) -- 0:00:49
182500 -- [-473.024] (-476.435) (-478.274) (-482.798) * (-474.910) (-474.287) [-476.117] (-474.638) -- 0:00:49
183000 -- [-474.405] (-478.922) (-475.540) (-475.942) * (-472.583) (-472.249) [-473.882] (-476.682) -- 0:00:49
183500 -- (-478.036) [-474.982] (-473.531) (-480.023) * [-474.148] (-472.563) (-475.476) (-473.587) -- 0:00:48
184000 -- (-473.923) (-472.669) (-474.192) [-477.530] * (-475.632) (-472.402) (-478.124) [-474.140] -- 0:00:48
184500 -- (-475.096) [-473.727] (-475.037) (-479.826) * (-476.199) [-472.934] (-477.863) (-475.228) -- 0:00:48
185000 -- (-474.828) [-473.217] (-474.744) (-474.559) * (-474.805) [-473.224] (-482.226) (-473.769) -- 0:00:48
Average standard deviation of split frequencies: 0.014673
185500 -- (-473.142) (-473.984) [-474.890] (-475.320) * (-475.134) [-472.608] (-474.606) (-475.169) -- 0:00:48
186000 -- [-472.719] (-474.138) (-475.582) (-481.328) * (-472.686) [-475.514] (-474.532) (-476.394) -- 0:00:48
186500 -- [-477.094] (-476.526) (-475.725) (-473.154) * (-473.441) (-474.600) [-473.654] (-474.568) -- 0:00:47
187000 -- (-473.981) (-474.131) [-474.054] (-475.374) * [-472.483] (-474.085) (-476.315) (-476.850) -- 0:00:47
187500 -- (-475.518) [-476.238] (-473.486) (-473.811) * [-474.759] (-475.121) (-476.455) (-473.502) -- 0:00:47
188000 -- (-473.333) (-474.836) (-473.901) [-474.165] * (-473.792) (-475.904) (-473.853) [-473.826] -- 0:00:47
188500 -- (-474.601) [-474.512] (-474.720) (-473.014) * [-476.515] (-473.540) (-477.524) (-473.405) -- 0:00:47
189000 -- (-478.639) [-473.365] (-472.896) (-473.401) * (-474.791) (-475.820) (-474.336) [-474.032] -- 0:00:47
189500 -- (-474.677) (-475.471) (-474.311) [-473.228] * (-476.038) (-473.058) [-473.544] (-473.081) -- 0:00:47
190000 -- (-473.319) [-478.424] (-474.492) (-474.678) * (-474.833) [-475.471] (-475.668) (-473.590) -- 0:00:46
Average standard deviation of split frequencies: 0.014965
190500 -- (-473.335) (-473.553) [-474.478] (-475.244) * (-474.906) (-473.041) (-474.770) [-472.208] -- 0:00:46
191000 -- (-473.476) (-472.719) [-473.558] (-473.527) * (-475.080) (-476.402) [-478.000] (-473.471) -- 0:00:46
191500 -- (-473.957) [-473.723] (-475.234) (-474.772) * (-472.839) (-477.589) (-474.198) [-473.508] -- 0:00:46
192000 -- (-473.419) [-474.226] (-475.255) (-476.091) * [-475.536] (-477.065) (-473.989) (-476.136) -- 0:00:46
192500 -- (-474.555) (-473.690) (-475.913) [-473.265] * (-477.891) (-473.890) (-478.832) [-473.995] -- 0:00:46
193000 -- (-472.808) [-477.220] (-475.633) (-473.613) * [-475.101] (-473.551) (-472.356) (-479.386) -- 0:00:45
193500 -- (-472.660) (-474.154) (-476.822) [-474.063] * (-476.076) (-477.671) [-473.278] (-477.307) -- 0:00:45
194000 -- (-474.049) (-475.512) [-474.588] (-472.338) * (-473.567) (-474.642) [-473.197] (-475.171) -- 0:00:45
194500 -- (-472.873) (-474.616) [-473.093] (-473.926) * (-473.833) (-485.790) [-477.081] (-475.381) -- 0:00:45
195000 -- (-476.226) [-476.217] (-475.583) (-474.185) * (-475.406) [-476.258] (-474.393) (-477.124) -- 0:00:49
Average standard deviation of split frequencies: 0.015190
195500 -- [-474.405] (-473.980) (-472.521) (-476.322) * (-475.179) [-473.627] (-474.069) (-480.233) -- 0:00:49
196000 -- (-477.045) [-472.655] (-477.715) (-476.277) * (-474.389) [-473.791] (-473.889) (-476.606) -- 0:00:49
196500 -- (-475.807) [-474.899] (-475.959) (-473.765) * (-478.884) (-472.590) [-472.931] (-476.179) -- 0:00:49
197000 -- (-474.632) (-476.665) (-475.114) [-473.115] * (-473.248) [-473.784] (-473.508) (-474.687) -- 0:00:48
197500 -- (-476.282) [-473.122] (-477.126) (-472.520) * [-475.674] (-475.645) (-474.489) (-476.658) -- 0:00:48
198000 -- (-477.584) (-475.745) [-474.258] (-473.534) * (-474.866) (-473.974) (-472.993) [-474.540] -- 0:00:48
198500 -- (-473.541) (-476.165) [-475.004] (-475.958) * (-473.675) (-472.960) [-478.462] (-478.176) -- 0:00:48
199000 -- (-476.728) (-473.454) (-476.318) [-474.415] * (-475.368) (-472.806) [-477.375] (-476.038) -- 0:00:48
199500 -- [-473.047] (-475.572) (-477.285) (-474.913) * (-475.699) [-473.029] (-474.083) (-475.627) -- 0:00:48
200000 -- (-474.092) [-475.487] (-479.410) (-472.648) * (-473.256) (-475.846) (-474.920) [-479.563] -- 0:00:48
Average standard deviation of split frequencies: 0.014961
200500 -- (-473.568) (-476.473) [-474.048] (-473.747) * (-472.843) [-473.410] (-474.104) (-474.396) -- 0:00:47
201000 -- (-476.133) (-477.272) (-473.064) [-474.583] * (-476.043) (-474.708) (-475.967) [-473.713] -- 0:00:47
201500 -- (-472.607) (-475.621) [-474.494] (-474.939) * (-476.144) (-475.899) [-473.324] (-473.774) -- 0:00:47
202000 -- (-476.800) [-473.061] (-478.040) (-473.791) * [-477.592] (-474.710) (-472.979) (-475.419) -- 0:00:47
202500 -- (-475.937) (-474.409) (-477.211) [-473.745] * (-480.706) [-483.207] (-474.762) (-473.254) -- 0:00:47
203000 -- (-474.453) (-475.173) [-473.863] (-474.976) * (-480.481) (-477.283) [-473.564] (-479.551) -- 0:00:47
203500 -- (-476.668) (-474.930) [-473.227] (-475.977) * [-473.517] (-475.050) (-473.856) (-479.365) -- 0:00:46
204000 -- [-474.784] (-474.351) (-474.741) (-475.042) * (-477.363) [-475.331] (-474.007) (-473.574) -- 0:00:46
204500 -- (-473.188) (-474.705) (-475.441) [-476.024] * (-473.262) (-475.169) (-472.807) [-476.122] -- 0:00:46
205000 -- (-476.291) (-476.168) (-479.373) [-474.220] * (-473.239) (-482.181) [-473.165] (-472.834) -- 0:00:46
Average standard deviation of split frequencies: 0.015904
205500 -- (-476.972) [-476.271] (-473.814) (-477.434) * [-475.570] (-479.286) (-473.002) (-477.383) -- 0:00:46
206000 -- (-473.056) (-473.806) (-475.593) [-475.025] * (-475.605) (-481.760) (-472.365) [-473.768] -- 0:00:46
206500 -- (-476.189) (-474.128) (-476.778) [-474.497] * [-475.600] (-476.115) (-473.652) (-474.390) -- 0:00:46
207000 -- (-476.793) [-473.629] (-472.948) (-475.934) * (-473.443) (-474.699) [-473.866] (-473.658) -- 0:00:45
207500 -- (-473.387) (-473.707) [-473.928] (-475.487) * (-472.360) (-475.015) (-473.311) [-472.453] -- 0:00:45
208000 -- [-473.083] (-474.940) (-473.850) (-474.934) * (-475.776) (-475.674) [-473.042] (-474.950) -- 0:00:45
208500 -- [-474.158] (-475.353) (-480.251) (-474.296) * (-473.217) (-474.581) (-477.974) [-474.798] -- 0:00:45
209000 -- (-477.191) (-473.604) (-474.979) [-474.402] * [-477.338] (-472.506) (-474.361) (-474.460) -- 0:00:45
209500 -- (-477.468) (-474.291) [-474.884] (-473.464) * (-472.839) (-472.703) (-472.908) [-472.350] -- 0:00:45
210000 -- (-474.722) (-474.691) [-476.955] (-473.437) * [-475.887] (-473.572) (-473.463) (-473.852) -- 0:00:45
Average standard deviation of split frequencies: 0.015888
210500 -- (-476.520) (-473.627) [-473.238] (-473.391) * (-477.487) [-475.543] (-476.339) (-475.206) -- 0:00:45
211000 -- (-473.138) (-475.112) (-473.587) [-476.217] * (-473.177) (-476.205) (-474.730) [-475.254] -- 0:00:44
211500 -- (-474.388) (-474.808) (-475.786) [-472.920] * [-473.168] (-474.079) (-475.273) (-473.862) -- 0:00:48
212000 -- (-476.782) [-474.154] (-477.535) (-474.662) * [-475.060] (-475.283) (-475.371) (-473.579) -- 0:00:48
212500 -- (-473.289) (-473.608) [-475.970] (-474.638) * (-474.414) (-476.527) [-472.448] (-474.120) -- 0:00:48
213000 -- (-473.857) (-473.023) (-475.002) [-475.638] * (-477.128) (-472.667) [-474.665] (-474.251) -- 0:00:48
213500 -- (-473.074) (-474.153) [-478.125] (-473.103) * (-474.916) (-474.160) (-476.122) [-475.503] -- 0:00:47
214000 -- (-476.565) (-473.088) [-473.916] (-474.049) * (-473.754) [-475.301] (-474.633) (-473.444) -- 0:00:47
214500 -- (-476.357) (-474.741) [-474.422] (-473.587) * (-474.157) (-475.665) [-472.583] (-472.804) -- 0:00:47
215000 -- (-474.043) (-477.279) (-475.804) [-473.631] * (-475.253) (-472.442) [-476.920] (-472.474) -- 0:00:47
Average standard deviation of split frequencies: 0.017132
215500 -- (-474.223) (-474.695) [-477.060] (-477.155) * (-474.590) (-472.880) [-474.039] (-473.667) -- 0:00:47
216000 -- [-473.076] (-474.765) (-475.519) (-474.483) * (-474.668) [-472.962] (-474.110) (-472.734) -- 0:00:47
216500 -- (-476.456) [-475.975] (-473.660) (-475.648) * (-474.094) (-472.786) [-472.750] (-473.972) -- 0:00:47
217000 -- [-473.036] (-476.526) (-477.330) (-477.486) * (-473.336) (-478.810) [-473.186] (-474.479) -- 0:00:46
217500 -- (-478.245) (-476.829) [-474.423] (-475.150) * (-474.138) [-476.410] (-478.335) (-474.489) -- 0:00:46
218000 -- (-479.215) (-474.374) [-473.071] (-475.867) * (-473.096) (-475.009) [-474.384] (-473.535) -- 0:00:46
218500 -- (-480.338) (-475.328) [-473.723] (-474.571) * (-475.935) (-482.856) [-474.103] (-475.043) -- 0:00:46
219000 -- (-478.340) (-477.638) (-478.400) [-474.743] * (-473.563) [-479.032] (-473.258) (-474.169) -- 0:00:46
219500 -- [-475.385] (-473.800) (-473.771) (-474.752) * (-472.644) [-475.811] (-473.813) (-475.928) -- 0:00:46
220000 -- (-473.114) (-476.007) (-475.053) [-474.344] * (-475.427) (-473.123) [-474.273] (-475.836) -- 0:00:46
Average standard deviation of split frequencies: 0.016303
220500 -- (-475.298) (-476.207) [-473.599] (-473.851) * [-477.170] (-473.948) (-475.046) (-476.045) -- 0:00:45
221000 -- (-475.150) (-474.448) [-474.220] (-473.446) * (-478.646) (-475.588) (-477.306) [-472.438] -- 0:00:45
221500 -- (-476.339) [-474.384] (-473.244) (-473.519) * (-475.689) (-477.372) [-472.534] (-472.251) -- 0:00:45
222000 -- (-475.789) (-473.973) [-474.595] (-478.005) * [-474.143] (-474.223) (-479.902) (-475.011) -- 0:00:45
222500 -- (-478.371) (-475.218) (-472.900) [-474.659] * (-478.298) (-473.660) (-474.961) [-474.225] -- 0:00:45
223000 -- [-474.249] (-472.705) (-477.175) (-477.665) * (-475.589) (-474.915) [-475.133] (-474.119) -- 0:00:45
223500 -- (-475.315) (-479.911) [-475.799] (-473.497) * (-473.472) (-474.013) [-473.053] (-475.776) -- 0:00:45
224000 -- (-474.722) (-474.639) (-474.924) [-472.889] * (-473.644) (-479.117) [-479.230] (-475.075) -- 0:00:45
224500 -- (-473.879) [-473.396] (-475.042) (-475.700) * [-473.857] (-476.794) (-475.679) (-474.347) -- 0:00:44
225000 -- [-472.391] (-473.454) (-473.569) (-477.560) * (-474.779) [-474.009] (-472.846) (-475.039) -- 0:00:44
Average standard deviation of split frequencies: 0.015957
225500 -- (-476.343) (-477.531) [-473.462] (-479.726) * (-475.499) [-473.979] (-473.522) (-477.616) -- 0:00:44
226000 -- [-476.388] (-476.022) (-473.078) (-477.267) * [-473.059] (-473.842) (-475.913) (-473.657) -- 0:00:44
226500 -- [-476.050] (-476.196) (-476.171) (-473.716) * [-474.261] (-475.651) (-473.777) (-484.656) -- 0:00:44
227000 -- (-476.814) [-473.432] (-474.405) (-476.742) * (-476.133) (-476.855) [-475.505] (-476.081) -- 0:00:44
227500 -- (-473.693) (-473.084) (-473.908) [-473.388] * [-475.920] (-472.414) (-474.389) (-472.764) -- 0:00:44
228000 -- [-475.129] (-473.755) (-473.270) (-473.822) * (-475.691) (-475.905) (-473.172) [-473.819] -- 0:00:44
228500 -- (-474.352) (-474.894) (-472.856) [-472.896] * (-473.390) [-481.930] (-476.056) (-473.141) -- 0:00:47
229000 -- (-474.399) (-473.241) (-473.352) [-472.593] * (-472.772) (-483.623) (-474.531) [-476.175] -- 0:00:47
229500 -- (-473.156) (-472.729) [-474.458] (-476.700) * (-473.751) (-473.744) (-474.169) [-474.388] -- 0:00:47
230000 -- (-473.522) (-474.355) [-477.023] (-474.774) * (-473.860) (-474.545) [-475.178] (-475.266) -- 0:00:46
Average standard deviation of split frequencies: 0.017065
230500 -- (-473.805) (-472.993) [-479.278] (-481.275) * (-476.001) (-476.659) [-473.505] (-476.793) -- 0:00:46
231000 -- (-477.292) (-475.808) (-474.601) [-476.363] * (-475.373) (-472.901) [-479.753] (-475.078) -- 0:00:46
231500 -- [-472.472] (-475.623) (-474.067) (-476.053) * [-476.069] (-474.260) (-477.387) (-473.410) -- 0:00:46
232000 -- (-474.869) (-474.725) [-476.958] (-472.854) * (-472.990) (-474.527) (-476.854) [-476.722] -- 0:00:46
232500 -- (-475.283) (-474.753) (-475.895) [-474.632] * (-473.923) (-474.960) [-475.156] (-478.152) -- 0:00:46
233000 -- [-473.362] (-474.115) (-474.753) (-475.478) * [-476.250] (-472.576) (-475.752) (-475.537) -- 0:00:46
233500 -- [-473.001] (-475.583) (-478.269) (-474.036) * [-472.632] (-473.509) (-477.018) (-475.660) -- 0:00:45
234000 -- (-474.362) [-473.126] (-475.292) (-474.038) * (-476.092) [-472.897] (-473.253) (-473.198) -- 0:00:45
234500 -- (-473.826) (-474.190) (-474.797) [-473.580] * (-474.266) (-474.564) [-475.561] (-474.957) -- 0:00:45
235000 -- (-474.234) (-473.789) [-476.759] (-476.863) * (-476.646) (-472.617) [-475.502] (-475.660) -- 0:00:45
Average standard deviation of split frequencies: 0.017662
235500 -- (-478.313) (-475.289) [-473.317] (-473.473) * [-473.322] (-476.230) (-473.161) (-472.893) -- 0:00:45
236000 -- (-473.906) (-477.599) [-472.485] (-472.632) * (-474.250) (-472.730) [-473.740] (-474.588) -- 0:00:45
236500 -- (-473.709) [-472.578] (-476.287) (-474.627) * (-475.247) [-472.642] (-473.967) (-474.899) -- 0:00:45
237000 -- [-474.114] (-473.005) (-473.690) (-474.666) * (-473.774) [-473.444] (-474.809) (-473.947) -- 0:00:45
237500 -- (-473.079) [-473.738] (-473.098) (-472.997) * (-472.932) (-473.744) [-473.547] (-474.306) -- 0:00:44
238000 -- [-472.702] (-481.317) (-476.912) (-473.018) * (-473.560) (-472.629) (-474.196) [-473.346] -- 0:00:44
238500 -- [-472.500] (-477.402) (-473.258) (-474.984) * (-475.023) (-473.055) [-474.380] (-474.785) -- 0:00:44
239000 -- (-474.205) [-472.996] (-475.210) (-474.390) * (-473.120) (-475.777) (-473.423) [-473.087] -- 0:00:44
239500 -- (-475.792) (-475.086) [-475.933] (-473.389) * (-473.833) (-475.589) [-474.067] (-478.052) -- 0:00:44
240000 -- [-473.606] (-473.243) (-474.582) (-473.642) * (-485.498) (-475.545) (-474.356) [-476.348] -- 0:00:44
Average standard deviation of split frequencies: 0.017732
240500 -- (-475.561) (-473.292) [-475.288] (-474.936) * [-476.352] (-476.279) (-475.328) (-475.938) -- 0:00:44
241000 -- (-475.359) (-472.147) [-474.195] (-475.227) * (-480.299) (-473.804) (-476.560) [-477.077] -- 0:00:44
241500 -- (-473.467) (-473.972) [-473.618] (-474.547) * (-474.882) (-473.332) [-473.347] (-478.869) -- 0:00:43
242000 -- [-474.084] (-475.025) (-475.109) (-472.930) * [-476.626] (-473.052) (-473.924) (-475.663) -- 0:00:43
242500 -- [-474.286] (-474.351) (-473.125) (-475.763) * (-479.007) (-478.949) [-477.892] (-474.223) -- 0:00:43
243000 -- (-474.713) (-473.631) [-477.299] (-473.338) * (-474.283) (-476.277) (-478.288) [-472.850] -- 0:00:43
243500 -- (-474.434) [-476.054] (-478.894) (-472.820) * (-477.535) (-474.224) (-476.182) [-477.765] -- 0:00:43
244000 -- [-482.182] (-476.892) (-476.830) (-473.499) * (-472.400) (-474.772) [-473.867] (-473.982) -- 0:00:43
244500 -- (-474.690) (-474.482) (-476.992) [-475.656] * [-473.846] (-474.698) (-473.463) (-475.924) -- 0:00:43
245000 -- (-474.451) [-477.790] (-479.411) (-472.798) * (-476.469) (-473.407) [-474.140] (-478.891) -- 0:00:43
Average standard deviation of split frequencies: 0.016767
245500 -- (-472.748) (-480.187) [-475.591] (-472.559) * (-479.081) [-476.222] (-472.915) (-477.411) -- 0:00:46
246000 -- (-473.705) [-479.509] (-477.504) (-475.653) * (-475.184) (-477.303) [-476.321] (-477.058) -- 0:00:45
246500 -- (-476.452) (-474.855) [-474.999] (-473.457) * [-472.733] (-473.781) (-472.736) (-477.808) -- 0:00:45
247000 -- (-474.294) [-474.125] (-473.225) (-473.953) * [-474.810] (-472.964) (-474.062) (-473.490) -- 0:00:45
247500 -- [-473.146] (-474.622) (-475.040) (-472.998) * (-474.567) (-474.328) (-476.481) [-472.897] -- 0:00:45
248000 -- (-476.155) (-473.521) (-474.647) [-474.227] * (-473.506) (-475.395) [-474.332] (-473.173) -- 0:00:45
248500 -- (-480.027) (-474.108) [-474.872] (-472.875) * (-473.802) (-474.977) (-474.236) [-473.898] -- 0:00:45
249000 -- [-472.792] (-474.563) (-474.114) (-474.407) * (-473.877) [-475.384] (-472.306) (-474.810) -- 0:00:45
249500 -- [-472.844] (-474.722) (-475.607) (-479.201) * [-473.515] (-476.096) (-480.558) (-472.415) -- 0:00:45
250000 -- (-476.519) [-473.602] (-473.511) (-476.281) * [-473.875] (-473.107) (-473.782) (-474.812) -- 0:00:45
Average standard deviation of split frequencies: 0.015233
250500 -- (-479.975) (-481.658) (-477.453) [-474.176] * (-474.517) (-478.253) [-472.687] (-475.399) -- 0:00:44
251000 -- (-477.268) (-476.194) (-474.075) [-475.763] * [-472.991] (-475.846) (-472.576) (-475.603) -- 0:00:44
251500 -- (-479.733) (-475.386) (-474.419) [-475.523] * (-474.928) (-478.815) (-472.301) [-477.109] -- 0:00:44
252000 -- (-477.421) (-474.699) (-476.467) [-474.618] * (-475.501) (-473.609) (-472.941) [-473.392] -- 0:00:44
252500 -- (-475.095) (-474.708) (-474.865) [-477.353] * (-475.634) (-472.429) [-476.841] (-474.836) -- 0:00:44
253000 -- (-474.463) [-473.463] (-477.103) (-473.005) * [-474.823] (-473.618) (-476.990) (-473.571) -- 0:00:44
253500 -- (-475.185) [-475.307] (-473.535) (-474.779) * [-473.520] (-473.528) (-475.212) (-474.207) -- 0:00:44
254000 -- (-477.741) (-477.006) (-473.038) [-473.510] * (-473.407) (-474.952) [-473.331] (-475.987) -- 0:00:44
254500 -- [-474.260] (-472.713) (-475.325) (-473.564) * (-473.840) (-473.773) [-474.988] (-473.762) -- 0:00:43
255000 -- (-475.536) (-476.629) (-475.629) [-472.607] * (-475.063) [-474.363] (-478.120) (-472.869) -- 0:00:43
Average standard deviation of split frequencies: 0.016282
255500 -- (-476.703) (-477.275) (-476.551) [-472.755] * (-475.270) (-475.928) [-473.957] (-473.334) -- 0:00:43
256000 -- (-479.189) (-473.826) (-472.130) [-473.813] * (-473.056) [-473.505] (-475.727) (-476.116) -- 0:00:43
256500 -- (-473.671) (-473.025) [-472.087] (-474.710) * (-473.525) (-473.469) [-473.022] (-472.671) -- 0:00:43
257000 -- (-474.640) (-474.698) [-474.320] (-476.348) * (-476.627) [-474.814] (-474.008) (-474.991) -- 0:00:43
257500 -- (-475.327) (-477.000) [-472.584] (-472.737) * [-472.963] (-474.868) (-477.303) (-473.857) -- 0:00:43
258000 -- (-474.796) (-476.126) (-474.346) [-472.794] * (-474.199) (-478.657) [-478.101] (-475.047) -- 0:00:43
258500 -- (-476.329) (-479.154) [-476.221] (-474.652) * (-473.158) (-473.841) [-476.865] (-477.023) -- 0:00:43
259000 -- [-475.211] (-480.344) (-476.485) (-475.828) * (-475.518) (-475.484) [-475.362] (-473.731) -- 0:00:42
259500 -- [-474.290] (-481.099) (-475.487) (-475.157) * (-474.347) (-473.221) [-473.930] (-477.614) -- 0:00:42
260000 -- (-474.986) (-473.950) (-476.312) [-474.138] * (-476.048) [-472.892] (-476.806) (-474.681) -- 0:00:42
Average standard deviation of split frequencies: 0.015673
260500 -- (-476.043) (-474.208) [-473.226] (-473.098) * (-473.576) [-474.085] (-478.543) (-475.327) -- 0:00:42
261000 -- (-474.984) (-473.065) (-472.987) [-475.786] * (-474.608) (-475.552) (-476.620) [-476.080] -- 0:00:42
261500 -- (-473.630) [-475.159] (-473.525) (-477.611) * (-472.153) [-479.203] (-475.823) (-474.003) -- 0:00:42
262000 -- (-475.544) [-472.887] (-478.725) (-474.021) * (-472.154) (-473.633) [-472.908] (-479.124) -- 0:00:42
262500 -- [-472.777] (-475.013) (-473.373) (-474.408) * (-472.688) (-474.401) [-472.377] (-474.865) -- 0:00:44
263000 -- (-472.723) (-474.411) (-473.576) [-473.755] * (-472.872) (-475.049) [-473.461] (-473.614) -- 0:00:44
263500 -- (-473.364) (-475.780) [-472.309] (-473.129) * (-476.215) [-473.692] (-477.804) (-473.994) -- 0:00:44
264000 -- [-474.175] (-474.753) (-472.267) (-474.488) * (-473.863) (-472.876) [-472.802] (-476.147) -- 0:00:44
264500 -- [-475.081] (-474.651) (-475.099) (-476.845) * (-472.271) (-473.582) (-475.129) [-472.973] -- 0:00:44
265000 -- (-474.512) (-474.311) [-477.067] (-473.925) * [-473.270] (-476.961) (-474.905) (-474.435) -- 0:00:44
Average standard deviation of split frequencies: 0.016481
265500 -- [-472.822] (-474.850) (-474.177) (-472.846) * (-473.589) (-476.051) [-472.448] (-476.926) -- 0:00:44
266000 -- (-475.209) (-473.579) (-474.440) [-475.131] * (-473.192) (-473.370) (-473.670) [-474.041] -- 0:00:44
266500 -- [-474.109] (-475.871) (-476.816) (-475.690) * (-477.243) (-472.319) (-472.638) [-472.984] -- 0:00:44
267000 -- (-477.339) (-477.023) (-473.871) [-476.307] * (-476.215) (-472.730) (-473.006) [-473.507] -- 0:00:43
267500 -- (-477.512) (-477.169) (-474.982) [-472.366] * [-475.689] (-473.834) (-473.865) (-476.056) -- 0:00:43
268000 -- (-476.675) [-473.572] (-474.909) (-475.617) * [-474.734] (-475.750) (-477.732) (-475.501) -- 0:00:43
268500 -- (-477.098) (-477.206) (-475.007) [-473.197] * (-474.041) (-472.695) (-474.961) [-473.010] -- 0:00:43
269000 -- (-478.178) [-473.561] (-474.553) (-473.873) * (-474.618) (-472.865) [-474.278] (-473.758) -- 0:00:43
269500 -- (-475.865) [-476.351] (-477.400) (-475.805) * (-473.274) [-475.120] (-473.026) (-478.429) -- 0:00:43
270000 -- [-473.323] (-473.451) (-472.949) (-474.745) * (-476.226) (-475.581) (-475.282) [-473.566] -- 0:00:43
Average standard deviation of split frequencies: 0.015094
270500 -- (-477.829) [-473.041] (-473.554) (-475.725) * (-474.391) (-476.259) [-478.548] (-474.143) -- 0:00:43
271000 -- (-472.623) [-474.475] (-473.189) (-476.273) * (-477.370) [-475.020] (-476.332) (-473.111) -- 0:00:43
271500 -- (-474.648) [-476.178] (-474.684) (-473.811) * (-478.513) (-476.074) [-474.604] (-473.028) -- 0:00:42
272000 -- (-472.972) (-476.168) (-474.057) [-474.535] * (-480.110) [-475.440] (-475.305) (-474.685) -- 0:00:42
272500 -- (-474.800) [-474.670] (-474.689) (-472.747) * (-474.995) (-476.624) (-475.493) [-473.639] -- 0:00:42
273000 -- (-472.364) (-473.095) [-473.815] (-475.501) * [-476.404] (-473.308) (-474.901) (-475.453) -- 0:00:42
273500 -- (-473.158) (-473.514) (-473.971) [-474.141] * (-473.780) (-474.836) (-473.276) [-473.983] -- 0:00:42
274000 -- [-474.595] (-474.225) (-472.636) (-473.214) * [-475.478] (-475.857) (-474.752) (-472.644) -- 0:00:42
274500 -- (-474.033) (-474.901) (-474.494) [-474.343] * (-473.841) [-475.817] (-475.075) (-474.255) -- 0:00:42
275000 -- (-473.741) (-475.354) (-473.950) [-472.751] * (-473.712) [-475.865] (-474.268) (-474.338) -- 0:00:42
Average standard deviation of split frequencies: 0.014367
275500 -- (-475.589) [-473.510] (-478.081) (-473.145) * [-475.649] (-474.064) (-473.713) (-472.985) -- 0:00:42
276000 -- (-474.642) [-477.965] (-472.638) (-474.210) * (-474.797) [-478.364] (-473.720) (-475.053) -- 0:00:41
276500 -- [-473.194] (-474.494) (-473.515) (-473.233) * [-475.441] (-476.271) (-473.815) (-475.008) -- 0:00:41
277000 -- (-474.338) (-474.125) [-474.062] (-475.269) * (-477.314) (-477.412) [-473.281] (-474.335) -- 0:00:41
277500 -- [-472.819] (-473.566) (-476.247) (-473.308) * [-473.646] (-474.645) (-476.544) (-474.150) -- 0:00:41
278000 -- (-474.646) [-474.120] (-474.539) (-478.388) * (-474.848) (-476.278) (-477.280) [-473.346] -- 0:00:41
278500 -- (-474.945) (-475.340) (-476.949) [-474.704] * (-476.282) [-474.331] (-475.780) (-475.016) -- 0:00:41
279000 -- (-474.263) (-474.317) (-476.265) [-473.248] * [-475.846] (-475.819) (-474.159) (-473.102) -- 0:00:41
279500 -- (-474.953) (-473.377) [-475.778] (-473.492) * [-473.694] (-477.973) (-472.780) (-474.284) -- 0:00:43
280000 -- (-474.741) (-473.134) [-476.182] (-473.516) * (-472.981) [-473.224] (-472.573) (-478.611) -- 0:00:43
Average standard deviation of split frequencies: 0.014463
280500 -- (-477.506) (-472.939) [-474.770] (-473.052) * (-475.809) (-473.870) (-473.579) [-475.595] -- 0:00:43
281000 -- (-473.557) (-474.335) [-474.525] (-473.088) * (-477.751) [-474.504] (-473.626) (-477.051) -- 0:00:43
281500 -- [-473.026] (-474.209) (-477.587) (-474.987) * (-479.496) [-475.714] (-473.458) (-475.675) -- 0:00:43
282000 -- (-472.736) (-475.000) (-474.418) [-476.463] * (-477.306) (-473.113) [-476.854] (-475.219) -- 0:00:43
282500 -- (-473.748) (-473.425) (-472.579) [-475.177] * (-475.465) (-474.166) [-474.804] (-477.374) -- 0:00:43
283000 -- (-475.727) (-474.787) (-472.510) [-476.099] * [-473.801] (-477.836) (-478.079) (-476.063) -- 0:00:43
283500 -- (-473.411) [-473.262] (-477.706) (-474.057) * (-475.280) (-474.179) [-476.611] (-477.078) -- 0:00:42
284000 -- (-478.824) [-475.108] (-476.922) (-474.298) * (-473.720) (-477.423) (-473.311) [-475.140] -- 0:00:42
284500 -- (-477.829) [-473.932] (-472.805) (-474.051) * [-473.007] (-475.563) (-474.546) (-475.693) -- 0:00:42
285000 -- (-480.736) (-476.117) [-473.606] (-474.353) * [-472.664] (-477.935) (-474.284) (-475.836) -- 0:00:42
Average standard deviation of split frequencies: 0.014314
285500 -- (-475.559) (-476.410) (-475.397) [-474.359] * (-474.751) (-473.346) (-476.798) [-473.988] -- 0:00:42
286000 -- (-474.910) (-473.629) [-474.274] (-475.065) * (-472.729) (-475.012) (-473.316) [-475.244] -- 0:00:42
286500 -- (-472.787) (-473.581) [-473.951] (-475.206) * (-474.354) [-472.830] (-476.666) (-477.638) -- 0:00:42
287000 -- (-472.454) (-476.184) (-473.240) [-474.457] * [-475.397] (-474.213) (-472.733) (-473.799) -- 0:00:42
287500 -- (-473.945) (-472.752) (-477.515) [-473.849] * (-474.200) [-474.073] (-472.504) (-472.710) -- 0:00:42
288000 -- (-475.682) (-476.701) (-474.559) [-474.349] * (-474.045) (-474.687) [-474.149] (-474.234) -- 0:00:42
288500 -- [-475.308] (-476.688) (-475.202) (-473.871) * (-475.206) [-474.440] (-472.977) (-473.131) -- 0:00:41
289000 -- (-474.529) (-476.440) (-479.003) [-473.689] * (-474.682) (-475.671) (-473.504) [-474.271] -- 0:00:41
289500 -- (-476.862) (-474.058) (-473.540) [-474.189] * (-474.035) (-475.632) (-476.263) [-475.007] -- 0:00:41
290000 -- (-476.853) [-473.822] (-475.520) (-473.974) * (-473.424) [-475.569] (-476.170) (-477.354) -- 0:00:41
Average standard deviation of split frequencies: 0.013401
290500 -- (-472.682) [-475.799] (-478.502) (-473.161) * [-473.948] (-475.983) (-476.834) (-474.366) -- 0:00:41
291000 -- [-472.370] (-474.719) (-476.279) (-474.297) * (-473.465) (-474.163) (-477.343) [-473.641] -- 0:00:41
291500 -- (-478.034) (-474.386) (-476.124) [-474.094] * [-475.818] (-478.485) (-474.548) (-475.022) -- 0:00:41
292000 -- (-482.270) (-472.935) (-475.145) [-473.454] * (-475.442) (-473.982) (-474.685) [-475.615] -- 0:00:41
292500 -- (-472.998) [-474.876] (-475.582) (-476.175) * (-475.692) (-479.916) (-473.614) [-472.963] -- 0:00:41
293000 -- (-475.911) [-474.560] (-474.251) (-472.373) * (-474.411) (-474.608) [-475.019] (-474.891) -- 0:00:41
293500 -- (-476.691) (-472.206) (-476.150) [-475.061] * (-472.463) [-476.192] (-478.551) (-474.483) -- 0:00:40
294000 -- (-476.022) (-473.738) (-475.124) [-475.232] * (-473.912) (-473.453) (-476.838) [-475.299] -- 0:00:40
294500 -- (-475.594) (-473.618) [-476.481] (-473.291) * (-474.883) (-472.635) (-474.214) [-476.348] -- 0:00:40
295000 -- (-475.071) (-474.143) [-474.740] (-474.146) * [-473.226] (-474.062) (-475.109) (-475.823) -- 0:00:40
Average standard deviation of split frequencies: 0.012179
295500 -- (-479.279) [-474.049] (-475.160) (-476.513) * [-476.002] (-473.826) (-473.365) (-475.409) -- 0:00:40
296000 -- [-474.019] (-474.133) (-477.306) (-474.022) * (-475.528) (-473.713) [-472.782] (-474.197) -- 0:00:40
296500 -- (-474.249) (-480.837) (-474.036) [-473.934] * (-474.679) [-474.468] (-478.823) (-473.508) -- 0:00:42
297000 -- (-475.774) [-473.093] (-473.878) (-478.231) * (-473.047) (-474.390) (-473.138) [-476.364] -- 0:00:42
297500 -- [-473.863] (-473.663) (-472.713) (-478.580) * (-474.405) (-476.099) (-475.175) [-473.869] -- 0:00:42
298000 -- (-478.237) [-475.858] (-476.694) (-477.425) * [-477.697] (-475.225) (-476.067) (-473.445) -- 0:00:42
298500 -- (-475.827) [-474.167] (-475.729) (-473.264) * (-476.105) [-475.792] (-473.911) (-473.035) -- 0:00:42
299000 -- (-472.926) (-475.061) [-475.996] (-474.946) * [-474.490] (-474.359) (-475.484) (-473.107) -- 0:00:42
299500 -- (-474.889) (-476.222) (-473.234) [-475.006] * [-473.436] (-474.495) (-477.086) (-473.951) -- 0:00:42
300000 -- (-476.560) [-473.837] (-474.869) (-475.730) * [-473.844] (-474.053) (-473.763) (-475.210) -- 0:00:42
Average standard deviation of split frequencies: 0.012727
300500 -- (-484.386) (-475.245) (-473.915) [-476.240] * [-473.357] (-473.834) (-475.568) (-473.380) -- 0:00:41
301000 -- [-481.529] (-474.619) (-475.854) (-480.294) * (-473.488) [-473.682] (-474.334) (-476.990) -- 0:00:41
301500 -- (-477.294) (-473.792) (-474.302) [-473.514] * (-474.971) (-472.710) [-472.303] (-476.380) -- 0:00:41
302000 -- [-475.888] (-475.783) (-475.080) (-476.904) * (-475.469) [-472.853] (-473.530) (-473.692) -- 0:00:41
302500 -- (-474.673) (-475.499) (-477.948) [-473.505] * (-475.483) [-473.453] (-473.099) (-476.428) -- 0:00:41
303000 -- (-475.338) (-476.281) (-474.218) [-474.599] * (-478.634) [-475.793] (-472.467) (-475.122) -- 0:00:41
303500 -- (-472.269) (-473.775) [-472.187] (-473.416) * (-475.300) (-472.604) [-474.076] (-473.496) -- 0:00:41
304000 -- (-474.536) (-478.819) (-474.436) [-473.105] * (-473.422) (-475.450) (-476.108) [-474.129] -- 0:00:41
304500 -- (-475.994) [-473.223] (-479.612) (-474.216) * (-473.340) (-474.963) (-479.420) [-474.139] -- 0:00:41
305000 -- (-474.354) [-473.190] (-472.229) (-473.149) * (-474.983) (-477.694) [-474.834] (-475.413) -- 0:00:41
Average standard deviation of split frequencies: 0.012752
305500 -- [-474.783] (-475.366) (-477.128) (-478.263) * [-473.879] (-473.475) (-474.089) (-478.592) -- 0:00:40
306000 -- (-475.818) (-474.173) (-474.235) [-474.367] * [-475.714] (-472.375) (-476.203) (-475.503) -- 0:00:40
306500 -- (-474.202) [-473.641] (-472.903) (-474.631) * (-474.616) (-473.589) [-475.545] (-476.814) -- 0:00:40
307000 -- (-474.919) (-472.895) (-477.834) [-473.762] * (-475.587) [-474.087] (-473.850) (-477.950) -- 0:00:40
307500 -- (-474.894) [-475.492] (-474.135) (-472.694) * [-477.318] (-473.977) (-473.611) (-477.118) -- 0:00:40
308000 -- (-473.695) (-474.891) [-474.825] (-473.606) * [-474.140] (-474.055) (-473.433) (-478.249) -- 0:00:40
308500 -- [-473.754] (-477.370) (-474.267) (-473.927) * (-477.862) (-472.759) (-474.960) [-476.257] -- 0:00:40
309000 -- (-475.373) (-476.055) (-474.456) [-473.312] * (-475.118) (-477.804) (-474.419) [-474.005] -- 0:00:40
309500 -- (-474.937) (-477.675) [-475.135] (-473.998) * (-478.790) (-474.521) (-473.774) [-473.588] -- 0:00:40
310000 -- (-474.410) (-475.419) [-473.669] (-473.439) * [-477.192] (-474.103) (-475.273) (-473.503) -- 0:00:40
Average standard deviation of split frequencies: 0.013182
310500 -- (-474.189) (-476.239) [-472.978] (-472.880) * (-473.777) (-473.959) [-473.620] (-475.015) -- 0:00:39
311000 -- (-473.401) (-477.262) (-473.423) [-472.753] * (-473.432) (-477.426) [-476.306] (-473.274) -- 0:00:39
311500 -- (-474.634) (-476.473) (-475.915) [-472.584] * [-474.645] (-476.091) (-476.413) (-474.661) -- 0:00:39
312000 -- [-473.909] (-482.813) (-473.795) (-474.434) * (-475.843) (-473.439) (-473.881) [-472.410] -- 0:00:39
312500 -- [-473.324] (-476.689) (-473.872) (-474.675) * (-476.032) (-472.458) (-474.372) [-474.768] -- 0:00:39
313000 -- (-472.887) (-474.758) (-474.453) [-475.666] * (-475.393) [-472.769] (-474.286) (-472.834) -- 0:00:39
313500 -- [-474.909] (-474.315) (-477.379) (-475.664) * (-479.964) (-472.916) [-478.817] (-473.732) -- 0:00:41
314000 -- (-473.292) (-473.169) [-477.001] (-474.515) * (-475.398) (-474.458) [-476.889] (-473.589) -- 0:00:41
314500 -- [-473.703] (-472.667) (-475.439) (-473.634) * (-475.252) (-473.687) [-475.067] (-476.586) -- 0:00:41
315000 -- [-474.514] (-476.589) (-475.334) (-472.571) * (-473.734) (-474.918) (-473.263) [-474.253] -- 0:00:41
Average standard deviation of split frequencies: 0.012867
315500 -- (-478.719) [-474.501] (-475.843) (-477.568) * (-476.896) (-475.029) [-478.171] (-473.960) -- 0:00:41
316000 -- (-477.851) [-473.443] (-473.750) (-474.097) * (-475.539) [-475.023] (-473.168) (-477.054) -- 0:00:41
316500 -- (-476.701) (-476.842) [-473.946] (-476.977) * (-473.548) (-475.393) [-474.384] (-474.032) -- 0:00:41
317000 -- (-476.796) [-475.023] (-479.265) (-473.577) * (-474.148) (-473.324) (-474.043) [-474.072] -- 0:00:40
317500 -- [-474.493] (-472.805) (-474.962) (-474.604) * (-473.883) (-473.741) (-473.185) [-473.276] -- 0:00:40
318000 -- (-472.932) [-473.564] (-476.017) (-475.855) * (-475.943) (-474.287) [-474.482] (-475.712) -- 0:00:40
318500 -- [-473.924] (-478.438) (-473.671) (-473.412) * (-473.552) (-474.587) [-473.102] (-473.974) -- 0:00:40
319000 -- (-473.015) (-476.149) [-476.345] (-473.188) * (-472.468) (-475.479) (-473.862) [-475.725] -- 0:00:40
319500 -- [-473.952] (-477.271) (-475.349) (-472.992) * (-473.099) (-473.636) [-474.867] (-472.923) -- 0:00:40
320000 -- [-472.747] (-474.392) (-473.960) (-475.514) * (-474.865) (-475.197) [-473.812] (-475.045) -- 0:00:40
Average standard deviation of split frequencies: 0.012404
320500 -- (-472.570) (-475.116) (-472.776) [-474.169] * (-474.863) (-472.805) (-473.781) [-474.367] -- 0:00:40
321000 -- [-472.828] (-476.457) (-473.286) (-474.278) * (-472.939) [-472.550] (-473.614) (-475.087) -- 0:00:40
321500 -- [-475.603] (-478.613) (-474.381) (-478.434) * [-474.851] (-473.103) (-474.608) (-473.786) -- 0:00:40
322000 -- [-474.195] (-475.464) (-479.252) (-475.599) * (-473.480) (-479.357) (-474.836) [-472.645] -- 0:00:40
322500 -- (-473.667) (-477.249) [-475.057] (-478.968) * [-472.719] (-478.359) (-474.714) (-473.552) -- 0:00:39
323000 -- (-476.019) (-475.705) (-474.258) [-478.209] * (-475.134) [-472.514] (-473.651) (-475.802) -- 0:00:39
323500 -- (-473.439) [-474.066] (-477.594) (-478.248) * (-473.286) (-474.999) [-475.749] (-475.244) -- 0:00:39
324000 -- (-474.147) (-473.736) [-475.491] (-477.670) * (-473.203) [-474.152] (-475.637) (-478.300) -- 0:00:39
324500 -- (-478.340) [-474.840] (-472.287) (-473.895) * [-473.268] (-472.728) (-473.679) (-475.304) -- 0:00:39
325000 -- (-473.012) [-473.421] (-476.806) (-475.369) * (-478.610) (-474.100) (-472.943) [-474.409] -- 0:00:39
Average standard deviation of split frequencies: 0.012079
325500 -- [-473.241] (-475.096) (-475.402) (-474.755) * [-474.804] (-474.817) (-473.501) (-474.767) -- 0:00:39
326000 -- [-475.995] (-472.696) (-477.165) (-473.103) * [-473.516] (-472.734) (-473.453) (-472.948) -- 0:00:39
326500 -- (-475.397) [-477.787] (-474.507) (-473.856) * [-475.193] (-475.696) (-474.500) (-473.957) -- 0:00:39
327000 -- (-473.678) (-475.064) (-473.668) [-474.977] * (-474.210) [-473.292] (-474.016) (-477.889) -- 0:00:39
327500 -- (-475.115) (-475.668) [-474.317] (-474.859) * (-473.311) [-474.270] (-477.531) (-479.117) -- 0:00:39
328000 -- [-474.952] (-474.919) (-474.090) (-475.882) * (-475.160) (-473.475) (-478.583) [-476.320] -- 0:00:38
328500 -- [-473.072] (-475.381) (-474.066) (-473.909) * (-474.081) [-474.069] (-474.846) (-475.577) -- 0:00:38
329000 -- (-475.483) [-474.545] (-479.054) (-474.657) * (-473.486) [-474.961] (-472.663) (-473.397) -- 0:00:38
329500 -- [-473.811] (-473.463) (-472.661) (-475.870) * [-475.736] (-475.233) (-473.263) (-474.340) -- 0:00:38
330000 -- [-473.300] (-473.807) (-474.027) (-476.981) * (-475.832) [-474.646] (-478.094) (-478.806) -- 0:00:38
Average standard deviation of split frequencies: 0.013166
330500 -- (-475.300) (-473.888) (-473.330) [-474.013] * [-477.559] (-473.802) (-474.959) (-474.358) -- 0:00:40
331000 -- (-475.920) (-475.163) (-476.915) [-474.196] * (-475.685) (-477.123) (-473.899) [-475.785] -- 0:00:40
331500 -- (-473.933) [-473.710] (-472.857) (-476.689) * (-473.152) (-473.838) (-474.658) [-476.057] -- 0:00:40
332000 -- (-475.924) (-473.539) [-473.112] (-474.093) * [-473.410] (-475.928) (-477.433) (-475.243) -- 0:00:40
332500 -- [-475.298] (-472.718) (-474.211) (-473.694) * (-474.337) (-476.365) (-475.658) [-473.251] -- 0:00:40
333000 -- [-474.026] (-475.383) (-475.706) (-474.460) * (-475.372) (-474.241) (-477.500) [-472.907] -- 0:00:40
333500 -- (-473.776) (-477.379) (-476.958) [-474.328] * (-475.505) (-474.496) (-475.283) [-472.971] -- 0:00:39
334000 -- [-473.327] (-475.307) (-473.410) (-474.291) * (-475.737) (-473.638) [-473.165] (-473.960) -- 0:00:39
334500 -- [-473.792] (-475.660) (-474.486) (-476.257) * (-472.964) [-474.995] (-473.118) (-476.358) -- 0:00:39
335000 -- (-473.025) (-477.284) (-475.193) [-473.940] * [-475.432] (-476.509) (-472.747) (-473.260) -- 0:00:39
Average standard deviation of split frequencies: 0.011967
335500 -- (-475.163) (-474.492) [-474.068] (-475.166) * (-475.446) (-475.506) (-475.162) [-472.526] -- 0:00:39
336000 -- (-477.364) (-472.237) (-473.537) [-472.301] * (-476.932) (-473.464) (-473.006) [-476.217] -- 0:00:39
336500 -- (-475.430) [-473.518] (-473.633) (-477.324) * (-473.648) (-475.872) [-474.450] (-475.392) -- 0:00:39
337000 -- (-473.851) [-476.210] (-475.204) (-473.148) * (-474.720) (-473.418) (-474.698) [-472.850] -- 0:00:39
337500 -- (-474.273) (-473.860) (-473.016) [-474.926] * (-472.890) (-473.234) [-473.354] (-475.675) -- 0:00:39
338000 -- (-473.543) (-473.255) (-475.822) [-473.186] * (-477.113) [-473.427] (-475.454) (-474.630) -- 0:00:39
338500 -- (-473.844) (-473.448) [-473.618] (-474.294) * (-474.175) (-478.811) [-472.746] (-473.268) -- 0:00:39
339000 -- (-474.213) (-474.284) (-478.151) [-474.693] * [-472.769] (-476.601) (-475.628) (-474.257) -- 0:00:38
339500 -- (-476.234) [-472.614] (-475.576) (-475.339) * [-473.802] (-476.453) (-472.822) (-478.078) -- 0:00:38
340000 -- (-477.846) (-473.045) (-474.835) [-474.227] * (-473.257) (-476.772) [-474.604] (-474.223) -- 0:00:38
Average standard deviation of split frequencies: 0.011157
340500 -- (-476.861) (-472.398) [-473.446] (-477.292) * (-472.349) [-473.453] (-474.452) (-475.073) -- 0:00:38
341000 -- (-474.951) [-476.071] (-474.290) (-473.921) * (-481.363) (-475.101) [-474.303] (-476.531) -- 0:00:38
341500 -- (-476.907) [-476.339] (-472.980) (-475.138) * (-478.931) (-475.612) (-472.590) [-473.345] -- 0:00:38
342000 -- (-476.449) (-476.027) (-472.770) [-473.948] * [-473.426] (-478.021) (-474.893) (-477.342) -- 0:00:38
342500 -- (-474.619) (-472.942) (-475.003) [-474.715] * (-473.708) (-472.634) (-476.181) [-475.292] -- 0:00:38
343000 -- (-473.271) (-472.823) [-474.640] (-474.424) * (-474.331) (-479.283) [-474.636] (-475.269) -- 0:00:38
343500 -- [-474.689] (-474.082) (-478.046) (-474.088) * [-473.304] (-481.268) (-474.214) (-473.418) -- 0:00:38
344000 -- (-475.185) [-472.942] (-474.767) (-479.582) * [-472.548] (-475.910) (-475.889) (-476.970) -- 0:00:38
344500 -- (-476.080) (-476.680) (-474.994) [-474.217] * [-473.772] (-474.370) (-475.018) (-473.346) -- 0:00:38
345000 -- (-474.106) (-473.299) [-474.983] (-473.503) * (-474.614) [-477.164] (-473.654) (-474.715) -- 0:00:37
Average standard deviation of split frequencies: 0.010419
345500 -- (-473.074) [-472.660] (-473.629) (-476.585) * (-475.928) [-476.662] (-472.346) (-478.167) -- 0:00:37
346000 -- (-473.090) (-475.360) (-475.460) [-474.690] * (-474.843) (-474.106) (-472.576) [-475.155] -- 0:00:37
346500 -- (-477.649) (-473.896) (-478.792) [-473.602] * (-475.608) (-474.957) (-475.233) [-475.341] -- 0:00:37
347000 -- (-475.593) (-481.958) (-477.257) [-474.722] * [-474.952] (-472.628) (-474.327) (-476.127) -- 0:00:37
347500 -- (-475.323) (-473.636) (-473.840) [-473.478] * (-474.246) (-474.262) [-474.123] (-475.166) -- 0:00:39
348000 -- (-475.839) (-473.743) (-472.827) [-472.602] * (-476.374) [-473.033] (-472.659) (-475.853) -- 0:00:39
348500 -- (-472.577) [-473.839] (-473.151) (-472.641) * (-475.232) [-473.622] (-473.915) (-476.144) -- 0:00:39
349000 -- (-475.385) (-478.662) (-473.975) [-475.928] * (-472.928) (-473.132) [-476.529] (-476.341) -- 0:00:39
349500 -- (-472.742) (-474.936) (-474.888) [-472.580] * (-472.377) (-476.096) (-473.586) [-473.712] -- 0:00:39
350000 -- (-473.236) [-473.561] (-476.748) (-473.750) * [-474.645] (-474.823) (-473.622) (-475.052) -- 0:00:39
Average standard deviation of split frequencies: 0.009964
350500 -- (-473.596) [-473.814] (-475.299) (-473.080) * (-473.716) [-475.831] (-479.123) (-475.459) -- 0:00:38
351000 -- (-474.052) (-475.475) [-475.369] (-474.773) * (-475.536) (-476.842) (-473.074) [-473.380] -- 0:00:38
351500 -- (-473.826) [-476.043] (-474.254) (-477.005) * (-480.180) (-475.100) [-473.372] (-477.316) -- 0:00:38
352000 -- [-475.778] (-474.136) (-477.522) (-474.102) * (-478.557) (-474.422) [-473.529] (-476.506) -- 0:00:38
352500 -- (-474.761) [-475.332] (-477.093) (-472.592) * [-473.866] (-472.859) (-474.301) (-473.645) -- 0:00:38
353000 -- [-474.401] (-472.890) (-472.723) (-473.857) * (-473.812) [-474.120] (-476.721) (-475.427) -- 0:00:38
353500 -- (-472.926) (-478.171) [-473.018] (-472.537) * (-477.080) (-473.388) [-475.266] (-476.709) -- 0:00:38
354000 -- (-472.224) (-477.242) (-475.527) [-474.743] * (-472.946) (-475.417) (-480.768) [-476.830] -- 0:00:38
354500 -- (-475.270) (-473.962) (-472.434) [-474.327] * (-476.434) (-477.041) (-475.405) [-474.913] -- 0:00:38
355000 -- (-477.079) (-475.163) [-472.427] (-473.784) * (-478.861) [-477.335] (-477.187) (-474.435) -- 0:00:38
Average standard deviation of split frequencies: 0.008524
355500 -- (-472.504) (-475.535) [-472.977] (-473.595) * (-475.200) (-474.542) (-475.682) [-473.590] -- 0:00:38
356000 -- (-473.691) [-472.933] (-474.522) (-473.393) * (-474.718) (-475.577) (-476.781) [-472.944] -- 0:00:37
356500 -- (-473.741) (-473.687) [-474.125] (-474.801) * [-476.898] (-478.371) (-474.854) (-474.253) -- 0:00:37
357000 -- [-473.234] (-473.319) (-472.933) (-473.648) * (-476.133) (-473.682) (-477.477) [-477.154] -- 0:00:37
357500 -- (-473.755) (-473.264) [-476.128] (-473.222) * (-473.549) [-475.316] (-472.977) (-475.667) -- 0:00:37
358000 -- [-473.881] (-474.500) (-473.484) (-472.744) * [-474.526] (-474.435) (-473.805) (-475.061) -- 0:00:37
358500 -- (-475.352) (-475.167) [-474.966] (-472.846) * [-474.100] (-476.589) (-474.701) (-476.903) -- 0:00:37
359000 -- (-476.974) (-477.053) (-474.795) [-472.684] * (-474.436) [-473.198] (-476.027) (-472.796) -- 0:00:37
359500 -- (-476.135) (-477.214) (-476.454) [-474.587] * [-475.285] (-474.152) (-473.897) (-472.988) -- 0:00:37
360000 -- (-477.290) (-478.357) (-475.061) [-472.889] * (-472.858) [-475.937] (-473.670) (-474.591) -- 0:00:37
Average standard deviation of split frequencies: 0.007842
360500 -- [-473.466] (-474.884) (-475.355) (-474.246) * (-475.201) (-474.341) (-474.251) [-474.110] -- 0:00:37
361000 -- (-474.601) (-474.403) (-476.286) [-473.346] * (-476.372) (-474.900) (-477.013) [-475.319] -- 0:00:37
361500 -- (-475.218) (-476.224) (-480.226) [-473.122] * (-474.414) (-472.462) [-477.375] (-478.035) -- 0:00:37
362000 -- (-473.170) (-472.759) [-474.331] (-472.715) * (-477.182) (-472.618) [-473.466] (-473.419) -- 0:00:37
362500 -- (-474.608) (-477.932) [-473.872] (-476.434) * (-475.035) [-474.299] (-473.254) (-474.396) -- 0:00:36
363000 -- [-472.267] (-475.060) (-477.573) (-477.322) * [-473.949] (-477.441) (-473.282) (-474.326) -- 0:00:36
363500 -- (-475.680) (-473.892) (-474.722) [-475.422] * (-472.653) (-472.963) [-474.335] (-475.220) -- 0:00:36
364000 -- (-477.899) (-473.880) (-473.255) [-473.214] * (-474.299) (-474.337) [-475.545] (-475.461) -- 0:00:36
364500 -- (-473.628) (-476.050) [-473.744] (-474.857) * [-476.942] (-473.099) (-475.584) (-475.100) -- 0:00:38
365000 -- (-474.040) [-473.986] (-476.665) (-474.584) * (-472.255) (-473.342) (-478.324) [-474.660] -- 0:00:38
Average standard deviation of split frequencies: 0.010161
365500 -- (-473.638) (-474.508) [-475.359] (-477.437) * [-473.598] (-473.024) (-476.259) (-476.766) -- 0:00:38
366000 -- (-474.872) (-475.160) [-474.100] (-474.799) * (-472.612) [-476.415] (-474.075) (-480.263) -- 0:00:38
366500 -- [-473.647] (-478.862) (-474.480) (-474.342) * (-472.714) (-475.656) (-472.730) [-477.841] -- 0:00:38
367000 -- [-478.542] (-474.170) (-480.241) (-474.598) * (-481.600) (-472.574) (-472.744) [-473.561] -- 0:00:37
367500 -- (-475.121) (-473.862) [-472.808] (-476.199) * [-473.481] (-478.261) (-475.458) (-474.159) -- 0:00:37
368000 -- (-474.240) [-473.413] (-473.145) (-474.571) * [-474.099] (-477.316) (-476.575) (-472.387) -- 0:00:37
368500 -- [-472.848] (-476.087) (-474.036) (-474.678) * (-472.949) (-475.549) (-472.528) [-474.348] -- 0:00:37
369000 -- [-474.090] (-473.229) (-474.699) (-474.731) * [-476.975] (-475.325) (-473.770) (-474.724) -- 0:00:37
369500 -- (-475.380) (-473.203) (-476.401) [-473.522] * [-473.311] (-480.913) (-474.379) (-473.719) -- 0:00:37
370000 -- [-474.124] (-473.206) (-476.408) (-473.602) * (-475.134) (-475.127) (-472.991) [-473.796] -- 0:00:37
Average standard deviation of split frequencies: 0.009202
370500 -- (-473.890) (-475.146) [-473.756] (-472.497) * (-476.781) [-475.055] (-473.454) (-473.530) -- 0:00:37
371000 -- (-473.193) (-478.481) [-473.823] (-473.509) * (-476.399) [-474.944] (-475.543) (-477.218) -- 0:00:37
371500 -- (-473.955) [-474.456] (-475.816) (-473.413) * (-480.446) [-472.938] (-475.475) (-475.810) -- 0:00:37
372000 -- [-472.366] (-474.213) (-473.605) (-473.855) * [-475.784] (-474.211) (-478.190) (-473.923) -- 0:00:37
372500 -- (-474.557) (-473.035) [-473.735] (-474.941) * (-475.368) (-472.538) (-478.539) [-472.523] -- 0:00:37
373000 -- [-474.749] (-472.551) (-476.056) (-474.752) * [-474.311] (-477.883) (-475.851) (-472.328) -- 0:00:36
373500 -- (-472.641) (-473.273) [-474.602] (-474.146) * [-474.610] (-475.097) (-477.514) (-478.201) -- 0:00:36
374000 -- (-475.880) (-473.586) [-474.667] (-474.228) * (-475.069) (-475.097) [-475.503] (-481.916) -- 0:00:36
374500 -- (-472.989) [-473.491] (-474.746) (-473.748) * [-473.112] (-475.047) (-477.380) (-475.984) -- 0:00:36
375000 -- [-473.748] (-475.990) (-473.678) (-474.593) * [-477.595] (-474.353) (-472.569) (-473.774) -- 0:00:36
Average standard deviation of split frequencies: 0.009661
375500 -- [-477.315] (-473.411) (-478.649) (-474.204) * (-473.135) (-476.176) (-472.339) [-476.211] -- 0:00:36
376000 -- (-475.982) (-477.738) [-474.999] (-473.347) * [-475.014] (-473.125) (-476.557) (-475.193) -- 0:00:36
376500 -- [-474.169] (-474.529) (-473.739) (-476.523) * (-472.613) (-473.325) (-475.749) [-473.012] -- 0:00:36
377000 -- [-477.062] (-476.340) (-474.171) (-473.924) * (-474.566) [-476.174] (-472.720) (-474.100) -- 0:00:36
377500 -- (-479.121) (-475.785) (-473.048) [-474.316] * [-473.932] (-474.789) (-473.246) (-475.014) -- 0:00:36
378000 -- (-476.901) (-473.394) [-473.298] (-472.368) * (-485.346) (-472.906) (-472.916) [-474.013] -- 0:00:36
378500 -- (-477.523) [-472.309] (-475.141) (-473.026) * (-473.023) [-472.851] (-472.847) (-475.497) -- 0:00:36
379000 -- (-474.478) (-472.975) [-478.179] (-472.537) * (-474.709) (-473.766) [-473.645] (-475.778) -- 0:00:36
379500 -- (-475.197) (-472.664) (-476.411) [-472.491] * [-472.670] (-474.484) (-473.424) (-479.179) -- 0:00:35
380000 -- (-475.031) [-473.742] (-474.209) (-475.383) * (-474.837) [-480.042] (-475.322) (-476.304) -- 0:00:35
Average standard deviation of split frequencies: 0.009752
380500 -- (-473.168) (-472.961) (-473.687) [-474.472] * [-473.320] (-476.505) (-479.460) (-472.533) -- 0:00:37
381000 -- (-473.516) (-474.064) (-476.084) [-472.857] * [-472.913] (-473.245) (-472.909) (-474.733) -- 0:00:37
381500 -- [-477.179] (-473.242) (-473.002) (-474.361) * (-474.376) [-473.546] (-473.996) (-474.081) -- 0:00:37
382000 -- (-480.666) (-474.609) [-474.084] (-473.393) * (-474.700) (-473.098) (-476.596) [-474.824] -- 0:00:37
382500 -- (-475.471) (-474.344) (-475.370) [-474.435] * (-474.874) (-475.778) [-475.519] (-472.849) -- 0:00:37
383000 -- [-478.032] (-475.556) (-480.028) (-474.718) * [-478.711] (-474.971) (-472.937) (-478.470) -- 0:00:37
383500 -- (-476.232) [-472.981] (-475.281) (-473.134) * (-477.290) [-475.469] (-476.877) (-476.287) -- 0:00:36
384000 -- (-474.318) (-477.354) (-473.820) [-477.080] * (-472.753) (-476.715) (-475.325) [-474.886] -- 0:00:36
384500 -- [-475.462] (-482.921) (-473.822) (-472.976) * [-473.130] (-474.076) (-473.769) (-475.573) -- 0:00:36
385000 -- [-475.344] (-474.091) (-473.157) (-472.656) * [-476.444] (-473.784) (-473.263) (-472.753) -- 0:00:36
Average standard deviation of split frequencies: 0.009626
385500 -- (-475.537) [-473.288] (-473.924) (-478.930) * (-473.075) [-475.416] (-476.776) (-473.670) -- 0:00:36
386000 -- [-472.999] (-477.520) (-477.136) (-476.615) * (-474.521) (-475.773) [-477.914] (-477.802) -- 0:00:36
386500 -- [-477.682] (-472.680) (-477.767) (-474.396) * (-475.321) (-476.229) (-479.276) [-475.445] -- 0:00:36
387000 -- [-472.967] (-473.295) (-474.692) (-473.718) * (-476.227) (-473.171) [-478.028] (-475.289) -- 0:00:36
387500 -- (-472.652) [-473.407] (-473.838) (-472.587) * (-474.813) (-475.287) [-473.617] (-477.263) -- 0:00:36
388000 -- (-474.605) [-473.958] (-476.613) (-473.442) * (-474.536) (-479.046) [-472.947] (-477.577) -- 0:00:36
388500 -- [-473.798] (-473.115) (-472.465) (-474.859) * (-474.900) (-478.930) (-477.690) [-477.500] -- 0:00:36
389000 -- (-472.394) [-472.805] (-477.830) (-473.002) * (-474.131) (-477.929) [-475.304] (-473.493) -- 0:00:36
389500 -- (-474.459) (-474.988) (-473.033) [-474.832] * [-475.737] (-474.181) (-475.683) (-474.870) -- 0:00:36
390000 -- [-474.372] (-474.519) (-473.922) (-475.844) * [-473.545] (-479.150) (-477.875) (-473.184) -- 0:00:35
Average standard deviation of split frequencies: 0.009795
390500 -- (-472.375) (-480.126) [-474.677] (-478.997) * [-475.469] (-475.171) (-480.396) (-478.630) -- 0:00:35
391000 -- [-473.268] (-477.012) (-476.858) (-473.610) * [-472.796] (-478.652) (-479.954) (-472.602) -- 0:00:35
391500 -- (-476.938) (-473.761) (-484.158) [-473.563] * [-478.099] (-474.742) (-477.098) (-473.494) -- 0:00:35
392000 -- [-473.921] (-472.770) (-475.132) (-476.706) * [-472.700] (-474.037) (-473.214) (-475.060) -- 0:00:35
392500 -- (-474.665) (-472.714) [-476.540] (-473.705) * (-474.156) [-472.591] (-476.485) (-475.171) -- 0:00:35
393000 -- (-472.812) (-473.716) [-473.118] (-474.216) * [-473.626] (-477.183) (-478.498) (-474.333) -- 0:00:35
393500 -- (-477.671) (-472.384) (-475.789) [-473.084] * (-474.013) (-473.099) (-478.637) [-474.406] -- 0:00:35
394000 -- (-474.906) [-476.481] (-473.703) (-475.130) * (-472.832) (-475.410) (-472.814) [-475.876] -- 0:00:35
394500 -- (-473.184) (-475.236) (-473.972) [-475.366] * (-472.233) [-474.340] (-473.241) (-474.339) -- 0:00:35
395000 -- (-473.386) (-474.354) (-476.524) [-477.544] * (-474.540) (-473.589) (-474.211) [-473.939] -- 0:00:35
Average standard deviation of split frequencies: 0.009523
395500 -- [-474.981] (-475.450) (-474.831) (-476.155) * (-475.995) (-473.252) [-474.155] (-473.520) -- 0:00:35
396000 -- (-474.434) (-473.617) [-473.680] (-477.857) * (-472.891) (-473.517) [-475.137] (-477.980) -- 0:00:35
396500 -- [-474.148] (-473.275) (-478.512) (-474.415) * (-476.303) (-474.917) (-473.051) [-475.824] -- 0:00:35
397000 -- [-473.514] (-472.939) (-474.625) (-473.810) * (-474.326) (-474.927) (-475.256) [-476.301] -- 0:00:36
397500 -- (-478.456) (-478.964) [-474.676] (-474.706) * (-477.327) (-474.420) [-474.653] (-475.551) -- 0:00:36
398000 -- (-477.226) (-473.805) [-473.824] (-477.314) * (-473.844) [-475.098] (-480.834) (-475.444) -- 0:00:36
398500 -- [-472.907] (-476.800) (-476.839) (-478.136) * (-477.329) [-474.976] (-474.178) (-476.032) -- 0:00:36
399000 -- (-473.473) [-474.602] (-474.770) (-475.272) * (-478.823) (-475.856) (-474.936) [-478.723] -- 0:00:36
399500 -- (-472.854) (-474.713) (-475.580) [-472.760] * [-473.533] (-473.259) (-478.573) (-473.965) -- 0:00:36
400000 -- (-473.541) (-473.642) (-482.463) [-472.535] * (-475.084) (-475.448) (-473.760) [-472.597] -- 0:00:36
Average standard deviation of split frequencies: 0.009780
400500 -- (-473.172) [-478.882] (-477.215) (-475.455) * (-474.823) [-476.734] (-473.953) (-474.538) -- 0:00:35
401000 -- (-473.380) [-475.359] (-475.115) (-473.545) * (-473.598) (-472.286) (-474.182) [-472.253] -- 0:00:35
401500 -- (-476.657) [-478.907] (-477.893) (-474.928) * (-472.709) [-474.131] (-474.340) (-472.716) -- 0:00:35
402000 -- [-474.377] (-472.970) (-472.897) (-477.565) * (-474.602) [-475.239] (-473.370) (-472.707) -- 0:00:35
402500 -- (-474.479) [-474.177] (-473.553) (-479.041) * (-474.249) (-472.767) (-478.541) [-473.213] -- 0:00:35
403000 -- (-476.623) [-474.148] (-473.478) (-473.870) * (-473.686) (-473.817) (-476.836) [-472.629] -- 0:00:35
403500 -- (-476.768) (-473.540) [-473.027] (-473.027) * (-472.893) (-475.959) [-477.492] (-475.502) -- 0:00:35
404000 -- [-477.963] (-472.999) (-474.213) (-475.096) * (-475.251) (-473.061) [-473.246] (-474.350) -- 0:00:35
404500 -- (-473.697) (-481.957) (-473.839) [-476.385] * (-473.558) [-473.923] (-473.355) (-477.734) -- 0:00:35
405000 -- [-472.642] (-473.598) (-474.542) (-477.575) * (-480.231) (-474.911) [-473.491] (-476.645) -- 0:00:35
Average standard deviation of split frequencies: 0.009224
405500 -- (-474.272) (-475.537) (-472.219) [-478.774] * [-474.566] (-474.502) (-473.063) (-475.604) -- 0:00:35
406000 -- (-474.223) (-474.276) (-473.783) [-476.065] * [-475.508] (-477.776) (-480.312) (-474.535) -- 0:00:35
406500 -- (-475.910) (-473.858) [-472.977] (-472.896) * (-474.485) (-481.401) [-476.069] (-478.898) -- 0:00:35
407000 -- (-472.348) [-473.220] (-475.022) (-475.177) * [-474.049] (-478.906) (-473.974) (-477.908) -- 0:00:34
407500 -- (-473.910) [-473.598] (-473.238) (-476.092) * (-476.841) [-477.159] (-473.797) (-474.947) -- 0:00:34
408000 -- (-475.446) [-475.279] (-473.502) (-474.768) * (-474.847) (-473.496) [-472.799] (-472.609) -- 0:00:34
408500 -- (-472.425) [-478.493] (-475.996) (-473.697) * (-473.534) [-473.339] (-473.637) (-473.778) -- 0:00:34
409000 -- (-473.361) (-473.336) [-474.585] (-477.539) * (-474.240) (-472.730) [-474.849] (-474.933) -- 0:00:34
409500 -- (-473.731) [-473.244] (-474.759) (-474.987) * [-472.345] (-472.902) (-473.997) (-477.976) -- 0:00:34
410000 -- (-475.162) (-474.580) [-473.825] (-473.133) * (-473.350) [-474.054] (-476.756) (-476.344) -- 0:00:34
Average standard deviation of split frequencies: 0.009502
410500 -- (-482.219) (-477.609) [-474.832] (-473.202) * [-473.097] (-472.903) (-473.094) (-473.151) -- 0:00:34
411000 -- (-475.304) [-473.179] (-473.017) (-476.500) * [-472.904] (-473.075) (-474.858) (-474.713) -- 0:00:34
411500 -- (-474.545) (-473.366) [-473.945] (-475.109) * (-474.398) (-478.921) (-478.700) [-476.246] -- 0:00:34
412000 -- (-480.778) [-473.439] (-474.922) (-473.005) * [-478.448] (-473.405) (-474.160) (-472.295) -- 0:00:34
412500 -- (-473.995) [-474.842] (-474.212) (-473.362) * [-475.396] (-473.437) (-475.075) (-474.813) -- 0:00:34
413000 -- (-472.791) [-474.161] (-473.191) (-476.612) * (-474.707) [-475.584] (-478.620) (-475.080) -- 0:00:34
413500 -- (-474.993) (-475.890) (-475.018) [-475.396] * (-476.634) (-474.343) [-474.129] (-474.405) -- 0:00:34
414000 -- (-472.973) (-474.383) (-475.156) [-472.912] * (-475.725) (-474.798) [-473.332] (-473.263) -- 0:00:35
414500 -- (-473.398) [-474.986] (-474.177) (-472.778) * (-476.973) (-475.286) (-477.281) [-472.492] -- 0:00:35
415000 -- [-473.891] (-473.419) (-477.128) (-473.737) * (-477.530) (-472.638) [-474.641] (-475.320) -- 0:00:35
Average standard deviation of split frequencies: 0.010065
415500 -- (-473.091) [-475.098] (-473.975) (-472.874) * [-475.460] (-477.321) (-473.001) (-476.315) -- 0:00:35
416000 -- (-473.978) (-475.569) (-473.232) [-473.279] * [-473.254] (-474.115) (-474.545) (-474.622) -- 0:00:35
416500 -- (-475.454) (-475.045) (-473.413) [-474.303] * (-473.089) (-477.813) (-472.696) [-473.578] -- 0:00:35
417000 -- (-473.728) (-474.523) [-473.973] (-474.658) * [-474.602] (-479.092) (-473.183) (-474.150) -- 0:00:34
417500 -- (-474.509) (-477.744) [-473.728] (-475.518) * [-476.538] (-473.153) (-473.229) (-472.434) -- 0:00:34
418000 -- (-475.509) (-478.657) [-473.008] (-476.277) * (-477.859) (-472.475) [-472.677] (-475.188) -- 0:00:34
418500 -- (-476.046) [-472.614] (-475.579) (-473.828) * (-476.857) [-475.394] (-473.578) (-475.077) -- 0:00:34
419000 -- [-473.337] (-472.472) (-474.225) (-473.905) * (-473.066) (-474.356) [-472.895] (-475.160) -- 0:00:34
419500 -- (-474.132) [-472.467] (-474.851) (-478.383) * [-473.352] (-476.959) (-474.199) (-481.954) -- 0:00:34
420000 -- (-472.549) [-472.913] (-475.434) (-474.347) * (-477.097) (-476.336) [-473.416] (-475.854) -- 0:00:34
Average standard deviation of split frequencies: 0.010020
420500 -- (-473.048) [-475.315] (-473.648) (-475.257) * (-474.084) (-474.845) [-473.034] (-473.831) -- 0:00:34
421000 -- (-475.493) (-474.848) (-475.362) [-476.572] * (-479.242) (-476.666) [-473.365] (-474.647) -- 0:00:34
421500 -- (-477.139) [-473.024] (-480.924) (-475.484) * (-474.634) (-475.492) [-473.570] (-475.169) -- 0:00:34
422000 -- (-474.292) (-477.139) (-474.791) [-473.961] * [-475.576] (-480.407) (-476.901) (-478.075) -- 0:00:34
422500 -- (-473.724) (-475.234) [-474.304] (-473.970) * [-473.909] (-480.754) (-472.854) (-475.620) -- 0:00:34
423000 -- [-472.257] (-476.256) (-474.710) (-477.353) * [-473.019] (-477.074) (-480.504) (-475.213) -- 0:00:34
423500 -- [-474.154] (-474.750) (-474.221) (-472.819) * [-479.769] (-472.409) (-475.815) (-474.712) -- 0:00:34
424000 -- [-476.511] (-477.026) (-475.908) (-474.870) * [-476.205] (-477.744) (-478.172) (-473.443) -- 0:00:33
424500 -- [-474.045] (-477.706) (-473.831) (-475.713) * (-473.946) (-475.009) (-472.666) [-474.224] -- 0:00:33
425000 -- (-474.256) (-475.588) [-474.187] (-474.838) * (-473.461) [-475.734] (-479.341) (-473.749) -- 0:00:33
Average standard deviation of split frequencies: 0.009439
425500 -- (-473.343) (-474.329) [-479.185] (-474.278) * (-473.261) (-476.157) [-474.280] (-478.067) -- 0:00:33
426000 -- (-476.836) [-474.236] (-479.724) (-473.302) * (-472.767) (-477.505) (-474.469) [-474.909] -- 0:00:33
426500 -- (-476.025) (-473.481) [-476.645] (-473.346) * (-478.764) (-473.100) [-474.636] (-477.710) -- 0:00:33
427000 -- [-475.526] (-475.560) (-474.115) (-474.493) * (-473.715) [-473.647] (-475.014) (-475.297) -- 0:00:33
427500 -- (-474.056) (-473.916) (-477.216) [-475.925] * (-472.520) [-473.126] (-478.129) (-474.725) -- 0:00:33
428000 -- (-474.407) (-476.855) (-478.691) [-473.635] * (-473.647) [-474.842] (-473.207) (-473.678) -- 0:00:33
428500 -- (-473.265) [-473.398] (-478.162) (-473.242) * (-474.076) (-474.786) [-473.486] (-476.960) -- 0:00:33
429000 -- (-473.880) (-473.450) [-473.466] (-474.547) * [-474.184] (-473.885) (-473.891) (-476.282) -- 0:00:33
429500 -- (-472.846) (-476.002) [-476.035] (-475.242) * (-476.392) (-473.892) [-475.777] (-474.139) -- 0:00:33
430000 -- (-474.253) (-474.551) (-472.409) [-475.198] * (-474.207) [-473.322] (-475.606) (-473.704) -- 0:00:33
Average standard deviation of split frequencies: 0.008370
430500 -- (-476.296) (-474.834) [-472.654] (-474.437) * (-474.904) (-473.973) [-474.804] (-478.687) -- 0:00:33
431000 -- (-475.690) (-472.625) (-475.868) [-475.967] * [-474.287] (-473.309) (-476.668) (-475.232) -- 0:00:34
431500 -- (-477.371) (-473.166) (-476.021) [-478.408] * (-472.948) (-476.471) [-473.974] (-473.296) -- 0:00:34
432000 -- (-478.726) [-475.211] (-473.327) (-475.745) * [-473.084] (-475.416) (-473.640) (-473.296) -- 0:00:34
432500 -- (-477.384) [-474.423] (-472.654) (-474.793) * (-473.331) (-474.669) [-473.274] (-476.721) -- 0:00:34
433000 -- [-472.676] (-472.596) (-473.281) (-473.034) * (-474.489) (-474.348) (-473.505) [-474.451] -- 0:00:34
433500 -- (-473.680) [-473.177] (-472.892) (-475.184) * (-475.384) [-475.323] (-473.570) (-474.246) -- 0:00:33
434000 -- [-472.592] (-474.033) (-473.212) (-475.191) * [-473.470] (-475.822) (-474.105) (-478.266) -- 0:00:33
434500 -- [-475.507] (-472.795) (-475.107) (-472.876) * [-474.026] (-476.913) (-473.468) (-472.348) -- 0:00:33
435000 -- (-473.630) (-472.783) [-473.574] (-475.514) * (-473.180) (-473.217) (-475.277) [-473.462] -- 0:00:33
Average standard deviation of split frequencies: 0.007771
435500 -- (-474.198) (-473.319) (-474.579) [-476.149] * (-475.742) [-472.389] (-474.484) (-474.149) -- 0:00:33
436000 -- [-474.418] (-478.864) (-474.660) (-473.251) * [-476.942] (-473.120) (-480.998) (-473.084) -- 0:00:33
436500 -- (-476.668) (-474.094) (-473.405) [-475.038] * (-473.644) [-472.526] (-475.451) (-473.801) -- 0:00:33
437000 -- (-474.072) [-475.132] (-476.501) (-474.931) * (-474.289) (-475.683) (-472.357) [-472.620] -- 0:00:33
437500 -- (-473.854) (-472.817) [-474.294] (-473.590) * [-473.035] (-473.768) (-475.253) (-477.037) -- 0:00:33
438000 -- (-476.196) (-483.154) [-473.765] (-475.299) * (-474.098) (-475.603) [-472.931] (-477.878) -- 0:00:33
438500 -- (-474.287) [-472.497] (-475.535) (-474.926) * (-476.049) (-473.922) (-478.595) [-476.215] -- 0:00:33
439000 -- (-474.413) (-472.500) (-474.664) [-478.417] * [-474.737] (-473.265) (-474.681) (-473.924) -- 0:00:33
439500 -- (-474.027) (-472.458) [-476.312] (-475.382) * (-473.634) (-476.631) (-472.631) [-472.935] -- 0:00:33
440000 -- [-474.600] (-476.101) (-477.876) (-474.476) * (-474.756) (-473.798) (-472.896) [-474.463] -- 0:00:33
Average standard deviation of split frequencies: 0.006753
440500 -- (-472.386) (-474.995) (-475.235) [-476.877] * (-480.562) (-475.947) [-476.448] (-474.934) -- 0:00:33
441000 -- (-472.778) (-473.012) [-474.968] (-473.069) * (-476.206) (-474.351) [-473.824] (-473.652) -- 0:00:32
441500 -- (-473.050) (-474.303) (-475.095) [-473.189] * (-475.015) (-473.078) (-475.455) [-474.420] -- 0:00:32
442000 -- (-475.910) [-472.291] (-475.850) (-473.410) * (-474.943) (-475.589) (-482.078) [-473.904] -- 0:00:32
442500 -- (-472.330) (-472.851) [-475.009] (-473.379) * (-476.665) [-474.118] (-473.966) (-474.513) -- 0:00:32
443000 -- [-472.444] (-478.151) (-477.009) (-473.603) * [-473.444] (-475.748) (-473.564) (-475.015) -- 0:00:32
443500 -- (-475.392) (-475.564) (-477.223) [-474.296] * (-472.610) [-475.703] (-475.785) (-473.776) -- 0:00:32
444000 -- (-477.975) [-475.082] (-474.441) (-476.786) * (-472.711) (-474.558) [-479.966] (-478.387) -- 0:00:32
444500 -- (-473.575) (-481.797) (-477.478) [-474.308] * (-475.733) [-473.317] (-476.350) (-476.798) -- 0:00:32
445000 -- (-475.886) (-475.135) [-475.077] (-473.436) * [-474.294] (-474.841) (-476.986) (-472.446) -- 0:00:32
Average standard deviation of split frequencies: 0.007201
445500 -- [-474.663] (-473.046) (-475.263) (-474.556) * (-473.796) (-476.508) [-473.734] (-474.802) -- 0:00:32
446000 -- (-474.700) [-474.401] (-475.898) (-473.326) * (-472.791) [-472.441] (-473.588) (-475.952) -- 0:00:32
446500 -- (-473.800) (-474.947) (-479.744) [-473.464] * [-477.424] (-474.705) (-472.762) (-476.292) -- 0:00:32
447000 -- (-479.507) (-474.040) (-474.325) [-476.430] * (-477.925) (-475.694) (-472.540) [-473.125] -- 0:00:32
447500 -- (-474.115) [-475.321] (-473.511) (-476.321) * (-477.135) (-473.983) [-473.354] (-472.287) -- 0:00:32
448000 -- (-473.686) (-474.109) [-474.718] (-477.331) * (-477.315) [-472.514] (-474.676) (-473.426) -- 0:00:33
448500 -- (-474.163) (-474.007) [-474.522] (-478.308) * [-476.540] (-472.825) (-474.123) (-474.598) -- 0:00:33
449000 -- (-478.214) (-474.772) (-477.089) [-475.710] * [-475.994] (-474.695) (-474.500) (-476.596) -- 0:00:33
449500 -- (-473.895) (-473.477) [-475.775] (-480.051) * (-474.744) [-477.323] (-474.381) (-478.552) -- 0:00:33
450000 -- (-474.600) [-472.735] (-475.912) (-473.339) * [-473.290] (-475.627) (-478.343) (-472.137) -- 0:00:33
Average standard deviation of split frequencies: 0.006211
450500 -- (-475.518) (-474.143) [-473.639] (-473.462) * (-474.873) (-473.677) (-473.565) [-475.140] -- 0:00:32
451000 -- (-473.053) (-474.049) (-473.190) [-473.624] * (-473.986) [-473.151] (-473.101) (-475.540) -- 0:00:32
451500 -- (-472.879) (-473.859) (-475.556) [-472.639] * [-473.823] (-475.653) (-476.310) (-472.801) -- 0:00:32
452000 -- (-473.613) (-472.660) (-473.514) [-473.927] * [-475.200] (-479.137) (-473.479) (-474.738) -- 0:00:32
452500 -- [-474.017] (-475.216) (-475.145) (-476.267) * (-473.593) [-480.043] (-474.313) (-473.918) -- 0:00:32
453000 -- (-474.948) [-474.977] (-474.046) (-473.470) * [-472.443] (-474.143) (-472.707) (-478.645) -- 0:00:32
453500 -- (-474.209) (-479.131) [-476.169] (-478.550) * (-474.798) [-474.143] (-473.901) (-476.306) -- 0:00:32
454000 -- (-474.518) (-477.852) (-473.931) [-473.466] * (-478.262) (-475.534) [-475.799] (-473.500) -- 0:00:32
454500 -- (-476.255) [-477.477] (-473.425) (-475.406) * [-473.757] (-474.697) (-474.124) (-477.006) -- 0:00:32
455000 -- (-479.184) (-477.695) [-472.865] (-475.079) * (-473.033) [-472.910] (-474.558) (-473.169) -- 0:00:32
Average standard deviation of split frequencies: 0.007236
455500 -- (-476.770) (-475.569) (-473.159) [-473.100] * [-473.187] (-472.498) (-477.415) (-475.702) -- 0:00:32
456000 -- (-475.068) (-473.494) (-472.336) [-472.886] * [-472.430] (-473.571) (-475.014) (-475.639) -- 0:00:32
456500 -- (-473.344) [-474.054] (-472.732) (-474.743) * (-473.923) [-474.000] (-473.831) (-476.402) -- 0:00:32
457000 -- (-477.722) [-473.591] (-475.724) (-473.867) * (-472.982) (-473.123) [-473.861] (-474.340) -- 0:00:32
457500 -- (-473.790) (-473.331) [-478.079] (-473.974) * (-476.310) (-474.535) [-473.227] (-474.824) -- 0:00:32
458000 -- (-476.225) [-473.594] (-480.040) (-475.376) * [-473.013] (-476.733) (-472.458) (-473.979) -- 0:00:31
458500 -- (-474.713) (-476.587) (-475.336) [-473.242] * [-473.016] (-476.254) (-474.145) (-474.863) -- 0:00:31
459000 -- (-473.237) (-476.241) (-475.235) [-473.621] * (-474.920) (-476.090) (-474.445) [-474.720] -- 0:00:31
459500 -- (-473.543) (-477.690) (-474.972) [-474.497] * (-478.556) [-475.147] (-473.867) (-474.226) -- 0:00:31
460000 -- [-477.498] (-475.148) (-473.910) (-476.862) * (-478.527) (-476.512) [-474.351] (-475.109) -- 0:00:31
Average standard deviation of split frequencies: 0.007867
460500 -- (-474.126) (-474.112) (-475.379) [-475.687] * (-474.784) (-475.176) (-478.818) [-475.110] -- 0:00:31
461000 -- (-475.628) [-480.003] (-474.137) (-475.124) * (-474.056) (-475.880) [-474.073] (-474.084) -- 0:00:31
461500 -- (-474.015) (-477.002) (-474.011) [-474.366] * (-474.459) (-474.586) (-475.040) [-473.356] -- 0:00:31
462000 -- [-472.909] (-475.942) (-475.191) (-473.958) * [-473.100] (-475.785) (-475.257) (-473.121) -- 0:00:31
462500 -- (-475.851) [-472.945] (-474.249) (-476.597) * (-475.904) (-475.607) [-474.246] (-473.697) -- 0:00:31
463000 -- (-476.733) (-474.849) [-474.568] (-474.558) * (-475.743) (-475.312) [-473.542] (-478.093) -- 0:00:31
463500 -- (-474.332) (-475.513) (-472.710) [-473.953] * (-477.866) (-473.541) [-472.982] (-472.995) -- 0:00:31
464000 -- (-473.727) [-474.519] (-473.890) (-473.468) * (-475.957) [-473.865] (-473.057) (-472.747) -- 0:00:31
464500 -- (-476.571) (-474.912) [-475.771] (-479.271) * [-472.946] (-472.728) (-474.757) (-476.487) -- 0:00:31
465000 -- (-475.209) [-475.408] (-475.943) (-475.186) * (-472.452) [-475.364] (-475.644) (-473.912) -- 0:00:32
Average standard deviation of split frequencies: 0.007688
465500 -- (-475.225) (-473.921) [-473.816] (-475.464) * [-472.835] (-482.967) (-474.499) (-474.039) -- 0:00:32
466000 -- [-473.161] (-473.029) (-474.507) (-473.612) * (-473.577) (-480.076) [-472.671] (-474.482) -- 0:00:32
466500 -- (-473.067) [-474.190] (-476.029) (-476.769) * (-472.510) (-476.147) [-472.843] (-474.635) -- 0:00:32
467000 -- [-473.023] (-474.022) (-474.090) (-474.430) * (-473.578) [-475.081] (-476.477) (-472.734) -- 0:00:31
467500 -- (-473.350) (-478.635) (-477.039) [-475.215] * [-472.837] (-475.208) (-479.155) (-473.402) -- 0:00:31
468000 -- (-476.694) (-477.223) [-473.577] (-475.610) * (-473.998) (-476.317) (-475.462) [-473.442] -- 0:00:31
468500 -- (-475.190) (-478.646) [-477.946] (-475.383) * (-472.553) (-475.105) (-474.458) [-472.949] -- 0:00:31
469000 -- (-474.770) (-478.305) (-478.659) [-473.644] * [-478.599] (-474.686) (-473.690) (-472.886) -- 0:00:31
469500 -- (-477.735) (-475.291) [-476.747] (-472.529) * (-473.318) (-475.245) [-473.694] (-472.895) -- 0:00:31
470000 -- (-481.573) (-476.130) (-475.975) [-474.906] * (-473.641) (-474.466) [-472.968] (-474.931) -- 0:00:31
Average standard deviation of split frequencies: 0.007574
470500 -- (-474.292) [-475.507] (-474.213) (-473.276) * (-474.905) (-473.332) (-474.629) [-476.375] -- 0:00:31
471000 -- (-473.365) (-473.362) [-473.217] (-478.525) * (-472.545) [-473.378] (-478.520) (-472.973) -- 0:00:31
471500 -- (-475.324) [-473.813] (-477.825) (-474.045) * [-475.388] (-476.397) (-476.458) (-476.155) -- 0:00:31
472000 -- (-474.186) (-473.863) (-481.456) [-474.747] * (-474.311) [-473.399] (-474.366) (-477.890) -- 0:00:31
472500 -- [-473.270] (-474.478) (-473.731) (-473.607) * (-476.516) (-473.712) [-474.439] (-476.922) -- 0:00:31
473000 -- (-474.103) (-476.416) [-474.353] (-474.732) * (-473.748) (-473.953) [-473.409] (-475.184) -- 0:00:31
473500 -- [-474.864] (-472.764) (-473.208) (-473.269) * (-476.001) [-475.887] (-473.761) (-477.621) -- 0:00:31
474000 -- (-480.271) (-473.602) (-474.926) [-474.429] * (-474.851) [-473.966] (-478.875) (-475.542) -- 0:00:31
474500 -- (-475.092) [-474.503] (-476.123) (-472.674) * (-474.523) (-473.065) (-477.170) [-473.097] -- 0:00:31
475000 -- (-473.153) (-477.163) (-473.139) [-474.733] * (-474.919) [-476.131] (-474.425) (-474.246) -- 0:00:30
Average standard deviation of split frequencies: 0.007366
475500 -- [-473.943] (-473.779) (-473.365) (-474.141) * (-475.912) (-476.620) [-472.948] (-476.302) -- 0:00:30
476000 -- (-475.148) (-476.064) [-473.136] (-475.900) * (-476.639) [-474.059] (-475.056) (-477.752) -- 0:00:30
476500 -- (-475.366) (-473.909) (-478.690) [-476.924] * (-477.248) (-475.987) (-477.285) [-472.641] -- 0:00:30
477000 -- (-474.147) [-473.635] (-473.364) (-476.513) * (-474.000) (-475.451) (-477.592) [-472.626] -- 0:00:30
477500 -- (-473.979) (-473.605) (-474.973) [-474.343] * (-473.888) (-477.576) [-473.207] (-473.673) -- 0:00:30
478000 -- (-473.383) (-475.892) (-474.925) [-472.463] * (-477.647) (-472.480) (-473.746) [-474.782] -- 0:00:30
478500 -- (-476.313) (-476.546) [-474.693] (-477.976) * [-475.212] (-475.313) (-476.271) (-472.649) -- 0:00:30
479000 -- (-475.528) [-477.962] (-473.437) (-473.535) * (-472.527) (-477.446) (-478.773) [-475.207] -- 0:00:30
479500 -- (-472.945) (-474.929) [-476.597] (-475.203) * (-476.173) (-477.596) [-481.619] (-472.944) -- 0:00:30
480000 -- (-475.766) (-475.798) [-475.954] (-475.689) * (-475.939) (-475.221) [-472.735] (-472.733) -- 0:00:30
Average standard deviation of split frequencies: 0.007257
480500 -- (-472.723) (-473.434) (-474.758) [-474.812] * (-476.465) (-473.522) (-480.586) [-473.003] -- 0:00:30
481000 -- [-473.190] (-477.023) (-474.051) (-474.976) * (-477.167) (-475.521) (-473.564) [-472.643] -- 0:00:30
481500 -- [-474.670] (-483.203) (-474.347) (-474.409) * [-474.603] (-477.967) (-474.071) (-473.860) -- 0:00:30
482000 -- (-472.965) [-477.360] (-476.251) (-472.941) * (-477.456) (-479.158) [-474.785] (-474.688) -- 0:00:31
482500 -- (-474.507) (-474.059) [-475.565] (-473.558) * (-477.468) (-475.331) [-475.255] (-472.215) -- 0:00:31
483000 -- (-476.479) (-475.725) [-475.235] (-472.585) * (-474.758) [-478.041] (-474.520) (-472.542) -- 0:00:31
483500 -- [-479.343] (-472.878) (-475.431) (-472.688) * [-475.329] (-474.980) (-473.585) (-473.138) -- 0:00:30
484000 -- (-473.603) (-473.182) [-473.578] (-474.212) * (-475.008) (-473.155) (-473.267) [-473.500] -- 0:00:30
484500 -- [-474.088] (-475.516) (-472.102) (-474.934) * (-474.668) (-476.512) [-473.059] (-472.427) -- 0:00:30
485000 -- (-473.093) [-475.388] (-474.807) (-472.655) * (-474.894) (-473.982) [-474.052] (-472.222) -- 0:00:30
Average standard deviation of split frequencies: 0.007214
485500 -- [-477.190] (-475.854) (-473.336) (-472.931) * (-475.335) [-475.250] (-474.293) (-476.411) -- 0:00:30
486000 -- (-481.492) (-475.124) (-473.134) [-473.661] * [-473.836] (-474.011) (-476.126) (-474.790) -- 0:00:30
486500 -- [-475.112] (-472.782) (-474.495) (-475.531) * (-473.835) (-472.863) [-473.355] (-475.772) -- 0:00:30
487000 -- (-478.727) (-474.534) (-474.019) [-474.446] * (-475.910) (-474.052) [-474.025] (-474.127) -- 0:00:30
487500 -- (-473.346) (-473.358) [-474.332] (-475.668) * (-475.649) (-472.714) [-473.005] (-477.236) -- 0:00:30
488000 -- (-474.611) [-473.707] (-472.757) (-476.397) * (-476.760) [-473.509] (-476.461) (-477.182) -- 0:00:30
488500 -- [-474.442] (-473.920) (-473.651) (-476.373) * (-476.747) [-473.763] (-477.582) (-478.170) -- 0:00:30
489000 -- (-473.446) (-482.010) (-473.734) [-474.123] * (-475.014) (-474.323) (-475.484) [-473.834] -- 0:00:30
489500 -- (-475.054) (-475.507) (-474.284) [-474.980] * [-472.905] (-477.946) (-475.041) (-475.500) -- 0:00:30
490000 -- (-475.159) (-473.918) [-474.807] (-475.991) * (-474.217) (-473.781) (-474.508) [-476.055] -- 0:00:30
Average standard deviation of split frequencies: 0.007806
490500 -- (-472.732) (-475.464) (-477.200) [-474.795] * [-474.548] (-477.522) (-475.687) (-476.077) -- 0:00:30
491000 -- (-474.044) (-476.487) (-473.345) [-477.890] * (-476.244) [-472.790] (-476.342) (-477.964) -- 0:00:30
491500 -- [-473.443] (-475.249) (-474.252) (-477.616) * (-474.356) [-476.250] (-473.433) (-474.057) -- 0:00:30
492000 -- [-479.962] (-475.114) (-473.149) (-474.323) * (-474.712) [-473.181] (-474.515) (-473.691) -- 0:00:29
492500 -- (-473.997) (-475.819) (-474.323) [-476.316] * [-475.645] (-475.127) (-473.816) (-475.127) -- 0:00:29
493000 -- (-474.369) [-473.842] (-474.253) (-474.802) * (-472.950) (-473.212) (-478.118) [-474.872] -- 0:00:29
493500 -- (-474.054) (-476.980) (-474.170) [-472.919] * (-472.544) [-474.750] (-473.384) (-475.459) -- 0:00:29
494000 -- (-474.270) (-475.218) [-473.475] (-476.900) * [-474.787] (-475.862) (-473.462) (-477.341) -- 0:00:29
494500 -- (-476.300) (-475.836) [-473.372] (-478.362) * (-477.672) (-475.791) [-474.060] (-473.091) -- 0:00:29
495000 -- [-473.898] (-474.146) (-473.615) (-477.963) * (-473.034) [-476.895] (-480.274) (-476.632) -- 0:00:29
Average standard deviation of split frequencies: 0.007722
495500 -- (-474.036) (-473.885) [-473.613] (-474.293) * (-475.872) [-474.388] (-473.682) (-475.523) -- 0:00:29
496000 -- (-476.703) (-476.927) [-474.121] (-473.855) * (-473.705) (-478.822) [-477.719] (-477.625) -- 0:00:29
496500 -- (-479.016) [-474.191] (-472.460) (-475.181) * (-474.519) (-474.905) [-476.081] (-475.334) -- 0:00:29
497000 -- (-475.163) (-475.069) (-472.682) [-474.124] * (-474.285) [-475.817] (-473.924) (-473.669) -- 0:00:29
497500 -- (-475.720) (-478.799) [-473.315] (-475.922) * (-479.470) (-472.873) [-474.220] (-476.146) -- 0:00:29
498000 -- [-475.520] (-475.481) (-476.985) (-477.112) * (-478.335) (-474.314) [-474.108] (-473.142) -- 0:00:29
498500 -- (-474.498) [-472.946] (-479.931) (-475.349) * (-472.926) [-477.472] (-474.021) (-476.800) -- 0:00:29
499000 -- (-480.023) (-473.973) [-472.597] (-475.433) * [-477.252] (-473.839) (-472.484) (-474.276) -- 0:00:30
499500 -- (-479.565) (-476.622) [-473.228] (-474.789) * (-476.605) (-472.930) (-475.728) [-475.220] -- 0:00:30
500000 -- [-473.577] (-477.060) (-473.770) (-476.514) * (-474.146) [-474.493] (-473.951) (-476.090) -- 0:00:30
Average standard deviation of split frequencies: 0.007415
500500 -- [-475.241] (-476.287) (-474.310) (-477.950) * (-474.681) [-473.652] (-472.990) (-473.691) -- 0:00:29
501000 -- (-473.375) (-477.775) (-476.759) [-476.078] * (-477.984) (-473.646) [-473.992] (-475.324) -- 0:00:29
501500 -- (-475.686) (-479.490) (-473.862) [-476.335] * (-475.203) [-474.127] (-474.386) (-473.827) -- 0:00:29
502000 -- [-474.458] (-477.168) (-473.727) (-475.727) * (-476.320) [-473.657] (-474.548) (-476.717) -- 0:00:29
502500 -- (-475.057) (-475.617) [-474.397] (-475.575) * [-474.032] (-473.185) (-473.068) (-475.445) -- 0:00:29
503000 -- [-472.609] (-475.110) (-473.487) (-472.708) * (-480.284) (-476.120) (-474.173) [-478.235] -- 0:00:29
503500 -- (-472.845) [-481.172] (-473.336) (-475.084) * (-479.976) (-474.166) (-474.245) [-478.366] -- 0:00:29
504000 -- (-474.117) (-476.302) [-473.152] (-476.785) * (-472.529) [-473.231] (-476.195) (-473.833) -- 0:00:29
504500 -- (-473.487) (-473.289) (-475.714) [-474.436] * (-476.008) (-473.539) [-475.036] (-476.014) -- 0:00:29
505000 -- [-475.355] (-474.264) (-474.952) (-474.875) * (-474.248) (-474.140) [-475.710] (-480.540) -- 0:00:29
Average standard deviation of split frequencies: 0.007511
505500 -- (-474.111) [-475.745] (-475.904) (-474.361) * (-474.251) (-474.027) [-481.625] (-477.197) -- 0:00:29
506000 -- [-476.230] (-476.424) (-472.270) (-475.134) * (-473.935) (-475.152) [-474.809] (-474.505) -- 0:00:29
506500 -- [-475.159] (-475.400) (-473.855) (-474.033) * [-473.087] (-474.511) (-477.951) (-472.896) -- 0:00:29
507000 -- (-474.596) (-472.502) (-473.026) [-473.454] * [-472.875] (-478.049) (-475.867) (-474.876) -- 0:00:29
507500 -- (-476.078) [-475.571] (-474.761) (-476.625) * (-472.310) (-474.072) [-474.220] (-473.944) -- 0:00:29
508000 -- (-473.413) (-475.324) (-475.893) [-477.526] * (-477.028) [-474.792] (-473.253) (-472.805) -- 0:00:29
508500 -- (-477.451) (-475.711) [-474.496] (-474.249) * (-474.468) (-474.341) (-473.224) [-473.909] -- 0:00:28
509000 -- [-472.896] (-473.281) (-473.164) (-474.213) * (-474.327) [-474.604] (-473.306) (-475.351) -- 0:00:28
509500 -- (-474.872) [-472.958] (-474.716) (-475.855) * (-475.905) (-474.413) (-474.168) [-476.525] -- 0:00:28
510000 -- (-476.853) (-476.468) [-484.661] (-476.554) * (-476.324) [-473.492] (-473.457) (-476.763) -- 0:00:28
Average standard deviation of split frequencies: 0.007731
510500 -- (-474.904) [-475.699] (-475.936) (-473.519) * (-476.303) (-478.205) (-478.098) [-472.873] -- 0:00:28
511000 -- (-472.194) (-475.895) [-474.283] (-473.728) * (-474.096) [-475.211] (-472.856) (-474.307) -- 0:00:28
511500 -- (-472.752) (-474.724) [-475.664] (-475.244) * (-473.298) (-476.911) (-475.008) [-476.756] -- 0:00:28
512000 -- (-474.152) [-474.327] (-472.584) (-475.346) * (-475.322) (-478.252) [-476.892] (-473.542) -- 0:00:28
512500 -- (-474.303) (-476.081) (-474.243) [-475.204] * (-474.624) (-481.583) (-475.070) [-474.480] -- 0:00:28
513000 -- (-474.884) (-480.178) [-475.001] (-473.883) * (-476.742) (-474.873) [-476.377] (-476.454) -- 0:00:28
513500 -- (-476.500) (-475.026) (-475.972) [-473.748] * (-473.121) (-477.958) (-474.040) [-473.421] -- 0:00:28
514000 -- (-474.171) (-473.047) [-473.754] (-474.919) * [-473.191] (-476.620) (-479.013) (-477.568) -- 0:00:28
514500 -- (-474.264) (-474.547) (-474.731) [-476.694] * [-475.846] (-475.516) (-475.283) (-475.316) -- 0:00:28
515000 -- [-478.141] (-475.787) (-474.178) (-474.945) * [-473.660] (-472.800) (-476.944) (-473.237) -- 0:00:28
Average standard deviation of split frequencies: 0.008336
515500 -- [-474.491] (-476.344) (-476.434) (-473.373) * [-480.951] (-474.705) (-474.436) (-473.341) -- 0:00:29
516000 -- (-476.760) (-474.205) (-475.148) [-472.770] * (-480.769) [-474.744] (-474.140) (-475.161) -- 0:00:29
516500 -- (-476.274) (-478.652) (-473.309) [-473.841] * (-474.968) (-479.724) [-474.686] (-474.623) -- 0:00:29
517000 -- (-475.933) (-474.790) (-475.530) [-475.463] * [-476.272] (-478.339) (-474.362) (-477.269) -- 0:00:28
517500 -- (-474.960) (-475.424) (-474.093) [-474.708] * (-476.433) (-476.414) (-478.207) [-477.079] -- 0:00:28
518000 -- (-475.551) [-473.290] (-472.463) (-472.623) * (-477.178) (-476.226) (-473.538) [-477.674] -- 0:00:28
518500 -- [-473.511] (-473.521) (-475.067) (-476.473) * [-473.132] (-473.390) (-473.806) (-473.979) -- 0:00:28
519000 -- (-473.910) (-477.343) (-474.615) [-475.518] * [-473.683] (-476.949) (-476.372) (-472.207) -- 0:00:28
519500 -- (-475.067) (-475.531) [-475.325] (-474.394) * (-474.420) (-473.385) (-473.603) [-473.382] -- 0:00:28
520000 -- [-473.310] (-475.271) (-474.798) (-473.803) * (-474.797) [-476.143] (-476.828) (-475.191) -- 0:00:28
Average standard deviation of split frequencies: 0.008148
520500 -- (-475.902) (-479.535) (-476.072) [-472.985] * [-473.135] (-475.133) (-476.996) (-474.566) -- 0:00:28
521000 -- (-474.036) (-475.307) (-473.184) [-474.414] * [-472.883] (-472.985) (-473.061) (-476.757) -- 0:00:28
521500 -- [-476.392] (-478.561) (-475.652) (-473.042) * (-475.235) [-473.570] (-473.627) (-475.733) -- 0:00:28
522000 -- [-473.972] (-474.823) (-477.487) (-473.141) * (-475.320) (-474.288) [-473.482] (-477.607) -- 0:00:28
522500 -- [-474.777] (-476.665) (-474.189) (-472.440) * (-476.166) (-473.587) (-473.329) [-473.914] -- 0:00:28
523000 -- (-474.942) (-474.545) [-474.379] (-473.927) * (-480.807) (-473.992) [-473.273] (-473.871) -- 0:00:28
523500 -- (-473.481) (-474.443) [-475.678] (-474.923) * (-482.894) [-473.678] (-476.231) (-474.299) -- 0:00:28
524000 -- (-473.931) (-472.440) [-473.114] (-474.295) * (-476.260) [-473.571] (-473.304) (-476.800) -- 0:00:28
524500 -- (-476.938) (-473.925) (-472.892) [-473.296] * (-474.098) (-477.475) (-472.389) [-472.247] -- 0:00:28
525000 -- (-474.084) (-476.234) (-474.993) [-475.613] * (-473.534) [-473.399] (-473.347) (-475.294) -- 0:00:28
Average standard deviation of split frequencies: 0.008290
525500 -- (-475.002) (-473.855) [-473.691] (-473.366) * [-477.724] (-474.551) (-472.676) (-481.563) -- 0:00:27
526000 -- (-474.819) [-473.163] (-476.540) (-473.243) * (-478.931) (-473.855) [-473.886] (-476.582) -- 0:00:27
526500 -- (-475.834) (-474.246) [-474.907] (-472.319) * [-477.701] (-474.115) (-474.977) (-474.599) -- 0:00:27
527000 -- (-474.929) (-474.673) [-473.073] (-473.020) * [-473.538] (-475.263) (-475.151) (-474.460) -- 0:00:27
527500 -- [-473.304] (-475.319) (-474.468) (-473.305) * (-474.516) (-472.748) (-474.791) [-473.367] -- 0:00:27
528000 -- (-473.304) (-474.405) [-473.352] (-473.213) * (-473.245) (-473.871) (-473.334) [-472.910] -- 0:00:27
528500 -- (-475.310) [-476.766] (-475.638) (-475.336) * [-475.170] (-473.450) (-477.477) (-473.104) -- 0:00:27
529000 -- (-476.410) [-474.524] (-482.806) (-473.202) * (-472.832) (-472.154) [-476.028] (-475.194) -- 0:00:27
529500 -- (-474.263) (-473.817) (-475.173) [-473.275] * (-476.210) [-473.091] (-473.625) (-473.262) -- 0:00:27
530000 -- (-473.947) (-474.277) (-474.070) [-472.977] * (-476.740) (-473.766) [-474.090] (-472.708) -- 0:00:27
Average standard deviation of split frequencies: 0.007662
530500 -- (-472.708) (-476.781) [-474.237] (-475.389) * (-475.483) (-476.887) (-474.686) [-472.695] -- 0:00:27
531000 -- [-472.727] (-475.948) (-474.086) (-477.728) * (-472.523) (-476.841) [-472.395] (-474.031) -- 0:00:27
531500 -- [-474.478] (-473.931) (-475.431) (-474.982) * (-475.138) (-474.219) [-472.800] (-474.636) -- 0:00:27
532000 -- (-474.779) (-475.389) (-480.493) [-475.264] * [-474.137] (-477.071) (-473.515) (-473.788) -- 0:00:27
532500 -- (-476.194) (-474.202) (-477.040) [-472.993] * (-475.672) [-475.099] (-474.594) (-476.864) -- 0:00:27
533000 -- [-475.264] (-474.225) (-474.350) (-473.019) * (-473.682) (-474.041) (-474.330) [-476.840] -- 0:00:28
533500 -- (-472.756) (-472.890) (-475.410) [-473.099] * (-474.022) [-475.007] (-475.353) (-475.441) -- 0:00:27
534000 -- (-473.665) (-472.667) (-475.670) [-474.294] * [-477.604] (-476.474) (-474.401) (-473.745) -- 0:00:27
534500 -- (-473.919) (-478.047) (-476.122) [-477.517] * (-477.559) (-476.272) (-473.844) [-473.879] -- 0:00:27
535000 -- [-474.159] (-477.401) (-474.082) (-472.599) * [-473.397] (-476.618) (-474.077) (-472.863) -- 0:00:27
Average standard deviation of split frequencies: 0.008025
535500 -- [-473.942] (-474.525) (-478.722) (-474.386) * (-473.537) (-472.750) [-476.290] (-472.953) -- 0:00:27
536000 -- [-472.868] (-476.525) (-473.957) (-473.744) * (-483.184) (-473.751) [-479.652] (-473.139) -- 0:00:27
536500 -- (-474.044) (-475.698) [-473.773] (-474.414) * [-473.681] (-475.472) (-472.655) (-477.981) -- 0:00:27
537000 -- (-472.770) [-472.834] (-477.100) (-474.438) * (-473.814) (-474.494) (-473.301) [-473.823] -- 0:00:27
537500 -- (-472.746) (-472.809) (-473.316) [-474.526] * (-472.397) [-474.958] (-475.578) (-475.459) -- 0:00:27
538000 -- [-472.918] (-477.428) (-472.914) (-474.234) * [-474.295] (-474.279) (-473.716) (-476.162) -- 0:00:27
538500 -- (-476.456) [-474.342] (-475.358) (-473.665) * (-476.866) (-472.497) (-474.941) [-474.299] -- 0:00:27
539000 -- (-473.078) [-473.930] (-477.266) (-472.521) * (-475.434) [-474.878] (-475.570) (-473.201) -- 0:00:27
539500 -- (-472.963) (-475.987) (-473.573) [-473.564] * [-475.918] (-473.378) (-474.319) (-473.724) -- 0:00:27
540000 -- (-473.750) (-473.919) (-475.420) [-477.016] * [-473.460] (-475.312) (-475.075) (-473.958) -- 0:00:27
Average standard deviation of split frequencies: 0.007905
540500 -- (-474.791) [-472.700] (-476.061) (-482.172) * (-473.472) (-476.764) [-474.441] (-475.615) -- 0:00:27
541000 -- (-472.633) [-472.954] (-476.826) (-472.810) * [-473.472] (-472.688) (-476.802) (-475.173) -- 0:00:27
541500 -- (-473.002) (-472.415) [-473.502] (-478.579) * (-474.325) (-474.231) [-476.865] (-473.306) -- 0:00:27
542000 -- (-478.902) (-472.430) [-472.743] (-476.272) * (-479.147) [-476.444] (-472.810) (-472.995) -- 0:00:27
542500 -- (-474.041) (-472.940) [-472.799] (-475.720) * (-474.006) (-474.313) (-475.866) [-473.620] -- 0:00:26
543000 -- [-474.557] (-477.699) (-478.429) (-474.085) * (-473.725) [-473.799] (-476.769) (-476.308) -- 0:00:26
543500 -- (-475.904) [-472.955] (-476.103) (-472.327) * (-472.424) (-475.396) (-474.489) [-472.693] -- 0:00:26
544000 -- (-473.839) (-472.323) [-475.614] (-473.099) * [-474.821] (-475.273) (-473.838) (-474.040) -- 0:00:26
544500 -- (-472.950) (-472.812) [-482.060] (-473.178) * (-473.669) (-473.578) (-475.237) [-472.594] -- 0:00:26
545000 -- (-482.730) (-473.708) (-474.628) [-476.037] * (-473.122) (-473.288) [-476.462] (-475.891) -- 0:00:26
Average standard deviation of split frequencies: 0.007655
545500 -- (-477.452) (-474.168) [-477.048] (-473.062) * (-472.924) (-476.983) (-474.667) [-472.953] -- 0:00:26
546000 -- (-475.216) [-474.346] (-480.126) (-473.845) * [-473.545] (-482.251) (-474.984) (-475.110) -- 0:00:26
546500 -- (-472.875) [-473.398] (-475.676) (-474.912) * (-472.331) (-475.701) [-472.684] (-475.091) -- 0:00:26
547000 -- (-475.068) (-475.136) (-474.716) [-473.143] * (-476.429) (-473.993) (-475.650) [-473.876] -- 0:00:26
547500 -- (-475.321) [-474.211] (-475.005) (-473.348) * (-473.502) [-472.351] (-476.996) (-474.012) -- 0:00:26
548000 -- (-475.876) (-477.838) [-474.578] (-476.540) * (-474.745) [-476.539] (-474.617) (-473.669) -- 0:00:26
548500 -- (-474.452) (-473.768) [-472.350] (-479.547) * [-474.950] (-475.059) (-473.443) (-474.740) -- 0:00:26
549000 -- (-474.451) (-473.726) (-473.180) [-476.661] * (-473.777) (-475.902) (-475.017) [-477.987] -- 0:00:26
549500 -- (-476.556) (-474.903) (-476.198) [-477.098] * (-475.669) (-478.105) (-477.722) [-474.907] -- 0:00:26
550000 -- (-475.386) (-473.438) (-476.279) [-474.317] * [-475.590] (-476.182) (-473.948) (-473.261) -- 0:00:27
Average standard deviation of split frequencies: 0.007819
550500 -- (-478.595) [-472.986] (-475.123) (-474.593) * [-472.355] (-475.393) (-472.972) (-475.181) -- 0:00:26
551000 -- (-477.201) (-473.195) (-478.843) [-474.745] * [-473.095] (-476.068) (-474.580) (-474.016) -- 0:00:26
551500 -- [-473.109] (-474.228) (-474.071) (-475.672) * (-473.364) (-476.311) (-473.610) [-473.395] -- 0:00:26
552000 -- (-475.505) (-475.431) (-479.145) [-473.697] * (-476.678) (-476.782) [-475.810] (-474.427) -- 0:00:26
552500 -- [-474.147] (-475.374) (-474.862) (-474.220) * (-475.986) [-477.340] (-475.541) (-474.938) -- 0:00:26
553000 -- [-475.522] (-474.607) (-474.261) (-476.168) * (-475.281) [-474.544] (-472.700) (-472.676) -- 0:00:26
553500 -- (-476.255) (-474.054) [-473.625] (-475.715) * (-476.478) [-475.960] (-475.424) (-473.161) -- 0:00:26
554000 -- (-475.994) [-472.645] (-473.939) (-473.258) * (-474.654) [-480.289] (-476.299) (-474.651) -- 0:00:26
554500 -- [-473.948] (-475.161) (-474.979) (-475.931) * (-474.847) (-475.917) (-477.096) [-475.441] -- 0:00:26
555000 -- [-476.991] (-473.711) (-479.801) (-474.703) * (-473.040) [-472.605] (-475.620) (-474.732) -- 0:00:26
Average standard deviation of split frequencies: 0.007744
555500 -- (-476.124) (-480.101) (-478.706) [-473.951] * [-475.011] (-472.820) (-479.381) (-474.871) -- 0:00:26
556000 -- (-474.499) [-474.402] (-479.044) (-474.686) * [-472.671] (-473.019) (-476.344) (-476.092) -- 0:00:26
556500 -- [-478.430] (-472.846) (-473.619) (-478.225) * (-476.367) [-472.831] (-474.795) (-473.768) -- 0:00:26
557000 -- [-473.111] (-474.215) (-473.604) (-477.157) * (-476.596) [-474.208] (-472.323) (-474.178) -- 0:00:26
557500 -- (-473.556) (-472.791) [-474.407] (-477.874) * (-473.266) (-472.678) [-472.660] (-472.522) -- 0:00:26
558000 -- (-472.232) (-475.884) [-474.016] (-476.241) * (-476.816) (-473.300) [-473.514] (-475.161) -- 0:00:26
558500 -- (-475.231) [-473.277] (-474.409) (-478.261) * (-473.694) [-475.361] (-476.782) (-476.725) -- 0:00:26
559000 -- (-478.333) (-475.468) (-477.836) [-476.069] * [-474.135] (-476.647) (-475.998) (-478.935) -- 0:00:26
559500 -- (-475.541) [-472.451] (-474.577) (-475.445) * (-473.722) (-479.454) [-475.392] (-480.985) -- 0:00:25
560000 -- (-477.750) (-474.081) [-476.809] (-473.997) * (-473.824) (-473.619) (-474.901) [-474.879] -- 0:00:25
Average standard deviation of split frequencies: 0.008408
560500 -- (-475.173) [-476.584] (-475.009) (-479.569) * (-473.999) [-476.864] (-472.847) (-474.046) -- 0:00:25
561000 -- [-473.665] (-477.220) (-473.269) (-473.885) * (-473.696) (-478.395) [-476.600] (-476.109) -- 0:00:25
561500 -- (-472.762) [-474.133] (-475.614) (-476.809) * (-472.458) (-473.734) (-473.049) [-473.209] -- 0:00:25
562000 -- (-477.068) (-472.927) [-474.194] (-475.975) * [-472.241] (-472.979) (-473.735) (-473.352) -- 0:00:25
562500 -- (-475.631) (-475.062) [-473.497] (-473.384) * (-472.212) (-474.650) (-473.951) [-474.666] -- 0:00:25
563000 -- (-475.759) (-474.027) (-473.744) [-473.167] * (-476.044) (-473.404) (-473.430) [-472.653] -- 0:00:25
563500 -- (-475.492) (-476.001) [-473.162] (-473.101) * (-475.480) (-478.367) (-473.052) [-478.553] -- 0:00:25
564000 -- (-475.604) [-476.973] (-476.421) (-472.997) * (-477.996) [-473.747] (-473.870) (-478.005) -- 0:00:25
564500 -- [-473.178] (-473.768) (-474.633) (-473.075) * (-474.132) (-473.909) (-472.838) [-478.824] -- 0:00:25
565000 -- [-474.418] (-472.418) (-474.089) (-473.792) * (-480.049) (-474.206) [-472.773] (-476.896) -- 0:00:25
Average standard deviation of split frequencies: 0.008107
565500 -- [-473.331] (-473.247) (-475.649) (-473.798) * [-474.359] (-473.113) (-473.436) (-476.907) -- 0:00:25
566000 -- [-473.427] (-474.538) (-473.660) (-475.108) * [-473.560] (-476.127) (-474.095) (-474.565) -- 0:00:26
566500 -- (-472.475) [-475.193] (-473.198) (-474.115) * (-473.491) (-475.488) (-473.582) [-473.706] -- 0:00:26
567000 -- (-474.057) [-477.558] (-475.454) (-473.739) * (-474.252) (-475.670) (-475.528) [-477.141] -- 0:00:25
567500 -- (-475.683) [-474.129] (-475.326) (-478.684) * (-474.950) (-475.781) (-473.706) [-473.866] -- 0:00:25
568000 -- (-474.725) (-474.371) [-477.764] (-473.734) * (-476.454) (-473.880) (-474.457) [-474.796] -- 0:00:25
568500 -- (-473.379) [-474.565] (-474.415) (-476.487) * (-474.689) [-472.917] (-475.274) (-475.397) -- 0:00:25
569000 -- (-473.483) (-473.533) (-474.369) [-472.914] * [-473.106] (-477.586) (-477.115) (-476.995) -- 0:00:25
569500 -- [-474.489] (-473.543) (-476.620) (-475.735) * (-475.823) (-474.289) (-473.649) [-475.060] -- 0:00:25
570000 -- [-473.624] (-477.523) (-476.747) (-475.096) * (-473.832) [-475.099] (-472.115) (-476.113) -- 0:00:25
Average standard deviation of split frequencies: 0.008536
570500 -- (-472.591) (-473.871) (-473.193) [-474.497] * (-472.841) (-474.773) (-473.922) [-472.763] -- 0:00:25
571000 -- (-475.143) (-476.920) [-474.424] (-477.924) * (-474.810) [-478.024] (-475.081) (-475.086) -- 0:00:25
571500 -- [-473.588] (-473.061) (-475.479) (-474.173) * (-477.932) (-475.622) (-478.165) [-473.797] -- 0:00:25
572000 -- [-475.536] (-474.639) (-473.963) (-472.623) * (-475.874) (-477.920) [-473.715] (-474.913) -- 0:00:25
572500 -- (-474.374) [-474.638] (-472.747) (-472.363) * (-474.295) (-473.298) (-477.717) [-475.460] -- 0:00:25
573000 -- (-473.969) (-473.210) (-472.756) [-474.862] * [-472.361] (-477.029) (-478.146) (-480.459) -- 0:00:25
573500 -- [-473.635] (-475.399) (-473.402) (-473.948) * [-473.506] (-473.739) (-475.883) (-480.021) -- 0:00:25
574000 -- (-474.325) (-474.676) (-472.467) [-475.010] * [-473.691] (-473.846) (-477.728) (-476.448) -- 0:00:25
574500 -- (-473.926) [-476.382] (-476.374) (-473.464) * (-473.513) [-476.817] (-475.560) (-476.692) -- 0:00:25
575000 -- (-475.218) (-478.257) (-473.805) [-474.152] * (-476.240) (-475.933) (-472.816) [-478.990] -- 0:00:25
Average standard deviation of split frequencies: 0.009112
575500 -- [-472.777] (-475.524) (-475.235) (-482.943) * (-477.039) [-474.168] (-476.625) (-476.761) -- 0:00:25
576000 -- (-472.896) (-478.288) [-473.935] (-474.084) * [-476.531] (-475.029) (-475.675) (-473.084) -- 0:00:25
576500 -- (-477.690) (-475.885) [-472.972] (-477.984) * (-474.574) [-474.331] (-474.172) (-475.336) -- 0:00:24
577000 -- (-479.760) [-477.197] (-472.973) (-474.695) * (-474.677) (-475.072) (-474.255) [-478.063] -- 0:00:24
577500 -- [-474.141] (-475.196) (-475.048) (-475.930) * (-472.968) [-474.813] (-473.583) (-481.462) -- 0:00:24
578000 -- [-474.741] (-474.674) (-473.909) (-473.422) * (-473.135) (-480.215) (-473.357) [-478.885] -- 0:00:24
578500 -- (-479.381) [-473.152] (-474.086) (-475.877) * (-473.032) (-474.806) [-472.814] (-474.985) -- 0:00:24
579000 -- [-475.174] (-473.918) (-473.868) (-474.347) * (-476.078) [-475.819] (-479.531) (-474.698) -- 0:00:24
579500 -- (-475.496) [-472.888] (-474.010) (-473.508) * (-476.336) [-473.250] (-476.824) (-478.909) -- 0:00:24
580000 -- (-476.768) [-476.180] (-474.315) (-474.836) * (-474.382) (-474.640) (-475.032) [-472.744] -- 0:00:24
Average standard deviation of split frequencies: 0.008335
580500 -- (-472.674) (-475.480) [-474.681] (-473.936) * (-476.564) [-473.545] (-473.403) (-472.742) -- 0:00:24
581000 -- (-472.537) (-478.067) (-475.505) [-473.978] * (-476.748) (-473.501) [-475.467] (-478.308) -- 0:00:24
581500 -- (-476.194) [-476.863] (-476.151) (-473.121) * [-478.266] (-473.618) (-476.828) (-474.464) -- 0:00:24
582000 -- (-474.049) (-474.230) (-474.031) [-473.572] * [-473.233] (-473.499) (-473.895) (-476.463) -- 0:00:24
582500 -- (-478.974) (-476.407) [-473.725] (-475.357) * (-474.720) (-477.227) (-472.264) [-477.727] -- 0:00:24
583000 -- [-474.018] (-477.608) (-475.989) (-473.602) * (-477.498) (-475.526) [-473.490] (-474.624) -- 0:00:24
583500 -- (-474.229) (-473.014) [-476.476] (-475.647) * (-475.974) (-474.227) [-474.528] (-472.896) -- 0:00:24
584000 -- (-476.133) (-474.143) (-476.295) [-473.185] * (-472.928) [-473.185] (-474.138) (-474.034) -- 0:00:24
584500 -- (-475.504) (-476.034) [-472.902] (-481.803) * (-475.520) (-473.510) [-472.194] (-476.034) -- 0:00:24
585000 -- (-478.750) [-474.307] (-474.073) (-474.291) * (-474.892) (-475.600) [-475.072] (-475.476) -- 0:00:24
Average standard deviation of split frequencies: 0.008742
585500 -- (-473.011) (-473.093) [-475.069] (-473.008) * [-474.821] (-473.973) (-474.289) (-475.948) -- 0:00:24
586000 -- (-473.349) [-473.088] (-472.944) (-474.233) * [-474.184] (-474.273) (-473.295) (-478.167) -- 0:00:24
586500 -- (-473.897) (-474.202) (-472.352) [-473.757] * (-473.367) (-474.051) (-473.106) [-474.202] -- 0:00:24
587000 -- (-473.216) (-477.831) (-473.284) [-477.361] * [-473.709] (-474.418) (-473.227) (-472.356) -- 0:00:24
587500 -- (-473.766) (-474.311) [-473.935] (-476.359) * (-473.102) [-473.115] (-476.270) (-472.510) -- 0:00:24
588000 -- [-474.553] (-477.535) (-478.637) (-480.189) * (-478.786) (-475.578) (-475.956) [-472.818] -- 0:00:24
588500 -- (-480.372) (-475.562) (-474.685) [-473.183] * [-472.372] (-476.448) (-478.005) (-476.521) -- 0:00:24
589000 -- (-479.425) (-474.459) [-473.314] (-474.687) * [-473.861] (-472.949) (-475.763) (-476.561) -- 0:00:24
589500 -- (-485.817) (-475.587) [-473.259] (-476.026) * (-474.712) (-475.396) [-473.004] (-475.399) -- 0:00:24
590000 -- [-472.634] (-474.302) (-473.471) (-476.734) * (-476.541) (-475.106) [-475.456] (-474.112) -- 0:00:24
Average standard deviation of split frequencies: 0.008087
590500 -- [-472.970] (-474.612) (-472.652) (-475.006) * [-479.161] (-474.280) (-473.714) (-475.687) -- 0:00:24
591000 -- (-477.778) [-475.235] (-480.173) (-476.774) * [-473.039] (-474.843) (-475.293) (-474.736) -- 0:00:24
591500 -- (-473.773) (-473.923) (-481.566) [-474.634] * (-473.578) (-475.441) [-476.173] (-481.651) -- 0:00:24
592000 -- (-472.929) [-473.140] (-477.383) (-473.184) * (-473.754) (-474.196) [-472.684] (-473.803) -- 0:00:24
592500 -- [-474.900] (-478.234) (-473.033) (-474.154) * (-475.227) (-476.047) (-474.566) [-472.893] -- 0:00:24
593000 -- (-473.094) (-476.382) [-474.557] (-474.262) * (-475.732) (-472.998) (-476.485) [-474.060] -- 0:00:24
593500 -- (-473.213) [-476.278] (-472.863) (-475.743) * (-474.462) (-473.248) (-474.176) [-475.139] -- 0:00:23
594000 -- (-473.064) (-476.179) (-473.539) [-474.975] * (-475.430) (-475.493) [-474.125] (-475.152) -- 0:00:23
594500 -- [-472.249] (-475.183) (-473.333) (-477.380) * [-475.392] (-475.209) (-474.789) (-477.723) -- 0:00:23
595000 -- (-477.014) (-478.234) (-473.540) [-476.039] * (-477.063) (-473.174) [-473.728] (-476.737) -- 0:00:23
Average standard deviation of split frequencies: 0.008279
595500 -- (-479.570) (-475.591) (-472.813) [-472.636] * [-472.757] (-475.861) (-475.503) (-474.094) -- 0:00:23
596000 -- (-478.764) (-476.574) [-472.481] (-473.100) * (-473.460) (-475.459) [-475.516] (-473.153) -- 0:00:23
596500 -- (-473.440) (-473.217) [-473.278] (-473.323) * (-474.592) (-474.079) (-472.443) [-476.326] -- 0:00:23
597000 -- (-474.762) [-474.243] (-473.589) (-476.823) * [-472.653] (-473.182) (-477.328) (-478.406) -- 0:00:23
597500 -- (-474.384) (-472.749) (-472.689) [-473.696] * (-474.008) [-473.172] (-472.785) (-473.168) -- 0:00:23
598000 -- [-472.824] (-472.864) (-474.940) (-472.563) * [-473.575] (-473.180) (-473.143) (-473.330) -- 0:00:23
598500 -- (-472.794) (-475.770) [-474.992] (-473.637) * [-474.143] (-477.388) (-473.817) (-476.199) -- 0:00:23
599000 -- (-474.239) (-472.234) [-473.122] (-476.383) * (-475.949) [-473.972] (-474.639) (-474.141) -- 0:00:23
599500 -- (-473.209) (-477.116) [-477.154] (-474.067) * [-474.056] (-472.341) (-476.837) (-474.875) -- 0:00:23
600000 -- (-480.697) (-475.573) [-477.199] (-473.957) * (-473.249) (-472.723) [-474.774] (-475.505) -- 0:00:23
Average standard deviation of split frequencies: 0.008319
600500 -- (-476.947) (-473.036) [-473.363] (-473.585) * (-472.590) [-476.217] (-476.002) (-476.006) -- 0:00:23
601000 -- (-474.197) [-473.170] (-474.831) (-473.533) * (-476.737) (-477.648) (-474.053) [-475.997] -- 0:00:23
601500 -- (-477.737) (-472.884) [-475.374] (-475.720) * (-473.417) (-478.896) (-476.430) [-474.223] -- 0:00:23
602000 -- [-476.497] (-477.297) (-473.411) (-478.040) * (-472.801) (-478.473) (-473.996) [-473.722] -- 0:00:23
602500 -- (-478.902) (-478.999) [-473.558] (-477.433) * (-474.077) [-476.859] (-475.395) (-475.432) -- 0:00:23
603000 -- (-474.414) (-475.726) [-474.098] (-476.298) * (-475.153) (-475.725) [-473.326] (-476.655) -- 0:00:23
603500 -- (-474.248) [-473.023] (-480.319) (-474.944) * (-474.241) (-473.826) [-473.443] (-475.565) -- 0:00:23
604000 -- [-474.353] (-477.808) (-479.679) (-476.247) * (-473.492) [-472.821] (-475.380) (-474.879) -- 0:00:23
604500 -- [-475.148] (-475.303) (-477.765) (-477.739) * (-473.908) (-474.654) [-476.962] (-476.227) -- 0:00:23
605000 -- (-473.283) (-475.553) [-475.547] (-476.625) * (-475.518) (-473.790) [-473.207] (-472.599) -- 0:00:23
Average standard deviation of split frequencies: 0.008217
605500 -- [-475.508] (-474.278) (-483.958) (-474.422) * (-476.412) [-477.214] (-474.317) (-475.112) -- 0:00:23
606000 -- [-474.734] (-475.809) (-473.012) (-473.415) * (-476.226) (-475.022) [-474.175] (-474.102) -- 0:00:23
606500 -- (-473.612) (-472.805) [-477.113] (-475.703) * (-482.151) (-475.057) (-477.218) [-474.981] -- 0:00:23
607000 -- [-476.011] (-472.712) (-479.951) (-477.665) * [-475.747] (-474.493) (-475.570) (-478.114) -- 0:00:23
607500 -- [-474.402] (-474.227) (-475.722) (-476.050) * (-473.950) (-472.835) (-474.993) [-475.909] -- 0:00:23
608000 -- (-474.030) (-473.705) (-474.629) [-473.341] * [-473.400] (-473.605) (-476.762) (-478.030) -- 0:00:23
608500 -- [-473.416] (-473.876) (-473.916) (-474.770) * [-472.912] (-473.972) (-472.847) (-481.040) -- 0:00:23
609000 -- (-476.028) (-473.440) [-472.755] (-474.799) * (-472.214) (-477.501) (-475.111) [-476.866] -- 0:00:23
609500 -- (-478.459) (-474.847) (-472.802) [-476.894] * (-474.518) [-473.008] (-481.353) (-474.275) -- 0:00:23
610000 -- (-473.268) [-478.161] (-474.304) (-476.535) * (-475.304) (-472.943) (-478.307) [-472.899] -- 0:00:23
Average standard deviation of split frequencies: 0.008974
610500 -- (-475.165) (-474.569) (-473.420) [-476.694] * (-473.017) (-473.876) [-474.129] (-473.663) -- 0:00:22
611000 -- [-474.628] (-479.746) (-472.801) (-473.014) * (-474.243) (-476.273) [-473.357] (-473.562) -- 0:00:22
611500 -- (-474.038) (-479.334) (-473.230) [-473.464] * (-479.246) (-476.054) (-472.460) [-474.363] -- 0:00:22
612000 -- (-479.655) (-478.004) (-472.871) [-473.491] * (-476.284) (-476.399) [-472.311] (-476.779) -- 0:00:22
612500 -- (-480.301) [-475.008] (-473.115) (-474.720) * (-473.449) (-474.605) (-478.890) [-474.176] -- 0:00:22
613000 -- [-478.466] (-478.960) (-474.140) (-473.265) * (-475.026) (-475.102) [-473.842] (-477.172) -- 0:00:22
613500 -- [-473.179] (-481.368) (-475.101) (-473.634) * (-473.274) [-474.186] (-472.878) (-473.767) -- 0:00:22
614000 -- (-474.779) [-473.606] (-476.944) (-474.838) * [-472.780] (-472.623) (-472.654) (-480.730) -- 0:00:22
614500 -- [-473.289] (-473.681) (-477.581) (-474.146) * (-472.636) (-473.616) [-472.801] (-476.049) -- 0:00:22
615000 -- (-473.960) (-473.001) [-473.208] (-474.570) * (-473.073) (-473.114) (-480.435) [-476.670] -- 0:00:22
Average standard deviation of split frequencies: 0.009642
615500 -- [-473.157] (-473.723) (-475.957) (-472.876) * [-473.906] (-475.076) (-474.065) (-475.400) -- 0:00:22
616000 -- (-474.480) (-475.240) (-474.175) [-472.929] * (-477.265) [-474.592] (-474.694) (-475.728) -- 0:00:22
616500 -- [-472.507] (-478.766) (-479.473) (-474.278) * (-473.251) (-477.134) (-477.619) [-474.739] -- 0:00:22
617000 -- (-476.450) (-472.844) (-474.571) [-472.693] * (-476.506) (-476.706) (-474.829) [-472.805] -- 0:00:22
617500 -- (-475.624) (-474.696) (-475.359) [-472.159] * (-477.889) (-475.142) (-473.360) [-473.446] -- 0:00:22
618000 -- (-473.341) (-473.483) [-475.366] (-474.647) * [-474.374] (-473.643) (-473.898) (-475.561) -- 0:00:22
618500 -- [-473.225] (-473.415) (-476.385) (-473.996) * (-477.181) (-476.844) (-475.708) [-472.518] -- 0:00:22
619000 -- (-473.131) (-473.147) (-474.729) [-475.835] * (-474.876) (-475.325) (-472.939) [-474.870] -- 0:00:22
619500 -- (-473.484) (-475.134) [-475.809] (-477.303) * (-473.939) [-473.939] (-473.944) (-476.577) -- 0:00:22
620000 -- (-476.131) (-476.061) (-474.137) [-473.177] * (-474.520) (-474.430) [-472.365] (-474.714) -- 0:00:22
Average standard deviation of split frequencies: 0.009215
620500 -- (-472.964) (-476.148) (-473.481) [-475.594] * (-477.838) (-474.846) [-474.068] (-474.016) -- 0:00:22
621000 -- (-472.886) [-472.946] (-476.531) (-475.783) * [-474.474] (-475.704) (-472.672) (-475.057) -- 0:00:22
621500 -- [-473.434] (-474.061) (-476.339) (-473.819) * [-473.871] (-473.634) (-472.361) (-476.517) -- 0:00:22
622000 -- [-472.731] (-474.979) (-475.130) (-475.900) * (-475.969) (-474.776) [-475.274] (-475.626) -- 0:00:22
622500 -- (-472.567) [-474.501] (-483.092) (-475.336) * [-473.600] (-474.085) (-472.438) (-474.413) -- 0:00:22
623000 -- (-478.103) (-473.450) (-474.049) [-475.353] * [-473.036] (-475.400) (-472.851) (-476.756) -- 0:00:22
623500 -- (-474.384) [-474.584] (-475.057) (-474.807) * (-473.470) (-476.314) (-473.960) [-474.094] -- 0:00:22
624000 -- [-476.986] (-472.695) (-476.596) (-476.010) * (-475.082) (-478.581) [-472.649] (-473.452) -- 0:00:22
624500 -- (-474.135) [-473.965] (-475.109) (-475.426) * [-472.268] (-473.811) (-473.857) (-473.597) -- 0:00:22
625000 -- [-473.434] (-477.610) (-478.705) (-475.854) * [-475.480] (-477.396) (-477.685) (-472.823) -- 0:00:22
Average standard deviation of split frequencies: 0.008886
625500 -- (-475.370) (-474.652) (-475.853) [-476.604] * (-473.419) (-473.944) (-482.036) [-474.064] -- 0:00:22
626000 -- (-473.705) (-474.270) [-476.456] (-473.475) * [-474.472] (-474.498) (-474.274) (-472.568) -- 0:00:22
626500 -- (-474.384) (-475.404) [-476.151] (-473.620) * (-475.009) (-474.191) [-472.615] (-475.479) -- 0:00:22
627000 -- (-472.450) (-472.777) (-476.166) [-474.323] * (-476.166) (-474.750) (-472.687) [-473.239] -- 0:00:22
627500 -- (-474.324) (-473.304) (-472.719) [-474.173] * (-473.754) [-473.773] (-473.577) (-474.463) -- 0:00:21
628000 -- (-475.460) [-472.145] (-472.923) (-473.650) * (-480.976) (-476.108) [-474.964] (-476.097) -- 0:00:21
628500 -- [-476.119] (-472.821) (-476.953) (-473.715) * (-474.956) (-475.399) [-473.932] (-472.880) -- 0:00:21
629000 -- (-474.725) (-474.591) (-474.099) [-473.675] * (-473.548) [-477.709] (-474.870) (-474.715) -- 0:00:21
629500 -- (-477.362) (-475.424) (-473.782) [-475.117] * (-476.299) (-475.411) (-483.432) [-474.313] -- 0:00:21
630000 -- [-474.339] (-477.754) (-474.216) (-474.090) * (-478.364) (-476.531) [-472.140] (-475.073) -- 0:00:21
Average standard deviation of split frequencies: 0.008720
630500 -- [-474.361] (-473.601) (-473.752) (-472.884) * (-475.679) (-475.917) [-474.493] (-473.618) -- 0:00:21
631000 -- [-479.835] (-479.451) (-473.369) (-474.425) * (-474.574) (-474.268) [-479.201] (-474.206) -- 0:00:21
631500 -- [-472.752] (-474.893) (-474.549) (-475.360) * [-472.152] (-473.696) (-475.203) (-475.770) -- 0:00:21
632000 -- [-472.435] (-473.091) (-474.429) (-473.909) * (-472.590) [-473.722] (-476.452) (-476.036) -- 0:00:21
632500 -- (-473.086) (-473.473) [-474.876] (-475.713) * [-473.230] (-474.462) (-475.689) (-475.716) -- 0:00:21
633000 -- (-472.729) [-475.053] (-473.987) (-472.832) * [-475.767] (-472.825) (-477.646) (-474.144) -- 0:00:21
633500 -- (-477.080) (-474.519) (-474.713) [-473.713] * (-472.637) [-476.778] (-473.378) (-475.126) -- 0:00:21
634000 -- [-477.672] (-473.052) (-474.143) (-474.243) * (-475.703) (-473.762) (-472.835) [-472.740] -- 0:00:21
634500 -- (-475.586) (-474.318) (-475.011) [-476.514] * (-472.320) (-474.484) (-473.314) [-475.346] -- 0:00:21
635000 -- (-474.299) (-476.099) (-476.627) [-473.089] * (-476.781) (-473.732) (-476.216) [-472.615] -- 0:00:21
Average standard deviation of split frequencies: 0.008647
635500 -- (-477.174) (-475.101) [-473.598] (-473.146) * (-473.708) (-474.849) (-472.297) [-478.749] -- 0:00:21
636000 -- [-474.201] (-476.285) (-477.128) (-473.409) * (-473.216) (-476.044) [-473.777] (-474.802) -- 0:00:21
636500 -- (-474.804) (-473.294) (-475.947) [-476.728] * [-474.009] (-477.621) (-474.040) (-473.973) -- 0:00:21
637000 -- (-474.708) (-474.482) (-474.449) [-473.505] * (-477.304) [-472.713] (-474.300) (-473.791) -- 0:00:21
637500 -- (-474.955) [-474.298] (-474.694) (-473.964) * (-476.351) (-472.597) [-473.778] (-473.047) -- 0:00:21
638000 -- (-474.386) [-473.202] (-474.951) (-474.250) * (-472.965) (-472.373) (-474.668) [-472.887] -- 0:00:21
638500 -- (-474.490) (-472.918) [-473.236] (-478.170) * (-474.729) (-474.882) (-476.695) [-473.795] -- 0:00:21
639000 -- [-478.268] (-478.427) (-473.983) (-477.899) * (-475.121) [-475.277] (-473.151) (-473.235) -- 0:00:21
639500 -- [-478.977] (-474.297) (-472.750) (-477.457) * (-476.322) (-477.217) [-473.522] (-475.951) -- 0:00:21
640000 -- (-473.157) (-474.014) (-473.441) [-475.142] * (-475.664) (-475.538) (-474.783) [-473.652] -- 0:00:21
Average standard deviation of split frequencies: 0.008781
640500 -- [-473.311] (-472.913) (-473.600) (-474.647) * (-475.219) (-476.204) [-474.268] (-476.328) -- 0:00:21
641000 -- (-474.190) (-473.440) [-476.328] (-473.661) * (-477.787) (-474.462) [-473.190] (-475.534) -- 0:00:21
641500 -- (-476.837) [-473.112] (-476.012) (-475.052) * (-475.220) (-472.405) [-474.270] (-476.932) -- 0:00:21
642000 -- (-480.186) (-476.299) [-474.828] (-474.478) * [-473.640] (-473.072) (-476.033) (-474.617) -- 0:00:21
642500 -- [-473.469] (-475.089) (-472.802) (-479.723) * (-473.943) (-474.179) (-476.928) [-476.123] -- 0:00:21
643000 -- (-473.919) (-474.429) (-474.303) [-473.046] * (-476.018) [-475.282] (-476.101) (-476.500) -- 0:00:21
643500 -- (-475.686) (-475.247) (-474.129) [-473.925] * (-474.948) (-484.535) [-474.311] (-473.810) -- 0:00:21
644000 -- (-473.165) (-472.640) [-476.071] (-474.001) * (-474.846) [-478.428] (-473.245) (-473.675) -- 0:00:21
644500 -- (-472.463) [-474.124] (-476.296) (-473.117) * (-472.254) (-479.207) [-477.432] (-481.731) -- 0:00:20
645000 -- (-477.937) (-477.333) [-476.509] (-478.487) * [-476.351] (-474.633) (-472.470) (-477.193) -- 0:00:20
Average standard deviation of split frequencies: 0.007784
645500 -- [-474.199] (-476.498) (-475.351) (-473.298) * [-474.355] (-475.128) (-475.334) (-476.238) -- 0:00:20
646000 -- (-475.696) (-472.791) [-477.877] (-472.918) * (-474.606) [-477.173] (-475.309) (-474.147) -- 0:00:20
646500 -- (-477.013) [-472.674] (-475.834) (-474.007) * (-474.080) (-478.145) (-483.594) [-474.532] -- 0:00:20
647000 -- [-473.570] (-473.821) (-473.551) (-475.837) * (-473.677) [-472.285] (-480.429) (-474.579) -- 0:00:20
647500 -- (-472.954) [-474.115] (-472.854) (-476.002) * [-473.209] (-472.479) (-472.976) (-476.014) -- 0:00:20
648000 -- (-475.861) [-474.421] (-477.027) (-475.120) * (-473.911) (-474.356) [-472.948] (-473.537) -- 0:00:20
648500 -- (-473.341) (-477.162) (-474.507) [-474.654] * (-475.548) [-474.109] (-477.442) (-475.733) -- 0:00:20
649000 -- [-473.023] (-479.200) (-477.036) (-474.568) * (-474.613) [-473.339] (-475.941) (-474.504) -- 0:00:20
649500 -- (-477.606) (-474.172) (-475.787) [-476.972] * (-472.898) (-473.612) (-474.463) [-476.214] -- 0:00:20
650000 -- (-472.577) (-475.651) (-474.342) [-476.527] * (-472.826) (-476.729) (-473.500) [-474.710] -- 0:00:20
Average standard deviation of split frequencies: 0.007969
650500 -- [-473.768] (-474.344) (-472.963) (-473.753) * (-472.711) [-473.414] (-475.630) (-473.471) -- 0:00:20
651000 -- [-475.334] (-472.913) (-476.427) (-474.596) * [-474.654] (-473.254) (-477.727) (-474.687) -- 0:00:20
651500 -- [-472.230] (-474.027) (-473.696) (-474.455) * (-472.710) [-476.397] (-477.301) (-473.787) -- 0:00:20
652000 -- [-472.772] (-475.153) (-477.049) (-474.187) * [-476.751] (-473.655) (-474.429) (-474.353) -- 0:00:20
652500 -- (-474.077) (-474.540) (-474.754) [-474.323] * (-476.159) (-473.227) (-473.420) [-473.410] -- 0:00:20
653000 -- (-476.820) (-473.573) (-474.806) [-473.657] * (-475.036) (-476.489) (-472.585) [-472.993] -- 0:00:20
653500 -- (-477.534) [-473.970] (-478.522) (-475.263) * (-479.885) (-477.768) (-474.600) [-474.095] -- 0:00:20
654000 -- (-475.255) (-474.119) (-476.669) [-474.323] * (-475.401) (-477.327) (-475.853) [-474.889] -- 0:00:20
654500 -- (-474.242) (-473.625) (-473.679) [-476.073] * [-473.393] (-479.364) (-472.974) (-473.193) -- 0:00:20
655000 -- [-473.731] (-473.050) (-473.615) (-480.767) * (-475.003) (-474.926) (-474.306) [-473.703] -- 0:00:20
Average standard deviation of split frequencies: 0.007569
655500 -- (-474.636) [-476.538] (-475.121) (-474.118) * (-474.458) [-474.315] (-474.315) (-474.379) -- 0:00:20
656000 -- [-473.298] (-475.267) (-477.617) (-475.121) * (-474.729) (-475.181) [-475.954] (-476.023) -- 0:00:20
656500 -- (-473.797) (-473.288) [-476.688] (-473.889) * (-476.989) (-475.670) (-474.369) [-477.672] -- 0:00:20
657000 -- (-473.191) (-479.636) (-473.443) [-475.246] * (-476.095) (-476.208) (-474.490) [-474.943] -- 0:00:20
657500 -- (-474.386) (-479.518) [-476.444] (-475.856) * (-474.376) [-475.538] (-473.700) (-475.147) -- 0:00:20
658000 -- (-472.660) [-474.935] (-478.871) (-476.032) * (-473.480) [-478.876] (-477.769) (-474.653) -- 0:00:20
658500 -- (-474.867) [-473.535] (-476.742) (-477.043) * [-473.613] (-474.299) (-476.813) (-475.268) -- 0:00:20
659000 -- (-473.985) (-473.746) (-473.613) [-473.286] * (-477.970) (-477.366) [-474.483] (-478.015) -- 0:00:20
659500 -- (-473.233) (-472.697) [-476.915] (-472.943) * [-475.298] (-476.675) (-482.212) (-472.549) -- 0:00:20
660000 -- [-474.844] (-474.294) (-473.019) (-476.844) * (-475.644) [-478.041] (-476.881) (-477.821) -- 0:00:20
Average standard deviation of split frequencies: 0.008229
660500 -- (-475.564) (-473.814) [-478.960] (-476.690) * [-475.047] (-480.772) (-473.195) (-475.359) -- 0:00:20
661000 -- (-473.417) [-472.449] (-477.259) (-474.160) * (-474.955) [-475.335] (-473.499) (-474.447) -- 0:00:20
661500 -- [-473.541] (-477.905) (-477.780) (-475.443) * (-475.429) (-475.198) [-475.263] (-475.817) -- 0:00:19
662000 -- (-473.376) (-477.093) [-476.044] (-476.419) * (-475.178) [-475.243] (-477.129) (-474.135) -- 0:00:19
662500 -- (-474.019) [-475.971] (-475.700) (-477.285) * (-477.687) (-472.374) [-477.485] (-475.175) -- 0:00:19
663000 -- (-475.400) (-477.117) [-473.170] (-476.620) * (-474.913) (-472.711) [-474.688] (-475.972) -- 0:00:19
663500 -- [-473.467] (-479.361) (-473.810) (-475.256) * [-474.337] (-472.716) (-472.568) (-480.822) -- 0:00:19
664000 -- (-474.220) (-475.957) [-474.620] (-475.598) * (-472.941) (-477.045) [-472.601] (-477.845) -- 0:00:19
664500 -- (-474.151) (-477.399) [-473.223] (-475.439) * (-473.366) [-474.086] (-473.823) (-472.640) -- 0:00:19
665000 -- [-473.499] (-474.153) (-473.109) (-473.770) * (-475.122) [-476.697] (-476.773) (-473.607) -- 0:00:19
Average standard deviation of split frequencies: 0.008211
665500 -- (-474.251) (-474.562) [-475.061] (-475.554) * (-472.947) (-475.846) (-473.528) [-474.117] -- 0:00:19
666000 -- (-473.902) [-474.014] (-475.694) (-476.960) * (-479.402) [-472.534] (-477.050) (-475.029) -- 0:00:19
666500 -- [-476.309] (-473.874) (-476.278) (-473.860) * (-474.170) (-473.092) (-473.455) [-475.056] -- 0:00:19
667000 -- [-476.061] (-473.835) (-476.212) (-472.761) * [-474.708] (-473.174) (-473.889) (-476.541) -- 0:00:19
667500 -- [-474.582] (-479.026) (-474.211) (-472.674) * [-475.665] (-476.545) (-474.214) (-474.107) -- 0:00:19
668000 -- [-474.425] (-474.538) (-473.102) (-477.882) * (-474.033) (-477.196) [-473.473] (-475.035) -- 0:00:19
668500 -- (-474.929) (-475.117) [-473.668] (-475.537) * [-473.247] (-478.660) (-478.087) (-473.383) -- 0:00:19
669000 -- (-472.611) [-475.657] (-473.916) (-473.989) * (-473.353) (-472.737) (-475.045) [-475.186] -- 0:00:19
669500 -- [-472.617] (-473.619) (-473.401) (-473.333) * (-474.240) [-472.975] (-477.783) (-472.679) -- 0:00:19
670000 -- [-473.619] (-472.892) (-476.516) (-477.216) * [-473.452] (-472.984) (-476.415) (-474.289) -- 0:00:19
Average standard deviation of split frequencies: 0.008528
670500 -- (-477.914) (-474.612) [-473.196] (-476.678) * (-473.925) (-473.660) [-473.476] (-475.133) -- 0:00:19
671000 -- (-475.031) (-474.439) [-473.766] (-473.742) * (-473.440) (-477.311) [-475.516] (-474.830) -- 0:00:19
671500 -- (-474.329) [-475.755] (-473.972) (-474.306) * (-479.438) (-474.334) [-473.303] (-475.411) -- 0:00:19
672000 -- (-475.597) (-473.601) [-477.488] (-474.876) * (-474.179) [-474.958] (-474.259) (-474.072) -- 0:00:19
672500 -- [-473.131] (-477.415) (-474.151) (-474.286) * (-473.887) (-473.096) (-477.600) [-473.748] -- 0:00:19
673000 -- (-475.989) (-473.234) [-474.449] (-475.267) * (-473.008) (-474.723) (-474.964) [-474.372] -- 0:00:19
673500 -- (-472.588) (-473.635) [-473.362] (-474.982) * (-473.339) (-474.252) [-475.903] (-474.573) -- 0:00:19
674000 -- [-473.691] (-473.865) (-478.448) (-473.472) * (-473.496) (-479.792) [-473.783] (-474.575) -- 0:00:19
674500 -- (-473.219) [-476.080] (-472.674) (-476.238) * [-474.097] (-475.735) (-478.718) (-475.816) -- 0:00:19
675000 -- (-478.833) [-473.373] (-474.132) (-474.257) * (-474.225) [-474.747] (-477.008) (-474.358) -- 0:00:19
Average standard deviation of split frequencies: 0.008508
675500 -- [-472.560] (-474.512) (-473.877) (-474.788) * (-472.464) (-474.045) [-472.482] (-473.690) -- 0:00:19
676000 -- (-474.844) (-474.077) [-475.356] (-475.565) * (-472.846) (-474.705) [-472.484] (-477.354) -- 0:00:19
676500 -- (-474.257) (-474.434) (-472.588) [-473.921] * (-474.330) (-472.502) (-472.221) [-473.584] -- 0:00:19
677000 -- (-476.407) (-477.094) [-474.430] (-477.267) * (-476.946) [-473.687] (-475.080) (-475.514) -- 0:00:19
677500 -- (-475.317) (-474.439) [-473.951] (-475.309) * (-481.027) [-474.144] (-475.809) (-475.179) -- 0:00:19
678000 -- (-479.426) (-474.953) [-476.610] (-474.169) * [-479.119] (-473.478) (-476.475) (-475.381) -- 0:00:18
678500 -- (-475.548) (-476.013) [-477.723] (-473.547) * [-476.145] (-479.678) (-477.148) (-474.888) -- 0:00:18
679000 -- (-474.216) (-474.220) (-473.845) [-473.334] * [-473.850] (-472.836) (-477.597) (-473.497) -- 0:00:18
679500 -- (-475.202) (-473.986) [-475.086] (-473.751) * (-474.723) (-476.266) (-477.686) [-478.015] -- 0:00:18
680000 -- (-477.043) (-478.075) (-472.718) [-473.065] * (-475.369) (-473.835) [-477.028] (-477.690) -- 0:00:18
Average standard deviation of split frequencies: 0.008634
680500 -- [-473.429] (-475.163) (-473.942) (-473.451) * (-474.661) [-473.659] (-478.610) (-475.774) -- 0:00:18
681000 -- [-472.944] (-474.929) (-476.649) (-475.384) * (-474.924) [-475.940] (-473.733) (-474.578) -- 0:00:18
681500 -- (-474.413) [-474.959] (-475.990) (-474.353) * (-475.415) (-473.643) [-473.548] (-473.261) -- 0:00:18
682000 -- (-474.310) [-475.809] (-473.288) (-474.334) * (-475.590) (-475.296) [-473.843] (-476.821) -- 0:00:18
682500 -- (-474.691) (-477.197) [-473.817] (-478.243) * (-475.142) (-476.403) (-475.334) [-475.446] -- 0:00:18
683000 -- [-473.350] (-479.947) (-474.386) (-475.317) * (-472.359) (-477.593) (-475.880) [-475.905] -- 0:00:18
683500 -- [-473.520] (-478.226) (-473.371) (-474.033) * (-474.640) (-474.267) [-474.288] (-474.251) -- 0:00:18
684000 -- (-478.159) (-474.701) [-472.590] (-474.033) * [-473.981] (-475.214) (-474.070) (-476.159) -- 0:00:18
684500 -- (-473.078) [-473.904] (-474.141) (-473.843) * (-480.410) [-474.074] (-472.320) (-473.094) -- 0:00:18
685000 -- (-472.663) (-473.339) (-474.213) [-472.973] * (-474.094) (-476.355) [-472.622] (-472.704) -- 0:00:18
Average standard deviation of split frequencies: 0.009254
685500 -- (-473.703) (-475.789) [-473.531] (-473.355) * (-474.813) (-473.844) (-472.962) [-473.033] -- 0:00:18
686000 -- (-473.904) (-473.984) [-476.174] (-474.268) * (-473.630) (-474.571) [-472.896] (-474.484) -- 0:00:18
686500 -- (-473.548) [-473.805] (-476.071) (-473.387) * (-473.820) [-475.526] (-478.604) (-473.973) -- 0:00:18
687000 -- (-474.345) (-474.789) (-474.725) [-472.339] * (-475.969) (-475.605) (-473.152) [-472.750] -- 0:00:18
687500 -- (-472.977) (-476.382) (-472.479) [-475.692] * (-478.249) (-472.680) [-473.194] (-474.232) -- 0:00:18
688000 -- (-472.416) [-474.308] (-474.916) (-476.555) * (-475.671) (-475.072) [-473.955] (-474.059) -- 0:00:18
688500 -- (-473.043) (-480.379) (-475.456) [-476.840] * (-475.377) (-475.674) [-472.890] (-474.946) -- 0:00:18
689000 -- (-472.550) (-477.041) (-473.202) [-473.896] * (-478.718) [-476.819] (-474.313) (-473.919) -- 0:00:18
689500 -- [-472.838] (-475.794) (-472.768) (-476.100) * (-477.726) (-475.513) (-473.687) [-474.793] -- 0:00:18
690000 -- (-475.196) [-472.713] (-474.478) (-473.184) * (-476.456) (-473.145) [-472.853] (-472.412) -- 0:00:18
Average standard deviation of split frequencies: 0.009191
690500 -- (-476.486) [-477.508] (-473.360) (-474.788) * (-476.837) (-474.956) [-472.927] (-476.443) -- 0:00:18
691000 -- (-476.232) (-476.011) [-472.471] (-475.560) * (-476.019) (-474.433) (-474.647) [-476.016] -- 0:00:18
691500 -- (-475.770) [-475.276] (-474.907) (-476.094) * (-475.375) (-475.594) (-474.988) [-473.256] -- 0:00:18
692000 -- [-475.096] (-475.421) (-473.534) (-478.712) * (-473.852) [-473.277] (-473.955) (-479.087) -- 0:00:18
692500 -- (-473.323) [-475.017] (-476.304) (-478.174) * (-479.398) (-474.281) (-473.237) [-472.634] -- 0:00:18
693000 -- (-473.141) (-474.906) (-475.239) [-484.139] * (-472.867) [-475.822] (-476.104) (-474.678) -- 0:00:18
693500 -- (-472.365) (-476.462) [-474.028] (-473.031) * (-473.599) (-477.655) (-473.122) [-473.926] -- 0:00:18
694000 -- (-474.463) (-477.660) (-474.380) [-473.354] * [-473.700] (-476.271) (-474.888) (-472.719) -- 0:00:18
694500 -- [-472.908] (-474.124) (-473.141) (-476.388) * (-477.218) (-473.318) (-474.540) [-477.169] -- 0:00:18
695000 -- [-473.158] (-477.920) (-472.552) (-474.625) * (-474.021) (-473.102) [-473.337] (-474.440) -- 0:00:17
Average standard deviation of split frequencies: 0.009347
695500 -- (-474.854) [-474.536] (-473.694) (-474.789) * (-475.465) (-474.175) [-474.620] (-476.044) -- 0:00:17
696000 -- [-474.128] (-476.334) (-477.055) (-475.529) * (-473.282) [-477.874] (-477.768) (-475.592) -- 0:00:17
696500 -- (-478.539) (-476.737) (-474.848) [-473.999] * (-474.050) [-472.553] (-477.883) (-472.296) -- 0:00:17
697000 -- (-487.370) (-480.624) (-474.139) [-473.844] * (-474.759) (-474.359) (-477.020) [-472.679] -- 0:00:17
697500 -- (-476.225) (-476.094) [-472.810] (-473.116) * (-473.487) (-472.827) [-474.876] (-473.358) -- 0:00:17
698000 -- (-484.006) (-476.252) [-472.201] (-472.938) * (-476.281) (-474.319) [-472.664] (-474.835) -- 0:00:17
698500 -- (-474.708) (-477.873) [-473.478] (-472.940) * [-474.033] (-473.259) (-475.064) (-476.387) -- 0:00:17
699000 -- [-472.426] (-475.505) (-476.855) (-476.091) * (-478.398) (-475.503) (-478.109) [-473.359] -- 0:00:17
699500 -- (-474.604) (-475.347) [-473.917] (-475.219) * (-474.311) [-474.528] (-476.044) (-474.947) -- 0:00:17
700000 -- (-473.405) (-473.557) [-476.628] (-476.209) * (-474.853) (-477.443) [-473.553] (-474.413) -- 0:00:17
Average standard deviation of split frequencies: 0.009599
700500 -- (-472.735) (-473.902) [-473.077] (-473.251) * (-473.032) (-476.418) [-473.941] (-474.934) -- 0:00:17
701000 -- (-478.181) (-473.257) [-473.200] (-472.885) * (-474.293) (-477.210) (-474.395) [-473.844] -- 0:00:17
701500 -- (-479.229) [-473.205] (-473.710) (-475.012) * (-474.566) (-475.493) [-473.965] (-473.758) -- 0:00:17
702000 -- (-478.315) (-473.982) [-474.323] (-472.765) * (-478.229) (-477.707) [-473.163] (-474.697) -- 0:00:17
702500 -- (-477.598) (-474.370) [-474.155] (-475.036) * (-474.130) (-474.381) (-474.727) [-473.669] -- 0:00:17
703000 -- (-473.614) (-472.834) [-474.075] (-477.116) * (-474.171) (-474.549) (-477.254) [-472.320] -- 0:00:17
703500 -- (-472.487) [-474.481] (-474.794) (-477.355) * [-472.323] (-476.010) (-474.546) (-473.242) -- 0:00:17
704000 -- (-474.019) (-475.655) (-472.735) [-477.188] * (-474.023) (-474.778) (-477.429) [-472.654] -- 0:00:17
704500 -- (-473.620) [-474.278] (-473.481) (-472.876) * (-478.703) [-475.641] (-478.233) (-481.284) -- 0:00:17
705000 -- (-474.089) (-474.060) [-474.058] (-477.812) * (-474.177) (-474.642) [-473.934] (-473.969) -- 0:00:17
Average standard deviation of split frequencies: 0.009571
705500 -- [-473.162] (-473.692) (-473.269) (-474.917) * (-479.367) (-474.219) [-472.670] (-472.908) -- 0:00:17
706000 -- (-476.063) [-476.648] (-474.258) (-472.073) * (-480.043) [-475.223] (-476.641) (-473.181) -- 0:00:17
706500 -- (-474.310) (-476.730) [-476.590] (-477.512) * (-478.750) [-474.100] (-481.172) (-473.547) -- 0:00:17
707000 -- [-473.853] (-475.221) (-473.415) (-475.525) * [-477.006] (-473.709) (-473.269) (-473.011) -- 0:00:17
707500 -- (-474.053) (-479.327) [-474.877] (-473.623) * [-475.823] (-474.482) (-473.566) (-476.581) -- 0:00:17
708000 -- (-474.757) (-474.051) [-474.596] (-477.578) * (-476.538) (-473.275) (-475.384) [-475.670] -- 0:00:17
708500 -- (-474.752) (-478.132) [-475.892] (-475.373) * (-476.544) (-474.175) [-476.060] (-476.313) -- 0:00:17
709000 -- (-474.770) (-474.462) [-474.753] (-476.813) * (-473.475) (-473.029) (-475.388) [-473.426] -- 0:00:17
709500 -- (-474.613) (-474.555) (-478.302) [-472.874] * [-474.635] (-474.256) (-473.663) (-476.280) -- 0:00:17
710000 -- (-477.223) [-472.804] (-476.601) (-474.105) * [-475.009] (-475.977) (-475.748) (-474.902) -- 0:00:17
Average standard deviation of split frequencies: 0.009110
710500 -- (-475.043) (-473.676) [-472.659] (-475.914) * (-473.533) [-476.414] (-473.048) (-474.472) -- 0:00:17
711000 -- (-472.798) [-476.216] (-476.741) (-475.324) * (-472.567) (-475.182) [-475.903] (-473.584) -- 0:00:17
711500 -- (-473.031) [-472.931] (-475.032) (-474.201) * (-477.782) [-477.403] (-474.127) (-472.545) -- 0:00:17
712000 -- (-473.060) (-473.625) (-475.525) [-475.400] * (-476.234) [-473.190] (-473.355) (-474.284) -- 0:00:16
712500 -- (-479.313) [-472.825] (-474.242) (-472.935) * (-472.487) [-474.184] (-472.927) (-473.953) -- 0:00:16
713000 -- (-474.437) (-474.169) [-473.345] (-475.488) * (-477.345) (-473.059) [-472.993] (-475.427) -- 0:00:16
713500 -- (-472.555) (-474.429) [-479.174] (-475.640) * (-476.995) (-474.319) (-474.283) [-476.960] -- 0:00:16
714000 -- (-473.472) (-473.876) [-473.179] (-473.000) * (-473.714) (-476.362) [-473.382] (-476.245) -- 0:00:16
714500 -- (-473.205) [-474.469] (-472.844) (-475.555) * (-476.039) [-473.270] (-474.366) (-475.299) -- 0:00:16
715000 -- (-472.594) (-475.539) (-472.615) [-475.059] * (-474.746) [-474.921] (-474.122) (-475.581) -- 0:00:16
Average standard deviation of split frequencies: 0.009744
715500 -- (-473.402) [-474.728] (-473.250) (-473.536) * (-473.815) (-475.262) (-479.616) [-474.395] -- 0:00:16
716000 -- [-472.916] (-476.554) (-474.225) (-475.426) * [-473.174] (-476.665) (-473.370) (-475.606) -- 0:00:16
716500 -- (-475.218) [-477.639] (-480.844) (-475.594) * (-473.861) [-474.088] (-475.530) (-473.244) -- 0:00:16
717000 -- (-473.835) (-475.519) (-474.397) [-473.956] * (-472.444) [-472.449] (-478.924) (-476.247) -- 0:00:16
717500 -- (-478.231) (-477.663) [-475.408] (-473.512) * (-473.763) [-472.304] (-472.886) (-479.913) -- 0:00:16
718000 -- (-478.140) (-474.004) [-476.062] (-473.712) * [-474.280] (-473.454) (-474.056) (-476.445) -- 0:00:16
718500 -- (-475.714) (-474.176) [-477.409] (-479.410) * [-473.326] (-473.954) (-474.832) (-475.382) -- 0:00:16
719000 -- (-476.498) (-474.191) (-474.452) [-475.231] * (-474.030) (-476.440) [-476.838] (-478.747) -- 0:00:16
719500 -- (-473.103) (-474.966) [-473.158] (-475.098) * (-477.623) (-476.565) [-474.574] (-476.577) -- 0:00:16
720000 -- [-473.909] (-474.264) (-477.091) (-475.877) * (-474.990) [-474.374] (-475.974) (-475.346) -- 0:00:16
Average standard deviation of split frequencies: 0.009812
720500 -- (-474.180) [-472.974] (-478.900) (-478.941) * [-476.060] (-473.013) (-473.788) (-478.288) -- 0:00:16
721000 -- [-473.975] (-474.141) (-476.120) (-475.298) * (-472.903) (-473.809) (-473.101) [-473.405] -- 0:00:16
721500 -- [-473.107] (-475.673) (-476.431) (-479.510) * (-473.443) (-474.978) (-474.601) [-473.475] -- 0:00:16
722000 -- (-475.913) (-473.821) (-473.716) [-475.664] * (-474.573) (-479.410) (-476.862) [-474.106] -- 0:00:16
722500 -- (-475.205) (-474.245) [-474.396] (-474.176) * (-474.362) (-474.229) (-473.404) [-473.750] -- 0:00:16
723000 -- (-473.476) (-475.561) (-474.010) [-472.913] * (-484.627) [-473.575] (-474.947) (-479.674) -- 0:00:16
723500 -- (-474.126) [-475.403] (-473.908) (-476.902) * [-476.545] (-472.536) (-478.394) (-481.967) -- 0:00:16
724000 -- (-472.969) (-475.065) (-477.377) [-473.921] * (-475.390) (-475.448) (-475.264) [-474.506] -- 0:00:16
724500 -- (-476.887) (-474.224) [-472.905] (-476.522) * (-476.055) [-474.773] (-475.933) (-478.428) -- 0:00:16
725000 -- (-478.029) (-474.808) (-476.680) [-475.583] * (-473.212) (-475.327) [-475.755] (-478.890) -- 0:00:16
Average standard deviation of split frequencies: 0.010129
725500 -- (-475.216) (-475.254) [-476.041] (-475.298) * (-474.945) (-478.139) [-475.087] (-474.928) -- 0:00:16
726000 -- (-473.414) (-474.398) (-475.030) [-476.441] * [-476.190] (-478.027) (-473.393) (-473.797) -- 0:00:16
726500 -- (-475.873) [-474.469] (-476.193) (-475.535) * (-476.448) (-479.436) [-473.237] (-475.534) -- 0:00:16
727000 -- (-474.907) (-479.490) [-474.944] (-474.902) * (-474.137) (-473.149) [-474.697] (-474.196) -- 0:00:16
727500 -- (-474.306) (-478.651) (-472.578) [-474.395] * [-476.010] (-476.748) (-475.352) (-474.167) -- 0:00:16
728000 -- (-474.144) (-475.785) [-473.240] (-473.280) * (-477.069) [-473.660] (-474.774) (-474.313) -- 0:00:16
728500 -- (-479.427) [-474.600] (-473.956) (-472.834) * (-476.820) [-475.467] (-476.963) (-472.610) -- 0:00:16
729000 -- [-474.404] (-476.416) (-478.657) (-474.390) * (-472.616) (-473.286) (-482.993) [-473.729] -- 0:00:15
729500 -- (-472.853) [-472.840] (-476.083) (-474.962) * (-476.573) [-472.739] (-477.765) (-474.482) -- 0:00:15
730000 -- (-473.203) (-472.287) (-475.119) [-477.793] * (-473.012) (-478.068) [-475.712] (-473.818) -- 0:00:15
Average standard deviation of split frequencies: 0.009764
730500 -- (-473.286) (-476.066) (-477.070) [-474.467] * (-472.645) (-480.762) (-474.197) [-472.702] -- 0:00:15
731000 -- (-474.382) (-474.572) [-472.947] (-475.688) * [-474.008] (-472.237) (-474.708) (-474.612) -- 0:00:15
731500 -- (-473.034) (-479.184) [-475.657] (-474.076) * [-473.090] (-474.349) (-473.854) (-473.293) -- 0:00:15
732000 -- (-473.965) [-474.052] (-473.272) (-474.149) * [-474.685] (-476.756) (-474.487) (-473.906) -- 0:00:15
732500 -- [-474.446] (-473.083) (-474.684) (-477.937) * (-475.563) (-474.151) (-478.271) [-475.067] -- 0:00:15
733000 -- (-474.414) (-473.071) (-472.345) [-474.027] * (-472.934) [-473.423] (-477.087) (-478.342) -- 0:00:15
733500 -- (-476.789) (-475.203) (-472.446) [-474.920] * (-472.570) [-474.288] (-477.654) (-473.446) -- 0:00:15
734000 -- (-479.154) (-474.402) (-473.298) [-474.548] * (-473.546) (-475.242) (-476.253) [-472.883] -- 0:00:15
734500 -- (-474.890) [-474.000] (-475.695) (-476.754) * [-473.788] (-477.088) (-478.672) (-475.553) -- 0:00:15
735000 -- [-476.163] (-473.998) (-472.581) (-473.942) * [-473.771] (-474.940) (-475.123) (-476.624) -- 0:00:15
Average standard deviation of split frequencies: 0.009864
735500 -- (-478.208) (-476.702) [-475.065] (-477.145) * [-475.088] (-479.313) (-474.141) (-474.779) -- 0:00:15
736000 -- [-473.707] (-477.408) (-472.704) (-478.711) * [-475.649] (-475.541) (-474.848) (-478.315) -- 0:00:15
736500 -- (-473.169) [-474.622] (-472.929) (-474.358) * (-475.493) [-473.358] (-477.138) (-474.265) -- 0:00:15
737000 -- (-473.231) (-476.092) (-473.630) [-474.103] * (-476.678) (-472.420) [-474.287] (-473.630) -- 0:00:15
737500 -- (-474.111) [-473.033] (-473.831) (-474.502) * (-472.378) (-474.045) (-473.597) [-473.703] -- 0:00:15
738000 -- (-474.286) [-475.344] (-472.114) (-473.535) * (-475.684) [-473.785] (-473.977) (-472.486) -- 0:00:15
738500 -- (-474.420) [-473.049] (-477.362) (-473.493) * (-476.233) [-479.012] (-472.917) (-475.828) -- 0:00:15
739000 -- (-473.308) (-473.038) (-476.885) [-473.678] * (-475.014) (-478.011) [-474.792] (-479.380) -- 0:00:15
739500 -- (-475.734) (-472.606) (-474.241) [-472.449] * [-473.296] (-475.678) (-477.403) (-473.148) -- 0:00:15
740000 -- (-474.216) (-473.193) (-474.336) [-472.965] * [-474.954] (-475.190) (-473.566) (-474.538) -- 0:00:15
Average standard deviation of split frequencies: 0.009420
740500 -- (-473.398) (-474.814) (-476.531) [-473.217] * [-475.386] (-476.977) (-475.613) (-476.797) -- 0:00:15
741000 -- [-472.787] (-473.029) (-477.728) (-474.151) * (-475.909) [-477.931] (-475.106) (-475.046) -- 0:00:15
741500 -- [-472.760] (-475.457) (-474.468) (-473.800) * (-474.059) [-473.075] (-474.907) (-475.326) -- 0:00:15
742000 -- (-474.106) (-477.720) [-474.245] (-473.564) * (-473.319) [-473.091] (-474.836) (-474.938) -- 0:00:15
742500 -- (-475.507) (-474.048) [-474.127] (-474.870) * (-474.258) (-473.478) [-475.067] (-475.958) -- 0:00:15
743000 -- (-478.701) (-476.392) [-472.830] (-473.189) * (-474.708) (-473.337) [-474.215] (-473.732) -- 0:00:15
743500 -- (-473.850) (-474.566) (-474.238) [-473.614] * (-476.271) (-474.532) (-475.245) [-472.479] -- 0:00:15
744000 -- (-473.494) (-480.166) [-473.858] (-473.157) * (-474.545) (-478.038) (-473.953) [-473.202] -- 0:00:15
744500 -- (-476.193) (-475.378) [-478.154] (-474.742) * (-475.417) (-476.455) (-473.755) [-473.833] -- 0:00:15
745000 -- (-477.304) (-473.619) (-474.343) [-475.131] * (-475.474) (-475.468) [-474.642] (-475.338) -- 0:00:15
Average standard deviation of split frequencies: 0.009647
745500 -- [-476.485] (-474.476) (-477.878) (-472.959) * (-475.822) [-474.193] (-475.469) (-474.749) -- 0:00:15
746000 -- (-475.493) (-477.136) (-473.710) [-473.498] * (-472.982) [-473.969] (-474.055) (-474.388) -- 0:00:14
746500 -- (-474.937) (-477.751) [-472.748] (-473.788) * (-476.881) (-475.216) (-473.765) [-473.062] -- 0:00:14
747000 -- [-478.420] (-482.592) (-473.812) (-472.954) * (-475.416) (-474.253) [-473.202] (-473.577) -- 0:00:14
747500 -- (-474.684) (-473.556) [-475.838] (-476.014) * (-474.514) (-474.767) (-473.149) [-473.676] -- 0:00:14
748000 -- (-476.875) (-472.944) [-473.226] (-472.210) * (-475.178) (-475.962) [-476.887] (-477.778) -- 0:00:14
748500 -- (-475.155) (-473.145) [-473.070] (-473.967) * (-474.978) (-474.659) (-473.342) [-478.034] -- 0:00:14
749000 -- [-473.602] (-475.798) (-473.719) (-474.865) * (-474.817) (-476.221) [-474.128] (-475.511) -- 0:00:14
749500 -- [-477.282] (-473.455) (-473.774) (-474.694) * (-476.027) (-473.985) (-476.246) [-477.470] -- 0:00:14
750000 -- [-473.221] (-478.021) (-474.353) (-475.535) * (-475.734) (-475.223) (-476.790) [-473.662] -- 0:00:14
Average standard deviation of split frequencies: 0.009169
750500 -- (-473.770) (-473.503) [-473.015] (-477.449) * (-474.663) (-473.244) (-473.523) [-475.128] -- 0:00:14
751000 -- [-472.672] (-473.088) (-475.911) (-476.208) * (-472.671) [-472.846] (-475.129) (-473.424) -- 0:00:14
751500 -- (-473.226) (-476.910) (-476.029) [-478.286] * (-474.228) (-473.707) [-474.354] (-477.630) -- 0:00:14
752000 -- (-473.416) [-477.744] (-480.722) (-472.895) * (-473.134) (-477.286) [-473.470] (-474.106) -- 0:00:14
752500 -- (-472.435) (-473.483) [-473.645] (-474.523) * (-472.987) [-475.749] (-473.936) (-479.641) -- 0:00:14
753000 -- [-474.717] (-473.117) (-473.123) (-472.823) * (-473.953) [-474.746] (-475.311) (-477.882) -- 0:00:14
753500 -- [-475.689] (-473.708) (-477.194) (-472.374) * [-473.976] (-474.065) (-472.865) (-476.372) -- 0:00:14
754000 -- [-474.192] (-476.733) (-472.829) (-474.694) * (-472.741) (-473.524) (-474.624) [-473.582] -- 0:00:14
754500 -- (-477.484) (-474.949) (-473.980) [-478.550] * (-473.496) [-474.313] (-474.028) (-474.155) -- 0:00:14
755000 -- (-476.280) [-473.631] (-478.943) (-477.539) * (-478.859) (-476.832) [-476.136] (-474.959) -- 0:00:14
Average standard deviation of split frequencies: 0.008896
755500 -- [-477.231] (-474.567) (-473.027) (-476.353) * (-478.169) (-476.912) [-473.325] (-473.608) -- 0:00:14
756000 -- (-474.489) [-473.455] (-472.654) (-476.282) * (-474.644) (-473.367) [-474.377] (-473.890) -- 0:00:14
756500 -- (-474.022) (-473.749) (-478.748) [-472.452] * (-472.659) [-477.583] (-477.629) (-472.547) -- 0:00:14
757000 -- (-476.081) (-474.715) (-474.549) [-472.552] * (-473.170) (-474.024) (-474.442) [-474.092] -- 0:00:14
757500 -- (-476.901) (-477.690) (-475.639) [-477.382] * (-475.178) (-474.024) (-476.782) [-476.634] -- 0:00:14
758000 -- (-475.023) [-475.605] (-473.415) (-475.735) * (-473.266) [-473.473] (-475.856) (-474.393) -- 0:00:14
758500 -- (-475.638) [-475.614] (-476.676) (-476.941) * (-473.263) (-473.932) [-474.293] (-473.293) -- 0:00:14
759000 -- [-475.063] (-474.376) (-474.249) (-475.555) * (-474.131) (-477.492) (-475.652) [-474.446] -- 0:00:14
759500 -- (-473.983) (-474.155) (-472.518) [-474.762] * (-473.122) [-475.336] (-475.715) (-475.343) -- 0:00:14
760000 -- (-475.892) (-476.734) (-473.794) [-474.524] * [-476.357] (-477.401) (-473.980) (-473.858) -- 0:00:14
Average standard deviation of split frequencies: 0.009172
760500 -- (-479.753) [-474.995] (-474.313) (-473.004) * (-481.844) (-476.162) [-474.045] (-475.777) -- 0:00:14
761000 -- (-473.991) (-476.190) (-478.730) [-473.450] * (-474.657) (-475.332) [-473.703] (-474.299) -- 0:00:14
761500 -- [-472.880] (-477.520) (-476.110) (-474.900) * [-473.378] (-473.270) (-474.056) (-475.271) -- 0:00:14
762000 -- [-473.284] (-475.327) (-474.659) (-473.533) * (-473.190) (-472.437) [-475.750] (-475.495) -- 0:00:14
762500 -- (-473.467) (-475.477) [-473.395] (-473.746) * [-474.982] (-473.545) (-476.094) (-474.217) -- 0:00:14
763000 -- (-473.262) (-474.506) [-476.499] (-474.080) * (-473.278) [-473.086] (-475.890) (-474.223) -- 0:00:13
763500 -- (-472.857) (-479.053) [-474.846] (-478.051) * [-476.331] (-472.924) (-473.526) (-472.327) -- 0:00:13
764000 -- (-473.702) (-476.151) [-474.248] (-476.956) * (-472.187) [-474.680] (-475.478) (-474.398) -- 0:00:13
764500 -- (-473.168) (-475.560) [-473.191] (-475.585) * (-473.722) (-473.444) (-473.624) [-474.344] -- 0:00:13
765000 -- (-472.483) (-476.159) (-473.923) [-477.571] * (-473.752) (-472.782) (-476.443) [-473.519] -- 0:00:13
Average standard deviation of split frequencies: 0.009231
765500 -- (-473.282) (-474.040) [-474.874] (-473.080) * (-474.718) (-473.377) (-475.157) [-473.618] -- 0:00:13
766000 -- (-472.660) (-475.506) (-473.418) [-472.848] * (-472.815) (-475.171) (-476.345) [-473.248] -- 0:00:13
766500 -- (-473.246) (-475.051) [-472.911] (-472.906) * (-473.901) (-475.620) (-474.541) [-472.678] -- 0:00:13
767000 -- [-472.460] (-473.803) (-476.391) (-478.637) * [-475.103] (-473.410) (-473.300) (-472.870) -- 0:00:13
767500 -- (-473.881) [-483.245] (-474.611) (-475.294) * [-475.583] (-475.395) (-475.348) (-475.893) -- 0:00:13
768000 -- (-477.009) (-475.342) [-475.152] (-475.924) * [-474.767] (-472.684) (-474.752) (-475.989) -- 0:00:13
768500 -- [-474.297] (-475.268) (-477.170) (-474.958) * [-474.953] (-474.428) (-473.253) (-478.168) -- 0:00:13
769000 -- [-473.758] (-473.179) (-476.005) (-478.215) * (-473.878) [-473.939] (-472.677) (-474.405) -- 0:00:13
769500 -- [-472.976] (-473.080) (-475.181) (-477.754) * (-474.170) [-474.473] (-473.477) (-473.734) -- 0:00:13
770000 -- (-475.801) (-473.996) [-474.417] (-474.971) * (-475.559) (-475.579) (-475.168) [-476.198] -- 0:00:13
Average standard deviation of split frequencies: 0.009216
770500 -- (-473.791) [-475.357] (-476.323) (-473.986) * [-473.958] (-473.497) (-479.540) (-474.857) -- 0:00:13
771000 -- (-474.201) [-472.614] (-474.178) (-473.064) * (-474.824) (-473.871) [-472.338] (-474.816) -- 0:00:13
771500 -- (-475.873) (-476.665) [-473.320] (-475.492) * [-473.250] (-477.159) (-475.894) (-473.315) -- 0:00:13
772000 -- [-477.705] (-476.172) (-472.880) (-474.340) * [-473.668] (-473.667) (-477.293) (-477.207) -- 0:00:13
772500 -- (-474.769) (-475.521) (-474.450) [-475.752] * [-473.196] (-474.162) (-474.015) (-476.893) -- 0:00:13
773000 -- (-474.478) (-473.734) [-472.418] (-473.867) * (-476.334) (-474.318) (-473.996) [-475.114] -- 0:00:13
773500 -- (-474.471) (-481.160) [-474.635] (-473.594) * (-476.070) (-473.999) (-472.852) [-472.233] -- 0:00:13
774000 -- (-476.744) (-474.838) (-473.942) [-472.818] * (-474.446) (-475.019) [-473.601] (-475.969) -- 0:00:13
774500 -- (-475.460) (-473.042) (-474.792) [-473.122] * (-480.842) (-475.070) (-474.619) [-474.205] -- 0:00:13
775000 -- [-474.167] (-474.438) (-474.868) (-473.310) * [-475.320] (-473.410) (-474.014) (-475.465) -- 0:00:13
Average standard deviation of split frequencies: 0.009598
775500 -- (-473.876) (-475.371) (-472.681) [-474.162] * (-475.952) [-473.253] (-472.623) (-475.910) -- 0:00:13
776000 -- (-477.309) [-473.005] (-474.113) (-473.730) * [-472.652] (-474.332) (-475.102) (-478.115) -- 0:00:13
776500 -- [-472.703] (-474.462) (-472.658) (-473.246) * (-476.432) (-474.222) [-477.251] (-473.614) -- 0:00:13
777000 -- [-472.840] (-474.366) (-473.793) (-474.115) * (-474.806) [-475.481] (-474.924) (-473.931) -- 0:00:13
777500 -- (-474.386) [-472.801] (-474.347) (-473.298) * [-475.931] (-475.659) (-474.472) (-473.711) -- 0:00:13
778000 -- (-473.281) (-474.527) (-474.105) [-473.240] * (-473.460) (-473.340) (-473.008) [-474.211] -- 0:00:13
778500 -- (-472.930) (-473.940) [-472.897] (-477.187) * (-474.931) [-473.278] (-474.092) (-475.458) -- 0:00:13
779000 -- (-476.093) (-474.125) [-477.460] (-475.434) * (-472.697) (-475.635) (-474.007) [-474.180] -- 0:00:13
779500 -- (-475.042) (-473.193) [-475.570] (-476.452) * [-476.260] (-476.580) (-475.779) (-473.751) -- 0:00:13
780000 -- [-473.953] (-472.764) (-473.425) (-474.264) * (-475.113) (-472.751) (-477.589) [-474.491] -- 0:00:12
Average standard deviation of split frequencies: 0.009943
780500 -- (-476.012) [-475.159] (-473.166) (-472.587) * [-475.456] (-473.267) (-477.494) (-474.862) -- 0:00:12
781000 -- (-474.345) (-473.500) [-475.100] (-474.291) * [-473.795] (-475.000) (-475.642) (-473.925) -- 0:00:12
781500 -- (-475.466) (-473.101) (-474.494) [-473.261] * (-474.980) (-475.271) (-477.974) [-472.566] -- 0:00:12
782000 -- (-473.936) (-472.867) [-476.105] (-473.759) * [-474.757] (-475.294) (-474.688) (-475.404) -- 0:00:12
782500 -- (-477.318) (-474.040) [-473.881] (-473.973) * (-472.699) (-474.865) [-476.929] (-474.513) -- 0:00:12
783000 -- (-474.222) [-474.891] (-472.531) (-473.719) * (-473.417) [-475.335] (-477.731) (-475.928) -- 0:00:12
783500 -- (-474.164) (-475.890) (-476.389) [-477.523] * [-474.702] (-473.029) (-477.889) (-473.471) -- 0:00:12
784000 -- (-472.332) (-475.944) [-474.329] (-474.108) * (-476.836) [-472.289] (-477.673) (-472.351) -- 0:00:12
784500 -- (-475.818) (-476.952) (-475.409) [-474.914] * (-474.462) (-475.317) [-472.849] (-475.049) -- 0:00:12
785000 -- (-475.598) (-475.424) (-475.127) [-475.461] * (-473.028) (-478.488) (-473.202) [-474.539] -- 0:00:12
Average standard deviation of split frequencies: 0.009756
785500 -- (-473.336) [-474.650] (-475.940) (-473.654) * (-473.389) (-475.864) [-475.365] (-473.494) -- 0:00:12
786000 -- (-473.824) (-475.450) [-473.246] (-474.611) * (-474.800) (-476.597) (-474.817) [-475.160] -- 0:00:12
786500 -- (-478.006) (-476.773) [-473.167] (-479.782) * (-477.027) [-476.274] (-474.423) (-475.431) -- 0:00:12
787000 -- (-475.374) (-475.294) [-472.719] (-475.476) * (-475.107) (-474.896) [-473.206] (-473.390) -- 0:00:12
787500 -- (-474.585) (-475.972) [-473.216] (-476.266) * (-475.520) (-474.750) [-475.088] (-474.538) -- 0:00:12
788000 -- (-473.715) (-475.127) [-474.155] (-472.281) * (-475.609) (-478.275) (-473.700) [-475.903] -- 0:00:12
788500 -- (-474.645) (-475.230) (-473.930) [-473.262] * (-474.049) (-473.169) [-472.325] (-473.158) -- 0:00:12
789000 -- [-473.303] (-473.287) (-474.194) (-473.764) * (-480.417) (-474.228) (-472.790) [-474.863] -- 0:00:12
789500 -- [-473.289] (-473.614) (-473.790) (-473.420) * (-473.547) [-473.383] (-476.835) (-473.641) -- 0:00:12
790000 -- [-473.713] (-475.664) (-472.959) (-477.549) * (-474.147) [-472.655] (-472.526) (-482.306) -- 0:00:12
Average standard deviation of split frequencies: 0.010175
790500 -- (-474.371) (-474.112) [-473.422] (-477.553) * (-475.865) [-475.065] (-473.250) (-479.826) -- 0:00:12
791000 -- (-474.357) (-472.151) (-473.242) [-473.522] * (-472.703) (-473.465) [-475.056] (-476.303) -- 0:00:12
791500 -- [-473.022] (-473.849) (-473.655) (-475.147) * [-475.267] (-474.723) (-476.855) (-474.244) -- 0:00:12
792000 -- (-473.211) (-472.149) (-474.193) [-476.767] * (-477.122) (-474.749) (-473.699) [-474.317] -- 0:00:12
792500 -- [-474.855] (-474.150) (-477.123) (-473.776) * [-472.937] (-472.771) (-472.805) (-474.320) -- 0:00:12
793000 -- [-473.267] (-475.722) (-473.497) (-475.501) * (-474.201) [-477.640] (-474.085) (-475.487) -- 0:00:12
793500 -- (-472.509) (-474.334) [-476.858] (-477.390) * (-477.198) [-478.542] (-477.680) (-473.393) -- 0:00:12
794000 -- [-473.307] (-478.756) (-473.589) (-473.079) * (-475.322) (-478.539) (-479.146) [-474.024] -- 0:00:12
794500 -- (-473.157) [-476.150] (-473.245) (-476.021) * (-474.608) (-479.296) (-480.541) [-473.511] -- 0:00:12
795000 -- (-472.987) (-474.052) [-477.116] (-474.175) * (-474.360) (-484.031) [-472.699] (-475.177) -- 0:00:12
Average standard deviation of split frequencies: 0.009870
795500 -- (-473.943) [-472.591] (-481.445) (-472.372) * [-475.287] (-474.186) (-472.781) (-473.526) -- 0:00:12
796000 -- (-473.795) [-474.555] (-476.180) (-474.345) * (-474.985) (-473.426) [-474.541] (-474.133) -- 0:00:12
796500 -- [-474.059] (-473.221) (-475.736) (-476.239) * (-473.188) (-472.551) [-473.663] (-473.940) -- 0:00:12
797000 -- (-473.074) [-476.689] (-473.619) (-474.385) * [-474.130] (-473.667) (-473.460) (-474.016) -- 0:00:11
797500 -- (-475.325) (-472.193) (-477.980) [-475.028] * (-475.274) [-474.983] (-478.672) (-474.218) -- 0:00:11
798000 -- (-475.043) (-473.580) [-476.952] (-476.211) * (-473.984) (-476.218) [-475.903] (-472.322) -- 0:00:11
798500 -- (-477.844) (-473.993) [-474.116] (-475.671) * (-475.660) [-472.767] (-476.017) (-473.701) -- 0:00:11
799000 -- (-475.227) (-474.872) (-477.946) [-473.324] * [-475.893] (-473.798) (-474.946) (-474.217) -- 0:00:11
799500 -- (-472.372) (-473.624) [-474.415] (-473.293) * (-476.147) (-474.822) (-474.526) [-473.808] -- 0:00:11
800000 -- (-473.521) [-476.772] (-473.327) (-475.101) * (-475.092) [-472.416] (-473.659) (-476.212) -- 0:00:11
Average standard deviation of split frequencies: 0.009970
800500 -- (-476.815) [-475.843] (-474.801) (-474.605) * (-474.941) (-475.329) (-473.579) [-474.660] -- 0:00:11
801000 -- (-476.118) (-473.835) [-478.482] (-473.945) * [-475.340] (-474.608) (-474.321) (-475.151) -- 0:00:11
801500 -- [-473.640] (-475.946) (-474.355) (-473.613) * [-473.549] (-483.832) (-473.627) (-475.212) -- 0:00:11
802000 -- (-477.454) (-475.783) (-481.083) [-477.067] * (-473.491) [-477.191] (-474.006) (-477.314) -- 0:00:11
802500 -- (-473.141) (-476.598) [-473.587] (-476.116) * (-473.526) [-480.024] (-474.212) (-472.412) -- 0:00:11
803000 -- (-475.105) [-475.397] (-475.382) (-474.409) * (-474.313) (-473.689) (-478.464) [-472.785] -- 0:00:11
803500 -- (-476.293) (-477.998) (-479.196) [-473.359] * (-482.856) (-475.262) (-476.900) [-472.852] -- 0:00:11
804000 -- (-476.459) (-478.383) (-474.078) [-476.120] * (-473.189) (-474.047) (-475.796) [-473.810] -- 0:00:11
804500 -- [-472.332] (-481.746) (-474.398) (-474.401) * [-473.798] (-472.885) (-474.849) (-473.360) -- 0:00:11
805000 -- (-472.868) (-473.924) (-473.740) [-473.875] * [-472.620] (-473.521) (-474.842) (-473.768) -- 0:00:11
Average standard deviation of split frequencies: 0.009553
805500 -- [-476.240] (-475.530) (-475.354) (-474.811) * (-474.446) (-475.083) (-478.223) [-475.153] -- 0:00:11
806000 -- (-474.567) (-474.313) [-474.357] (-475.622) * (-474.659) [-474.862] (-472.742) (-473.053) -- 0:00:11
806500 -- (-477.192) [-474.134] (-477.664) (-473.880) * (-477.310) (-475.017) [-473.250] (-473.156) -- 0:00:11
807000 -- (-473.955) (-472.795) [-476.824] (-473.454) * (-473.722) (-475.578) (-474.157) [-474.017] -- 0:00:11
807500 -- (-474.278) (-475.364) (-474.089) [-472.839] * [-473.420] (-473.890) (-473.168) (-472.790) -- 0:00:11
808000 -- (-476.100) [-475.190] (-473.511) (-474.038) * (-475.028) (-472.983) (-474.919) [-473.544] -- 0:00:11
808500 -- (-474.967) (-476.625) (-474.444) [-473.711] * (-474.626) (-474.555) (-478.565) [-476.249] -- 0:00:11
809000 -- (-472.792) (-474.314) [-474.596] (-477.549) * (-474.676) [-476.517] (-475.528) (-475.509) -- 0:00:11
809500 -- (-474.693) (-474.182) (-475.302) [-474.186] * [-475.300] (-474.056) (-475.137) (-472.867) -- 0:00:11
810000 -- (-472.628) [-472.886] (-473.642) (-476.116) * (-474.857) (-474.046) (-477.395) [-475.049] -- 0:00:11
Average standard deviation of split frequencies: 0.009808
810500 -- [-475.675] (-473.945) (-475.104) (-474.276) * (-475.815) (-479.608) [-473.854] (-473.140) -- 0:00:11
811000 -- (-475.742) (-477.176) [-475.108] (-477.670) * (-474.105) (-474.198) (-478.713) [-473.654] -- 0:00:11
811500 -- [-474.788] (-475.406) (-473.772) (-479.540) * (-476.463) [-474.061] (-473.834) (-476.178) -- 0:00:11
812000 -- (-474.525) [-473.594] (-473.661) (-474.053) * (-474.372) (-472.434) [-479.661] (-475.682) -- 0:00:11
812500 -- [-477.495] (-474.248) (-476.154) (-473.647) * (-479.467) (-477.524) (-473.184) [-474.399] -- 0:00:11
813000 -- (-478.758) (-474.036) (-473.891) [-475.288] * (-473.137) [-474.541] (-474.997) (-474.694) -- 0:00:11
813500 -- [-474.175] (-477.860) (-476.147) (-475.075) * (-473.367) (-472.486) [-472.375] (-478.129) -- 0:00:11
814000 -- [-474.930] (-475.058) (-472.898) (-475.839) * [-472.385] (-473.987) (-473.411) (-481.820) -- 0:00:10
814500 -- (-474.815) [-472.676] (-478.712) (-476.508) * [-473.965] (-473.262) (-472.659) (-474.069) -- 0:00:10
815000 -- (-472.368) [-473.271] (-473.473) (-475.984) * (-473.747) (-475.235) [-473.700] (-474.256) -- 0:00:10
Average standard deviation of split frequencies: 0.009782
815500 -- (-475.239) [-474.173] (-474.635) (-474.680) * (-472.770) (-472.929) [-473.298] (-473.027) -- 0:00:10
816000 -- [-474.104] (-475.811) (-474.481) (-475.491) * [-472.258] (-473.735) (-478.454) (-476.298) -- 0:00:10
816500 -- [-473.922] (-477.946) (-472.656) (-474.172) * [-474.609] (-474.455) (-474.840) (-475.809) -- 0:00:10
817000 -- (-475.942) (-473.444) (-472.867) [-472.771] * (-477.454) (-473.331) [-472.938] (-474.225) -- 0:00:10
817500 -- (-476.977) (-474.101) (-474.536) [-474.974] * (-478.488) (-472.976) (-473.107) [-473.062] -- 0:00:10
818000 -- (-474.079) [-474.378] (-474.677) (-479.012) * (-477.232) (-475.497) (-472.855) [-474.829] -- 0:00:10
818500 -- [-478.682] (-473.923) (-475.189) (-474.043) * (-474.918) (-475.540) (-472.753) [-474.595] -- 0:00:10
819000 -- (-472.248) (-473.680) (-474.944) [-472.303] * (-472.303) (-473.962) [-472.738] (-474.924) -- 0:00:10
819500 -- [-474.490] (-473.000) (-473.748) (-473.151) * (-473.211) (-474.028) [-473.738] (-474.793) -- 0:00:10
820000 -- (-473.087) [-472.430] (-472.826) (-474.518) * (-473.214) [-472.795] (-473.359) (-477.666) -- 0:00:10
Average standard deviation of split frequencies: 0.009535
820500 -- (-478.420) [-472.752] (-482.478) (-473.941) * [-477.425] (-472.784) (-476.534) (-473.524) -- 0:00:10
821000 -- (-476.781) [-472.755] (-478.030) (-474.548) * (-473.246) (-475.386) (-475.803) [-473.206] -- 0:00:10
821500 -- (-474.287) (-475.476) (-476.344) [-472.471] * [-472.559] (-474.860) (-476.187) (-475.329) -- 0:00:10
822000 -- (-474.547) [-474.980] (-475.416) (-474.376) * (-474.956) (-473.680) [-476.640] (-476.441) -- 0:00:10
822500 -- (-472.589) (-477.009) [-474.803] (-479.326) * (-475.082) [-472.762] (-476.798) (-473.292) -- 0:00:10
823000 -- (-476.976) (-478.505) (-473.508) [-475.163] * [-473.730] (-473.755) (-476.092) (-474.895) -- 0:00:10
823500 -- (-477.424) (-476.533) [-472.857] (-474.739) * (-476.263) (-473.932) [-475.098] (-474.400) -- 0:00:10
824000 -- (-475.436) [-474.644] (-475.668) (-477.706) * (-472.827) [-473.929] (-473.670) (-474.257) -- 0:00:10
824500 -- (-475.212) (-477.212) [-474.726] (-476.286) * (-473.178) (-474.929) (-473.139) [-477.030] -- 0:00:10
825000 -- [-473.625] (-474.511) (-473.400) (-475.009) * (-472.128) (-474.863) [-474.702] (-473.749) -- 0:00:10
Average standard deviation of split frequencies: 0.009816
825500 -- [-473.069] (-479.858) (-477.638) (-474.709) * (-478.141) (-476.620) [-472.743] (-476.941) -- 0:00:10
826000 -- (-474.263) (-474.202) (-476.033) [-473.602] * (-478.166) (-475.277) [-472.743] (-473.548) -- 0:00:10
826500 -- (-475.933) (-475.648) [-477.363] (-476.676) * [-478.329] (-475.859) (-473.164) (-476.447) -- 0:00:10
827000 -- (-473.711) (-473.170) [-472.671] (-476.796) * (-480.068) (-474.899) [-474.866] (-473.522) -- 0:00:10
827500 -- (-473.695) (-473.530) [-474.976] (-474.762) * (-474.408) (-477.671) [-473.731] (-476.381) -- 0:00:10
828000 -- (-474.444) (-473.716) [-476.061] (-475.467) * [-476.022] (-475.682) (-473.410) (-476.508) -- 0:00:10
828500 -- [-474.261] (-474.788) (-476.827) (-476.506) * (-474.387) [-473.693] (-473.616) (-474.797) -- 0:00:10
829000 -- (-475.715) [-478.809] (-474.644) (-475.934) * (-474.645) [-472.950] (-474.308) (-474.144) -- 0:00:10
829500 -- (-473.749) [-472.847] (-480.087) (-476.127) * [-476.889] (-473.198) (-476.883) (-473.484) -- 0:00:10
830000 -- (-474.819) (-472.828) [-478.449] (-473.438) * [-473.861] (-474.015) (-475.523) (-473.140) -- 0:00:10
Average standard deviation of split frequencies: 0.010026
830500 -- (-473.961) (-473.037) (-473.379) [-477.304] * (-479.876) (-477.619) (-473.860) [-474.195] -- 0:00:10
831000 -- [-473.189] (-481.204) (-473.893) (-476.916) * (-478.647) (-477.814) [-475.640] (-472.579) -- 0:00:09
831500 -- [-473.283] (-474.725) (-474.647) (-474.838) * (-475.364) [-475.712] (-474.405) (-473.610) -- 0:00:09
832000 -- (-474.265) [-478.344] (-473.129) (-476.557) * (-477.187) [-477.213] (-477.529) (-473.469) -- 0:00:09
832500 -- (-472.342) (-476.371) [-473.003] (-474.465) * (-481.096) [-474.947] (-475.867) (-472.615) -- 0:00:09
833000 -- (-472.690) (-473.815) (-477.711) [-474.602] * (-477.598) (-474.297) [-474.850] (-474.216) -- 0:00:09
833500 -- (-477.379) (-477.299) [-474.760] (-476.367) * (-473.300) (-476.817) [-472.952] (-475.464) -- 0:00:09
834000 -- (-474.518) [-478.555] (-475.895) (-475.693) * (-474.685) (-475.995) (-474.050) [-473.532] -- 0:00:09
834500 -- [-472.728] (-473.693) (-474.823) (-473.894) * (-474.797) [-477.658] (-476.827) (-476.200) -- 0:00:09
835000 -- (-478.676) (-478.501) (-475.864) [-474.743] * (-473.534) (-473.962) [-474.748] (-476.546) -- 0:00:09
Average standard deviation of split frequencies: 0.009548
835500 -- [-475.403] (-485.785) (-475.900) (-475.997) * [-476.186] (-475.203) (-474.342) (-473.712) -- 0:00:09
836000 -- (-480.016) (-478.900) (-476.697) [-474.266] * [-473.379] (-474.449) (-475.180) (-472.843) -- 0:00:09
836500 -- (-474.056) (-476.155) (-473.561) [-477.727] * (-473.599) (-475.195) [-474.459] (-475.448) -- 0:00:09
837000 -- (-475.909) (-476.645) (-473.506) [-477.700] * (-473.118) [-473.658] (-472.989) (-473.050) -- 0:00:09
837500 -- (-474.394) (-474.197) [-474.059] (-474.470) * [-473.394] (-475.606) (-475.450) (-474.010) -- 0:00:09
838000 -- [-474.096] (-472.565) (-472.480) (-473.747) * (-476.372) (-477.102) [-476.812] (-478.554) -- 0:00:09
838500 -- (-475.236) (-473.675) [-473.742] (-474.573) * [-474.917] (-472.811) (-474.716) (-474.621) -- 0:00:09
839000 -- (-482.205) (-473.395) (-475.829) [-474.641] * [-474.244] (-473.474) (-481.377) (-474.955) -- 0:00:09
839500 -- (-476.741) (-474.332) [-472.516] (-475.993) * (-474.326) [-476.068] (-475.424) (-473.989) -- 0:00:09
840000 -- (-475.019) (-474.366) [-476.046] (-475.817) * [-474.115] (-474.970) (-473.198) (-474.622) -- 0:00:09
Average standard deviation of split frequencies: 0.009608
840500 -- [-475.985] (-474.065) (-474.170) (-472.924) * (-473.654) (-474.983) [-474.470] (-480.073) -- 0:00:09
841000 -- (-474.636) (-475.538) [-479.011] (-472.721) * (-475.210) (-477.604) [-474.604] (-477.380) -- 0:00:09
841500 -- (-474.705) (-473.594) [-475.077] (-473.825) * (-474.407) (-475.301) [-473.906] (-473.950) -- 0:00:09
842000 -- (-474.232) [-473.482] (-474.786) (-473.796) * (-476.390) (-473.120) (-475.597) [-475.784] -- 0:00:09
842500 -- (-473.406) (-474.415) [-474.064] (-472.995) * (-472.445) (-472.539) [-475.503] (-479.325) -- 0:00:09
843000 -- (-477.316) [-476.432] (-476.347) (-476.325) * (-475.898) (-473.730) (-475.686) [-480.044] -- 0:00:09
843500 -- [-473.189] (-474.190) (-475.641) (-474.798) * [-477.256] (-473.529) (-474.260) (-475.517) -- 0:00:09
844000 -- (-474.021) (-473.711) [-474.340] (-474.564) * (-475.760) (-472.922) [-473.129] (-474.245) -- 0:00:09
844500 -- (-473.855) (-477.746) [-474.891] (-472.883) * (-479.085) [-475.130] (-473.097) (-476.477) -- 0:00:09
845000 -- [-473.130] (-476.239) (-473.489) (-475.472) * (-473.099) (-479.421) [-473.676] (-477.477) -- 0:00:09
Average standard deviation of split frequencies: 0.009287
845500 -- (-475.437) (-472.684) [-473.593] (-476.525) * (-473.787) [-472.902] (-472.762) (-476.323) -- 0:00:09
846000 -- [-472.451] (-472.996) (-474.758) (-478.111) * (-472.736) (-473.061) [-472.832] (-473.181) -- 0:00:09
846500 -- (-473.909) [-477.633] (-477.086) (-476.364) * [-477.839] (-476.742) (-478.113) (-473.591) -- 0:00:09
847000 -- [-474.630] (-474.866) (-474.998) (-472.898) * (-475.827) (-477.798) (-481.024) [-473.018] -- 0:00:09
847500 -- (-480.393) (-477.073) [-473.816] (-473.010) * (-475.234) [-472.716] (-476.822) (-474.641) -- 0:00:08
848000 -- (-475.062) (-474.619) [-472.764] (-472.486) * (-477.681) [-475.008] (-476.825) (-477.465) -- 0:00:08
848500 -- (-475.856) [-475.265] (-472.854) (-472.651) * (-472.862) (-474.369) [-473.160] (-472.567) -- 0:00:08
849000 -- (-476.205) (-480.604) (-479.889) [-472.579] * [-475.533] (-473.631) (-472.773) (-477.405) -- 0:00:08
849500 -- (-477.989) (-479.386) (-477.472) [-473.288] * (-474.446) [-473.266] (-473.021) (-473.716) -- 0:00:08
850000 -- (-476.801) (-473.795) [-472.709] (-472.823) * [-474.966] (-473.494) (-474.001) (-476.706) -- 0:00:08
Average standard deviation of split frequencies: 0.009310
850500 -- [-476.353] (-475.506) (-474.978) (-474.324) * (-475.389) [-473.330] (-473.955) (-477.252) -- 0:00:08
851000 -- (-475.453) (-475.159) [-473.878] (-477.303) * (-476.391) (-474.194) [-475.246] (-478.087) -- 0:00:08
851500 -- (-475.793) [-474.798] (-478.173) (-473.653) * [-473.463] (-483.676) (-474.407) (-483.012) -- 0:00:08
852000 -- (-477.867) (-474.652) (-477.307) [-474.199] * (-473.600) [-473.154] (-475.674) (-480.547) -- 0:00:08
852500 -- (-475.402) (-475.169) (-474.218) [-472.287] * (-474.291) (-475.426) [-474.850] (-482.102) -- 0:00:08
853000 -- (-474.080) (-474.258) (-472.752) [-472.893] * (-473.687) (-475.418) [-478.121] (-474.579) -- 0:00:08
853500 -- (-475.117) (-473.180) [-474.241] (-473.922) * (-472.993) [-473.809] (-476.801) (-474.169) -- 0:00:08
854000 -- (-474.045) (-475.416) [-475.197] (-473.643) * (-473.744) (-472.828) (-475.721) [-479.097] -- 0:00:08
854500 -- [-475.339] (-477.383) (-476.155) (-475.894) * (-476.421) (-477.194) [-474.406] (-473.165) -- 0:00:08
855000 -- [-474.716] (-482.673) (-473.383) (-478.375) * (-476.444) [-475.721] (-472.867) (-475.116) -- 0:00:08
Average standard deviation of split frequencies: 0.009142
855500 -- (-475.064) (-472.910) [-474.826] (-473.269) * (-472.524) (-474.375) [-473.019] (-476.403) -- 0:00:08
856000 -- (-473.849) [-474.640] (-473.092) (-472.282) * (-472.624) (-472.530) [-475.247] (-480.694) -- 0:00:08
856500 -- (-478.510) [-475.939] (-473.879) (-472.990) * (-473.975) (-475.803) [-476.293] (-475.464) -- 0:00:08
857000 -- (-474.539) [-473.369] (-475.482) (-473.392) * [-476.799] (-475.037) (-478.813) (-475.842) -- 0:00:08
857500 -- (-475.980) (-475.029) (-473.548) [-474.071] * [-474.416] (-474.081) (-475.117) (-475.800) -- 0:00:08
858000 -- (-474.556) (-475.275) [-475.266] (-472.854) * [-473.364] (-475.789) (-474.373) (-479.084) -- 0:00:08
858500 -- (-474.194) [-477.175] (-478.966) (-475.400) * [-474.591] (-475.064) (-474.750) (-475.498) -- 0:00:08
859000 -- [-473.852] (-477.519) (-476.528) (-474.828) * (-475.822) (-478.879) [-475.648] (-473.817) -- 0:00:08
859500 -- (-473.189) [-477.514] (-475.055) (-473.606) * (-472.835) (-473.166) [-472.590] (-473.861) -- 0:00:08
860000 -- [-473.536] (-477.737) (-475.036) (-472.481) * [-472.852] (-472.876) (-473.274) (-479.141) -- 0:00:08
Average standard deviation of split frequencies: 0.009348
860500 -- (-473.337) (-477.167) (-473.198) [-473.076] * (-474.680) (-480.316) (-473.185) [-476.681] -- 0:00:08
861000 -- (-474.100) (-474.532) [-472.450] (-473.320) * (-475.128) (-473.775) [-474.065] (-474.415) -- 0:00:08
861500 -- (-474.715) (-474.461) [-474.225] (-476.825) * (-473.204) (-477.543) (-472.875) [-473.454] -- 0:00:08
862000 -- (-483.427) [-474.195] (-472.984) (-474.987) * (-473.851) [-472.948] (-472.662) (-473.291) -- 0:00:08
862500 -- (-474.230) (-474.043) [-474.014] (-476.095) * (-474.010) (-477.450) (-472.955) [-475.475] -- 0:00:08
863000 -- (-474.755) (-472.584) (-472.092) [-474.184] * [-476.285] (-481.345) (-477.022) (-478.984) -- 0:00:08
863500 -- (-473.675) (-476.351) (-472.795) [-474.161] * (-476.275) (-472.885) [-476.394] (-476.875) -- 0:00:08
864000 -- (-472.923) (-474.386) (-474.223) [-472.767] * [-477.557] (-473.800) (-473.834) (-474.532) -- 0:00:08
864500 -- (-477.145) (-473.323) (-477.596) [-474.419] * [-478.974] (-474.416) (-475.317) (-474.198) -- 0:00:07
865000 -- (-476.481) (-473.136) [-473.039] (-474.320) * (-482.086) [-473.106] (-475.612) (-474.695) -- 0:00:07
Average standard deviation of split frequencies: 0.009181
865500 -- (-472.572) (-474.656) [-473.144] (-480.356) * [-473.229] (-476.066) (-477.094) (-473.386) -- 0:00:07
866000 -- (-475.131) [-474.815] (-473.170) (-473.710) * (-473.826) (-475.982) (-476.193) [-472.477] -- 0:00:07
866500 -- (-472.864) (-477.491) [-473.116] (-473.190) * (-474.102) [-476.063] (-475.682) (-474.957) -- 0:00:07
867000 -- (-474.415) [-475.456] (-473.284) (-473.426) * (-473.934) [-475.423] (-473.029) (-476.524) -- 0:00:07
867500 -- [-475.453] (-477.749) (-474.027) (-475.879) * (-473.281) (-474.032) [-473.565] (-473.994) -- 0:00:07
868000 -- [-475.077] (-473.717) (-472.816) (-474.065) * [-474.163] (-475.293) (-474.172) (-475.808) -- 0:00:07
868500 -- [-476.218] (-475.091) (-472.575) (-475.255) * (-476.295) (-475.387) [-474.283] (-473.681) -- 0:00:07
869000 -- (-475.247) (-473.874) (-472.280) [-473.574] * [-474.941] (-479.686) (-475.917) (-475.838) -- 0:00:07
869500 -- (-475.838) [-473.727] (-475.671) (-472.517) * (-473.155) (-473.576) [-473.121] (-473.545) -- 0:00:07
870000 -- (-476.608) (-472.910) [-475.563] (-473.827) * (-473.456) (-476.291) (-476.087) [-474.257] -- 0:00:07
Average standard deviation of split frequencies: 0.008410
870500 -- (-474.359) (-477.209) [-474.499] (-479.695) * (-473.272) (-473.418) [-478.264] (-472.962) -- 0:00:07
871000 -- (-473.677) [-473.603] (-475.522) (-475.238) * (-474.091) [-475.021] (-472.818) (-473.301) -- 0:00:07
871500 -- (-476.142) (-474.852) (-474.173) [-476.516] * (-477.730) (-475.650) (-475.453) [-473.826] -- 0:00:07
872000 -- (-475.247) (-475.788) [-474.111] (-474.178) * (-476.466) [-472.928] (-476.070) (-475.090) -- 0:00:07
872500 -- (-473.205) (-474.316) (-474.956) [-472.506] * (-474.653) [-473.596] (-481.615) (-472.757) -- 0:00:07
873000 -- [-473.865] (-475.995) (-474.595) (-476.177) * (-475.802) (-474.942) [-476.351] (-476.524) -- 0:00:07
873500 -- [-474.987] (-475.848) (-473.732) (-474.056) * (-474.600) (-474.225) [-475.126] (-473.030) -- 0:00:07
874000 -- [-476.220] (-473.170) (-472.349) (-473.106) * (-473.248) [-476.588] (-476.897) (-475.630) -- 0:00:07
874500 -- (-473.291) [-472.661] (-472.628) (-474.159) * (-475.215) (-475.221) (-473.913) [-476.731] -- 0:00:07
875000 -- [-474.725] (-472.461) (-476.824) (-475.954) * [-472.964] (-474.132) (-475.264) (-476.607) -- 0:00:07
Average standard deviation of split frequencies: 0.008825
875500 -- [-475.079] (-474.865) (-474.318) (-475.638) * (-472.646) (-473.248) [-475.062] (-474.528) -- 0:00:07
876000 -- [-476.990] (-474.696) (-473.327) (-478.399) * (-475.359) (-472.989) [-476.488] (-476.838) -- 0:00:07
876500 -- (-474.850) [-472.969] (-474.256) (-474.967) * (-475.856) (-475.589) (-477.569) [-473.379] -- 0:00:07
877000 -- (-475.173) [-474.781] (-474.274) (-479.427) * (-476.292) (-480.205) [-474.488] (-476.146) -- 0:00:07
877500 -- (-475.758) [-472.847] (-475.108) (-473.052) * (-480.740) [-478.282] (-477.716) (-477.565) -- 0:00:07
878000 -- [-476.093] (-472.847) (-474.536) (-474.413) * [-473.975] (-472.996) (-473.125) (-473.157) -- 0:00:07
878500 -- (-476.242) (-478.882) [-473.385] (-474.392) * [-474.201] (-476.103) (-472.916) (-476.064) -- 0:00:07
879000 -- (-479.430) [-475.007] (-476.636) (-473.494) * (-474.156) (-476.613) (-474.328) [-479.509] -- 0:00:07
879500 -- (-472.779) (-473.643) [-479.088] (-477.273) * (-474.438) (-475.081) (-474.288) [-474.487] -- 0:00:07
880000 -- (-474.263) (-472.163) (-475.245) [-475.069] * [-475.019] (-477.590) (-473.528) (-472.584) -- 0:00:07
Average standard deviation of split frequencies: 0.008422
880500 -- (-473.358) [-477.271] (-474.945) (-475.516) * [-473.845] (-475.950) (-474.244) (-473.947) -- 0:00:07
881000 -- (-473.569) [-474.121] (-474.919) (-473.783) * (-474.587) (-474.497) [-475.663] (-472.949) -- 0:00:07
881500 -- (-473.444) [-473.892] (-475.312) (-477.266) * (-474.073) [-476.386] (-473.587) (-475.693) -- 0:00:06
882000 -- (-476.933) (-476.109) [-476.116] (-478.666) * (-473.954) [-475.531] (-474.476) (-473.902) -- 0:00:06
882500 -- [-476.740] (-473.953) (-476.565) (-473.170) * [-473.532] (-472.908) (-475.336) (-475.406) -- 0:00:06
883000 -- (-474.004) (-477.544) [-472.423] (-472.425) * [-473.783] (-477.376) (-473.796) (-474.486) -- 0:00:06
883500 -- (-472.719) (-473.329) [-473.647] (-475.110) * (-474.253) (-477.102) [-474.177] (-474.498) -- 0:00:06
884000 -- (-473.584) [-472.914] (-474.799) (-476.537) * (-474.221) (-476.318) [-473.717] (-473.161) -- 0:00:06
884500 -- (-475.025) [-473.698] (-477.232) (-472.982) * (-481.020) [-472.570] (-474.695) (-473.219) -- 0:00:06
885000 -- (-474.406) [-475.831] (-474.227) (-473.933) * (-473.990) (-474.922) (-474.743) [-473.328] -- 0:00:06
Average standard deviation of split frequencies: 0.008442
885500 -- (-476.406) [-474.799] (-474.152) (-473.985) * (-477.276) (-474.696) [-475.407] (-472.924) -- 0:00:06
886000 -- [-472.900] (-473.140) (-473.886) (-475.576) * (-475.978) [-474.116] (-477.491) (-472.881) -- 0:00:06
886500 -- [-474.444] (-474.080) (-475.262) (-477.251) * [-472.058] (-474.118) (-473.757) (-472.758) -- 0:00:06
887000 -- (-473.811) (-474.144) (-475.186) [-474.410] * [-472.244] (-472.792) (-474.627) (-476.758) -- 0:00:06
887500 -- [-475.381] (-474.685) (-475.484) (-477.159) * (-479.758) (-475.069) [-475.041] (-473.543) -- 0:00:06
888000 -- (-473.882) (-475.627) (-473.137) [-474.595] * (-475.384) (-474.565) [-473.965] (-476.266) -- 0:00:06
888500 -- (-478.279) (-472.613) (-478.101) [-474.809] * (-478.482) (-475.698) (-475.338) [-474.422] -- 0:00:06
889000 -- (-476.106) (-473.523) [-474.780] (-475.547) * (-475.161) [-473.525] (-475.200) (-474.229) -- 0:00:06
889500 -- [-475.000] (-472.489) (-478.890) (-477.110) * (-474.746) [-473.284] (-475.210) (-474.366) -- 0:00:06
890000 -- (-474.314) [-475.389] (-475.311) (-476.429) * (-474.442) (-474.610) [-474.008] (-477.064) -- 0:00:06
Average standard deviation of split frequencies: 0.008856
890500 -- (-472.906) (-473.341) [-474.034] (-474.777) * [-475.043] (-473.484) (-473.341) (-475.443) -- 0:00:06
891000 -- (-474.022) [-475.892] (-474.897) (-475.024) * (-473.806) [-473.416] (-472.984) (-476.414) -- 0:00:06
891500 -- (-472.843) (-475.349) [-473.514] (-474.082) * (-472.958) [-478.450] (-474.190) (-478.759) -- 0:00:06
892000 -- (-480.239) (-473.799) (-474.307) [-475.577] * [-476.008] (-484.767) (-475.345) (-474.889) -- 0:00:06
892500 -- (-473.201) [-474.833] (-474.983) (-474.382) * (-477.334) [-474.360] (-474.636) (-475.316) -- 0:00:06
893000 -- [-474.089] (-479.344) (-472.791) (-473.791) * (-476.194) [-472.944] (-475.346) (-474.992) -- 0:00:06
893500 -- [-476.340] (-476.453) (-474.175) (-473.437) * (-481.954) (-474.493) [-477.378] (-473.624) -- 0:00:06
894000 -- (-478.962) [-475.581] (-475.442) (-473.161) * (-477.105) [-472.971] (-474.226) (-474.869) -- 0:00:06
894500 -- (-477.424) (-474.526) [-475.339] (-476.259) * [-475.459] (-473.681) (-472.528) (-475.648) -- 0:00:06
895000 -- (-474.519) (-474.576) (-472.628) [-476.139] * (-479.495) (-477.127) (-472.551) [-475.130] -- 0:00:06
Average standard deviation of split frequencies: 0.007927
895500 -- [-473.175] (-475.803) (-472.986) (-473.781) * [-477.933] (-472.927) (-475.223) (-475.714) -- 0:00:06
896000 -- (-473.833) (-473.418) (-472.964) [-472.313] * [-475.039] (-473.383) (-477.040) (-475.386) -- 0:00:06
896500 -- (-475.722) (-474.750) [-472.677] (-473.957) * [-473.351] (-473.808) (-476.895) (-476.932) -- 0:00:06
897000 -- (-474.832) [-473.051] (-474.572) (-473.019) * (-474.327) (-474.860) (-474.656) [-475.506] -- 0:00:06
897500 -- (-474.072) (-473.997) (-474.517) [-478.194] * (-480.352) [-473.504] (-477.292) (-474.953) -- 0:00:06
898000 -- (-472.835) [-473.234] (-475.033) (-473.714) * [-476.064] (-472.399) (-476.794) (-477.386) -- 0:00:06
898500 -- (-474.982) [-474.336] (-474.821) (-472.248) * (-476.661) [-473.582] (-474.453) (-474.251) -- 0:00:05
899000 -- (-473.979) [-472.581] (-475.173) (-472.286) * (-476.870) (-477.707) [-473.403] (-473.878) -- 0:00:05
899500 -- (-474.790) [-479.052] (-476.201) (-472.782) * (-479.962) (-473.334) [-472.649] (-474.684) -- 0:00:05
900000 -- (-474.945) (-476.227) [-474.394] (-472.528) * (-485.183) [-472.704] (-474.920) (-472.716) -- 0:00:05
Average standard deviation of split frequencies: 0.007956
900500 -- (-479.518) (-476.549) (-476.854) [-474.855] * (-473.595) (-474.070) [-474.792] (-472.731) -- 0:00:05
901000 -- (-477.360) (-474.619) (-476.657) [-473.818] * [-473.542] (-474.011) (-473.809) (-473.590) -- 0:00:05
901500 -- (-476.636) (-473.885) (-473.868) [-473.698] * (-476.034) [-475.576] (-475.922) (-476.925) -- 0:00:05
902000 -- [-473.550] (-473.173) (-474.320) (-472.535) * (-474.316) (-474.681) [-476.910] (-473.521) -- 0:00:05
902500 -- [-475.716] (-473.452) (-473.805) (-474.361) * (-473.921) (-477.493) (-476.630) [-472.529] -- 0:00:05
903000 -- (-474.562) [-477.808] (-474.395) (-474.975) * (-473.506) (-476.978) [-476.376] (-473.506) -- 0:00:05
903500 -- (-473.723) (-472.811) (-474.819) [-474.585] * [-473.072] (-472.847) (-475.473) (-474.454) -- 0:00:05
904000 -- [-474.750] (-472.318) (-473.301) (-475.873) * (-476.624) [-473.567] (-474.196) (-474.395) -- 0:00:05
904500 -- (-473.443) (-474.164) (-474.698) [-475.113] * (-475.320) [-472.894] (-476.983) (-473.905) -- 0:00:05
905000 -- (-474.235) [-474.738] (-477.662) (-474.147) * (-473.773) (-474.312) (-476.058) [-475.558] -- 0:00:05
Average standard deviation of split frequencies: 0.007874
905500 -- (-475.673) (-473.814) (-483.380) [-477.666] * (-475.022) (-478.207) [-475.715] (-473.492) -- 0:00:05
906000 -- (-475.017) (-472.499) [-472.623] (-481.005) * [-474.464] (-472.698) (-481.979) (-473.625) -- 0:00:05
906500 -- (-473.500) [-472.496] (-472.623) (-474.887) * (-479.302) (-473.120) (-473.694) [-474.312] -- 0:00:05
907000 -- (-473.519) (-474.694) (-475.375) [-474.561] * [-473.241] (-474.726) (-475.181) (-472.848) -- 0:00:05
907500 -- [-473.352] (-474.504) (-475.699) (-473.298) * [-474.819] (-479.331) (-483.327) (-473.418) -- 0:00:05
908000 -- (-474.338) [-474.348] (-478.209) (-482.284) * (-474.826) [-476.382] (-475.030) (-472.372) -- 0:00:05
908500 -- [-473.849] (-479.103) (-476.984) (-480.548) * (-472.547) (-476.360) (-473.983) [-472.841] -- 0:00:05
909000 -- (-475.102) (-474.268) [-475.530] (-477.768) * [-472.589] (-481.714) (-478.895) (-473.232) -- 0:00:05
909500 -- (-474.426) [-474.408] (-472.847) (-475.027) * [-473.579] (-477.177) (-474.686) (-473.778) -- 0:00:05
910000 -- [-473.711] (-474.467) (-479.748) (-474.865) * (-473.689) [-474.824] (-473.195) (-473.116) -- 0:00:05
Average standard deviation of split frequencies: 0.008317
910500 -- (-473.058) (-472.591) (-472.445) [-472.886] * [-474.378] (-478.993) (-475.923) (-473.003) -- 0:00:05
911000 -- (-473.743) (-472.439) [-473.169] (-475.176) * (-479.625) (-474.953) [-472.985] (-475.082) -- 0:00:05
911500 -- [-475.061] (-474.869) (-472.109) (-474.855) * (-476.809) (-474.438) (-473.202) [-478.704] -- 0:00:05
912000 -- (-480.725) [-474.514] (-472.223) (-474.960) * (-474.318) (-474.948) [-475.075] (-472.868) -- 0:00:05
912500 -- (-475.814) (-473.990) [-472.223] (-477.518) * (-472.513) (-473.436) (-475.830) [-473.808] -- 0:00:05
913000 -- (-474.479) (-473.060) [-472.883] (-473.239) * (-475.518) (-474.746) (-473.179) [-477.246] -- 0:00:05
913500 -- (-473.303) (-473.085) [-473.670] (-473.752) * (-473.700) (-477.703) (-474.030) [-473.693] -- 0:00:05
914000 -- (-476.429) (-476.317) (-476.397) [-476.919] * (-476.745) (-475.478) (-474.404) [-476.542] -- 0:00:05
914500 -- (-473.808) (-486.036) (-477.619) [-474.107] * (-475.712) [-476.297] (-474.880) (-475.387) -- 0:00:05
915000 -- (-475.951) (-480.219) [-474.515] (-473.812) * (-474.561) (-473.911) [-475.219] (-474.485) -- 0:00:05
Average standard deviation of split frequencies: 0.008440
915500 -- [-473.544] (-475.456) (-473.043) (-474.664) * (-474.051) [-474.433] (-475.410) (-475.105) -- 0:00:04
916000 -- [-473.284] (-476.390) (-472.839) (-473.334) * [-477.931] (-474.010) (-475.460) (-475.251) -- 0:00:04
916500 -- (-479.485) (-479.471) (-472.977) [-472.990] * (-473.038) (-473.821) [-473.527] (-476.353) -- 0:00:04
917000 -- (-474.357) (-473.067) (-473.638) [-475.803] * (-474.190) (-473.391) [-474.508] (-474.414) -- 0:00:04
917500 -- (-472.481) (-477.044) [-475.446] (-474.307) * (-473.214) [-475.439] (-473.534) (-476.872) -- 0:00:04
918000 -- [-472.531] (-480.347) (-473.427) (-473.636) * (-472.977) [-474.334] (-473.169) (-477.668) -- 0:00:04
918500 -- (-472.779) (-474.133) (-474.930) [-474.064] * (-473.865) [-473.446] (-476.207) (-475.498) -- 0:00:04
919000 -- (-474.274) [-473.444] (-474.230) (-474.225) * (-475.260) (-473.958) (-474.669) [-474.204] -- 0:00:04
919500 -- (-476.343) [-473.606] (-475.049) (-476.478) * (-474.673) (-474.182) [-473.423] (-474.902) -- 0:00:04
920000 -- (-478.471) (-473.787) [-473.452] (-479.612) * (-474.540) (-474.995) [-473.700] (-474.118) -- 0:00:04
Average standard deviation of split frequencies: 0.007919
920500 -- [-475.765] (-475.024) (-474.492) (-474.136) * (-475.280) [-473.751] (-475.169) (-472.798) -- 0:00:04
921000 -- (-473.605) [-473.593] (-474.773) (-474.528) * (-475.508) (-476.976) (-474.994) [-475.200] -- 0:00:04
921500 -- [-473.302] (-477.343) (-474.700) (-474.273) * (-474.570) [-477.148] (-478.686) (-474.036) -- 0:00:04
922000 -- (-475.342) (-478.023) (-473.675) [-475.103] * [-476.379] (-472.524) (-473.727) (-473.748) -- 0:00:04
922500 -- (-472.735) (-476.397) [-476.337] (-473.653) * (-476.037) (-473.432) (-476.974) [-475.242] -- 0:00:04
923000 -- [-477.293] (-475.827) (-473.022) (-472.838) * (-476.302) (-480.660) [-473.400] (-475.293) -- 0:00:04
923500 -- (-473.675) [-474.399] (-472.508) (-473.444) * (-475.091) (-479.615) [-473.008] (-473.251) -- 0:00:04
924000 -- (-473.218) [-473.412] (-474.711) (-474.026) * [-472.581] (-478.741) (-474.979) (-472.146) -- 0:00:04
924500 -- [-475.003] (-475.582) (-475.223) (-474.197) * (-472.971) (-476.022) (-474.913) [-472.815] -- 0:00:04
925000 -- [-477.442] (-477.877) (-475.156) (-477.538) * (-473.217) [-475.327] (-472.742) (-479.135) -- 0:00:04
Average standard deviation of split frequencies: 0.007636
925500 -- (-474.589) (-475.818) (-473.075) [-475.465] * [-475.734] (-478.678) (-473.196) (-475.990) -- 0:00:04
926000 -- [-473.706] (-476.741) (-474.873) (-474.798) * (-473.238) (-479.306) [-473.964] (-474.763) -- 0:00:04
926500 -- (-472.304) (-473.799) [-473.870] (-473.093) * (-472.405) [-473.588] (-473.801) (-473.628) -- 0:00:04
927000 -- (-475.337) (-473.879) [-474.834] (-475.300) * (-473.399) (-482.904) [-473.697] (-481.637) -- 0:00:04
927500 -- (-476.487) [-475.030] (-472.441) (-473.046) * (-473.573) [-473.904] (-476.137) (-480.788) -- 0:00:04
928000 -- (-476.474) (-476.726) [-472.719] (-474.639) * [-474.253] (-474.907) (-473.855) (-475.266) -- 0:00:04
928500 -- [-473.684] (-472.824) (-474.867) (-475.404) * (-476.319) (-473.598) (-473.670) [-472.513] -- 0:00:04
929000 -- (-474.931) [-473.376] (-473.923) (-474.221) * (-475.225) (-476.170) (-473.076) [-472.969] -- 0:00:04
929500 -- (-473.308) [-473.396] (-477.895) (-473.802) * [-474.429] (-473.972) (-476.019) (-472.595) -- 0:00:04
930000 -- (-475.456) (-474.344) (-474.830) [-474.488] * (-474.476) (-474.476) (-475.413) [-473.740] -- 0:00:04
Average standard deviation of split frequencies: 0.008003
930500 -- (-478.673) (-474.001) [-474.584] (-479.851) * [-477.261] (-474.185) (-474.735) (-477.517) -- 0:00:04
931000 -- (-474.983) (-479.179) (-474.442) [-477.666] * (-474.248) (-474.622) (-473.473) [-474.023] -- 0:00:04
931500 -- (-473.499) (-474.138) [-473.763] (-476.006) * (-478.343) [-474.707] (-476.640) (-475.244) -- 0:00:04
932000 -- (-477.413) (-474.696) (-474.901) [-479.871] * (-476.560) [-477.355] (-473.464) (-475.924) -- 0:00:04
932500 -- (-474.078) [-474.353] (-473.671) (-474.333) * (-478.974) (-475.313) [-475.446] (-476.051) -- 0:00:03
933000 -- (-475.668) (-472.677) [-474.947] (-478.041) * (-477.724) (-473.604) [-477.801] (-478.088) -- 0:00:03
933500 -- (-474.152) (-475.475) (-476.213) [-476.136] * (-474.930) (-475.353) [-478.505] (-475.186) -- 0:00:03
934000 -- (-476.497) [-478.255] (-475.209) (-476.667) * (-475.163) (-476.969) [-476.305] (-473.577) -- 0:00:03
934500 -- (-475.720) [-474.284] (-475.253) (-477.518) * [-473.725] (-472.114) (-476.033) (-473.297) -- 0:00:03
935000 -- (-472.836) (-476.887) (-476.972) [-474.699] * (-473.359) [-472.153] (-473.791) (-473.443) -- 0:00:03
Average standard deviation of split frequencies: 0.007756
935500 -- (-473.370) (-473.772) (-475.260) [-473.666] * (-473.138) (-473.052) (-476.744) [-472.649] -- 0:00:03
936000 -- [-473.229] (-475.582) (-473.886) (-473.308) * (-475.779) (-473.848) (-477.130) [-475.525] -- 0:00:03
936500 -- (-473.831) (-473.994) [-473.209] (-478.349) * (-473.467) [-473.129] (-475.880) (-473.392) -- 0:00:03
937000 -- (-477.649) (-475.016) (-475.511) [-477.657] * (-474.178) (-473.078) [-473.253] (-473.700) -- 0:00:03
937500 -- (-477.570) (-476.147) [-474.004] (-476.329) * (-474.822) [-472.487] (-475.065) (-477.174) -- 0:00:03
938000 -- [-476.153] (-477.644) (-477.223) (-477.801) * (-479.181) (-475.031) [-473.900] (-476.229) -- 0:00:03
938500 -- (-474.253) [-480.163] (-473.649) (-473.504) * (-477.020) (-474.457) [-473.389] (-472.571) -- 0:00:03
939000 -- (-475.474) (-474.054) [-473.221] (-472.725) * [-473.834] (-476.089) (-475.935) (-473.070) -- 0:00:03
939500 -- (-474.009) (-474.487) (-472.524) [-472.963] * (-475.303) (-477.041) (-473.231) [-475.674] -- 0:00:03
940000 -- (-473.384) (-476.409) (-475.867) [-473.575] * (-474.715) (-478.165) [-475.549] (-473.143) -- 0:00:03
Average standard deviation of split frequencies: 0.007517
940500 -- (-472.872) (-478.113) (-475.800) [-479.561] * [-475.250] (-473.155) (-474.723) (-473.053) -- 0:00:03
941000 -- [-477.110] (-473.933) (-474.300) (-473.843) * [-474.472] (-479.271) (-473.609) (-477.332) -- 0:00:03
941500 -- (-474.950) (-475.439) [-473.146] (-475.759) * (-476.990) (-478.100) (-473.201) [-474.183] -- 0:00:03
942000 -- [-474.462] (-473.927) (-473.258) (-475.125) * [-475.576] (-474.808) (-475.198) (-477.784) -- 0:00:03
942500 -- [-472.169] (-479.238) (-472.838) (-475.022) * (-477.444) [-475.512] (-477.222) (-472.735) -- 0:00:03
943000 -- (-479.022) (-473.703) (-477.406) [-477.272] * (-478.690) (-477.141) (-477.036) [-473.642] -- 0:00:03
943500 -- (-474.010) (-478.590) [-474.016] (-475.521) * (-479.472) (-473.402) [-481.693] (-475.103) -- 0:00:03
944000 -- [-476.857] (-475.656) (-473.976) (-479.493) * (-476.517) [-477.186] (-475.461) (-479.144) -- 0:00:03
944500 -- (-473.380) (-478.959) [-472.809] (-473.597) * (-473.565) (-476.807) (-474.013) [-474.132] -- 0:00:03
945000 -- [-473.660] (-474.399) (-474.272) (-473.315) * (-473.788) (-478.330) (-472.654) [-473.747] -- 0:00:03
Average standard deviation of split frequencies: 0.007674
945500 -- [-472.109] (-473.061) (-473.004) (-473.308) * [-473.952] (-476.623) (-474.827) (-475.233) -- 0:00:03
946000 -- (-474.477) (-474.522) (-473.422) [-472.551] * (-476.404) (-477.139) (-478.738) [-472.995] -- 0:00:03
946500 -- (-474.536) (-474.366) (-477.035) [-476.438] * (-472.470) (-473.399) (-479.692) [-475.161] -- 0:00:03
947000 -- (-473.629) [-474.662] (-477.531) (-476.597) * (-473.359) (-475.209) (-478.966) [-474.794] -- 0:00:03
947500 -- [-474.113] (-472.331) (-477.540) (-474.915) * (-474.101) [-473.691] (-476.712) (-476.653) -- 0:00:03
948000 -- (-474.258) (-472.701) (-474.550) [-478.594] * [-472.770] (-478.431) (-474.581) (-474.911) -- 0:00:03
948500 -- (-474.811) (-475.251) (-473.136) [-477.436] * [-477.237] (-472.967) (-474.459) (-475.927) -- 0:00:03
949000 -- (-474.163) (-474.166) [-477.563] (-475.697) * (-474.458) [-474.446] (-473.912) (-474.574) -- 0:00:03
949500 -- (-477.917) (-475.117) (-475.667) [-473.048] * (-473.232) (-474.552) (-476.157) [-474.708] -- 0:00:02
950000 -- [-474.692] (-475.247) (-473.848) (-475.490) * (-473.816) (-475.504) [-473.172] (-475.612) -- 0:00:02
Average standard deviation of split frequencies: 0.007769
950500 -- (-475.640) (-474.259) (-475.367) [-478.202] * (-472.812) [-473.425] (-476.774) (-473.646) -- 0:00:02
951000 -- (-473.050) (-481.380) [-472.298] (-480.688) * (-474.021) (-474.183) [-474.297] (-473.009) -- 0:00:02
951500 -- [-474.160] (-474.074) (-474.212) (-475.817) * (-472.568) (-479.341) [-473.724] (-473.016) -- 0:00:02
952000 -- [-472.348] (-475.997) (-475.556) (-475.791) * (-472.653) [-473.158] (-474.450) (-472.836) -- 0:00:02
952500 -- (-472.446) (-474.556) [-475.225] (-474.120) * (-473.365) [-474.003] (-475.173) (-472.796) -- 0:00:02
953000 -- (-472.270) [-474.435] (-473.782) (-476.760) * (-474.573) [-472.585] (-475.416) (-474.124) -- 0:00:02
953500 -- (-472.649) [-478.238] (-472.934) (-472.724) * [-475.408] (-472.865) (-476.997) (-477.117) -- 0:00:02
954000 -- (-474.995) (-481.969) [-474.189] (-472.847) * (-474.965) [-474.542] (-483.612) (-472.837) -- 0:00:02
954500 -- [-473.774] (-477.079) (-474.180) (-474.266) * (-479.329) (-474.330) (-475.051) [-474.583] -- 0:00:02
955000 -- (-473.248) (-477.289) (-472.990) [-472.860] * (-475.735) (-474.670) (-473.370) [-473.560] -- 0:00:02
Average standard deviation of split frequencies: 0.007561
955500 -- [-472.709] (-473.738) (-475.183) (-472.938) * (-475.064) (-473.614) (-472.548) [-472.462] -- 0:00:02
956000 -- (-472.492) (-472.478) [-474.357] (-474.667) * (-473.511) (-475.549) (-476.568) [-472.456] -- 0:00:02
956500 -- (-474.218) [-474.194] (-477.186) (-473.814) * (-474.612) [-476.658] (-477.553) (-474.244) -- 0:00:02
957000 -- (-473.084) [-473.598] (-473.710) (-474.465) * (-473.770) [-472.857] (-476.096) (-475.664) -- 0:00:02
957500 -- (-473.383) (-479.138) (-476.740) [-473.248] * (-473.423) (-473.953) [-474.968] (-478.505) -- 0:00:02
958000 -- [-475.285] (-473.890) (-473.438) (-474.131) * (-473.673) (-474.515) [-472.607] (-472.129) -- 0:00:02
958500 -- (-472.658) (-476.528) [-473.054] (-474.356) * [-476.285] (-476.278) (-473.408) (-473.713) -- 0:00:02
959000 -- [-476.714] (-477.886) (-475.144) (-473.680) * (-474.861) [-472.700] (-475.942) (-472.778) -- 0:00:02
959500 -- (-474.625) (-476.406) (-477.106) [-473.579] * (-473.870) (-472.372) (-474.058) [-473.742] -- 0:00:02
960000 -- (-479.614) (-475.852) (-475.058) [-474.833] * (-475.803) (-478.112) [-475.139] (-473.409) -- 0:00:02
Average standard deviation of split frequencies: 0.007622
960500 -- (-474.671) [-473.129] (-474.782) (-484.533) * (-474.333) (-476.161) [-474.106] (-472.818) -- 0:00:02
961000 -- [-474.569] (-473.577) (-476.268) (-479.129) * (-474.550) [-479.389] (-476.411) (-473.271) -- 0:00:02
961500 -- (-472.717) (-474.279) (-475.838) [-473.770] * [-473.181] (-474.163) (-478.342) (-474.746) -- 0:00:02
962000 -- (-473.387) (-476.353) [-475.281] (-474.020) * (-473.601) (-478.675) (-474.222) [-474.738] -- 0:00:02
962500 -- (-473.912) [-472.706] (-472.869) (-475.399) * [-473.663] (-472.741) (-477.827) (-478.955) -- 0:00:02
963000 -- [-472.312] (-473.763) (-475.174) (-474.477) * (-475.131) (-473.074) [-473.872] (-474.635) -- 0:00:02
963500 -- (-474.103) [-473.825] (-474.212) (-473.812) * (-478.422) [-474.621] (-474.528) (-472.983) -- 0:00:02
964000 -- (-474.766) [-474.727] (-476.950) (-473.312) * (-477.924) (-474.046) [-477.889] (-472.567) -- 0:00:02
964500 -- (-474.027) [-473.981] (-478.081) (-475.642) * (-476.542) (-475.750) [-473.115] (-476.145) -- 0:00:02
965000 -- (-476.380) [-476.485] (-473.363) (-477.156) * (-478.463) [-474.127] (-472.680) (-473.196) -- 0:00:02
Average standard deviation of split frequencies: 0.007808
965500 -- [-473.692] (-474.161) (-476.441) (-473.728) * (-477.629) (-476.992) (-473.660) [-473.866] -- 0:00:02
966000 -- (-476.682) (-474.336) [-474.511] (-473.008) * (-476.318) (-476.645) [-473.862] (-477.499) -- 0:00:02
966500 -- [-475.002] (-473.725) (-481.645) (-474.068) * [-475.220] (-472.349) (-474.248) (-475.490) -- 0:00:01
967000 -- (-472.153) (-477.637) (-473.817) [-475.586] * (-475.177) [-474.238] (-473.532) (-476.235) -- 0:00:01
967500 -- [-472.164] (-473.523) (-474.076) (-474.911) * (-473.970) [-474.465] (-473.077) (-476.311) -- 0:00:01
968000 -- (-474.726) (-474.080) [-473.058] (-476.536) * (-473.103) (-473.460) [-472.804] (-475.691) -- 0:00:01
968500 -- (-474.956) (-476.519) [-473.810] (-474.776) * [-473.625] (-473.402) (-473.162) (-473.950) -- 0:00:01
969000 -- (-473.859) (-474.932) (-475.345) [-474.432] * [-472.609] (-473.029) (-473.354) (-474.319) -- 0:00:01
969500 -- (-475.151) (-474.626) (-473.121) [-473.722] * (-472.743) [-472.856] (-476.137) (-472.509) -- 0:00:01
970000 -- (-474.723) (-473.262) (-474.496) [-474.949] * [-472.753] (-477.737) (-477.264) (-473.913) -- 0:00:01
Average standard deviation of split frequencies: 0.008062
970500 -- [-474.610] (-475.085) (-473.016) (-477.285) * (-474.428) (-476.013) (-475.029) [-474.631] -- 0:00:01
971000 -- (-473.033) (-475.518) (-472.487) [-475.566] * (-473.600) (-476.195) [-474.761] (-474.531) -- 0:00:01
971500 -- (-473.176) [-476.768] (-475.610) (-477.281) * (-473.345) [-477.122] (-475.325) (-474.420) -- 0:00:01
972000 -- (-477.344) (-473.500) [-474.166] (-476.130) * (-473.001) (-476.928) (-475.577) [-474.921] -- 0:00:01
972500 -- (-477.237) [-473.582] (-475.470) (-472.919) * (-472.690) (-474.415) (-480.409) [-473.297] -- 0:00:01
973000 -- (-476.209) (-476.139) (-476.397) [-472.911] * [-472.668] (-473.824) (-474.314) (-474.698) -- 0:00:01
973500 -- (-473.787) [-475.414] (-479.871) (-473.085) * [-473.350] (-474.556) (-478.276) (-478.585) -- 0:00:01
974000 -- (-476.122) [-472.928] (-475.791) (-473.443) * (-472.871) [-474.483] (-475.839) (-476.524) -- 0:00:01
974500 -- (-477.318) (-472.897) [-476.030] (-473.219) * (-473.714) [-473.885] (-472.582) (-476.720) -- 0:00:01
975000 -- (-476.042) (-472.971) [-473.168] (-477.676) * (-477.227) (-473.393) [-474.449] (-475.247) -- 0:00:01
Average standard deviation of split frequencies: 0.007760
975500 -- (-474.925) [-473.677] (-475.170) (-473.701) * [-474.534] (-472.859) (-477.781) (-475.904) -- 0:00:01
976000 -- [-475.831] (-480.005) (-473.552) (-475.459) * (-473.719) (-473.574) [-474.253] (-480.606) -- 0:00:01
976500 -- [-475.992] (-472.925) (-476.836) (-477.362) * [-474.961] (-473.213) (-474.064) (-473.924) -- 0:00:01
977000 -- [-476.779] (-473.420) (-474.297) (-476.089) * (-481.999) [-472.843] (-473.581) (-472.953) -- 0:00:01
977500 -- (-473.053) [-475.398] (-474.334) (-476.496) * [-477.060] (-472.678) (-475.535) (-474.425) -- 0:00:01
978000 -- (-473.006) (-473.779) [-474.169] (-477.628) * (-473.777) (-474.490) [-475.205] (-473.733) -- 0:00:01
978500 -- [-474.540] (-476.022) (-476.137) (-475.670) * [-474.132] (-475.466) (-472.790) (-474.045) -- 0:00:01
979000 -- [-475.125] (-473.361) (-474.875) (-472.782) * (-472.328) (-476.748) [-473.259] (-475.489) -- 0:00:01
979500 -- (-472.074) [-473.407] (-475.772) (-474.750) * (-475.218) (-479.112) (-478.002) [-474.232] -- 0:00:01
980000 -- (-473.908) (-475.489) (-477.241) [-473.308] * [-475.386] (-474.517) (-476.349) (-476.799) -- 0:00:01
Average standard deviation of split frequencies: 0.008236
980500 -- [-474.014] (-475.810) (-476.172) (-475.032) * (-474.117) (-473.163) (-474.864) [-475.416] -- 0:00:01
981000 -- (-473.008) [-476.078] (-474.422) (-473.442) * [-473.095] (-473.988) (-480.030) (-475.332) -- 0:00:01
981500 -- [-474.242] (-475.434) (-473.183) (-476.084) * (-474.938) [-473.940] (-473.902) (-474.237) -- 0:00:01
982000 -- (-474.233) [-476.722] (-480.015) (-478.683) * (-475.842) [-476.784] (-473.694) (-473.604) -- 0:00:01
982500 -- (-474.062) [-478.424] (-476.254) (-479.066) * (-477.338) [-474.200] (-476.481) (-473.098) -- 0:00:01
983000 -- (-475.073) [-477.366] (-474.857) (-476.158) * (-475.486) [-473.621] (-472.641) (-475.088) -- 0:00:01
983500 -- (-474.509) (-475.444) [-473.217] (-477.417) * (-476.511) [-478.783] (-472.737) (-473.616) -- 0:00:00
984000 -- (-478.293) [-473.246] (-473.070) (-474.426) * [-474.862] (-474.804) (-474.244) (-475.204) -- 0:00:00
984500 -- (-474.638) [-475.132] (-475.174) (-478.684) * (-476.776) (-476.577) [-473.580] (-473.497) -- 0:00:00
985000 -- [-474.472] (-476.995) (-472.537) (-473.700) * (-475.091) (-476.742) [-476.292] (-477.192) -- 0:00:00
Average standard deviation of split frequencies: 0.008191
985500 -- (-480.831) [-473.979] (-474.156) (-475.644) * [-473.701] (-476.148) (-473.843) (-474.201) -- 0:00:00
986000 -- (-472.386) [-477.661] (-472.683) (-479.889) * [-476.546] (-477.055) (-475.453) (-473.036) -- 0:00:00
986500 -- (-474.179) (-476.678) (-474.195) [-474.125] * (-474.907) (-476.452) [-475.532] (-472.770) -- 0:00:00
987000 -- (-472.646) (-473.621) (-478.366) [-474.139] * (-473.910) (-475.322) [-473.545] (-473.293) -- 0:00:00
987500 -- (-475.871) [-473.366] (-475.392) (-472.954) * (-475.897) (-474.551) [-476.193] (-474.891) -- 0:00:00
988000 -- (-475.187) (-474.670) [-473.061] (-472.630) * [-473.134] (-473.215) (-474.181) (-475.873) -- 0:00:00
988500 -- [-474.890] (-475.635) (-474.752) (-478.496) * (-474.949) (-480.678) [-473.255] (-473.624) -- 0:00:00
989000 -- (-472.928) (-474.802) (-479.112) [-477.083] * (-474.925) (-478.657) [-474.657] (-473.250) -- 0:00:00
989500 -- [-475.052] (-474.875) (-474.508) (-473.398) * [-474.805] (-475.371) (-472.926) (-477.906) -- 0:00:00
990000 -- [-472.820] (-473.679) (-475.416) (-476.327) * [-472.696] (-476.028) (-474.686) (-473.851) -- 0:00:00
Average standard deviation of split frequencies: 0.008185
990500 -- (-475.105) (-474.794) [-473.779] (-475.085) * (-473.013) [-473.604] (-474.926) (-475.333) -- 0:00:00
991000 -- (-475.385) (-475.396) [-473.654] (-476.315) * (-473.584) [-473.714] (-473.683) (-474.316) -- 0:00:00
991500 -- [-473.343] (-476.803) (-477.861) (-477.085) * (-475.791) [-474.997] (-476.144) (-473.811) -- 0:00:00
992000 -- (-479.015) [-475.120] (-474.695) (-474.890) * (-472.877) [-473.194] (-474.687) (-478.264) -- 0:00:00
992500 -- (-475.487) (-477.761) [-475.426] (-473.160) * (-474.513) [-473.045] (-473.944) (-473.645) -- 0:00:00
993000 -- (-477.769) (-478.864) (-475.584) [-474.072] * (-473.273) (-472.800) (-473.513) [-473.869] -- 0:00:00
993500 -- (-475.289) (-475.478) (-473.283) [-474.018] * (-473.643) (-474.849) (-473.621) [-473.503] -- 0:00:00
994000 -- (-474.620) (-474.298) (-476.324) [-472.889] * (-472.903) [-475.195] (-479.634) (-473.751) -- 0:00:00
994500 -- [-473.031] (-473.512) (-475.339) (-474.601) * (-473.726) (-475.093) [-475.189] (-474.360) -- 0:00:00
995000 -- (-477.615) [-473.504] (-474.977) (-474.230) * (-475.068) (-474.697) (-474.255) [-475.014] -- 0:00:00
Average standard deviation of split frequencies: 0.008235
995500 -- [-474.665] (-474.482) (-473.658) (-475.126) * (-473.231) (-473.515) [-474.223] (-474.290) -- 0:00:00
996000 -- [-479.178] (-477.689) (-473.531) (-476.775) * (-473.413) [-474.845] (-473.424) (-476.916) -- 0:00:00
996500 -- (-476.434) (-474.109) (-476.366) [-473.932] * (-474.601) [-475.014] (-473.015) (-474.805) -- 0:00:00
997000 -- (-474.609) (-475.195) (-474.135) [-473.843] * (-475.022) (-477.605) [-474.514] (-475.067) -- 0:00:00
997500 -- [-472.812] (-475.890) (-475.073) (-474.160) * (-477.314) (-474.250) (-473.849) [-475.287] -- 0:00:00
998000 -- [-473.800] (-475.036) (-473.695) (-473.438) * [-475.990] (-473.137) (-475.622) (-474.457) -- 0:00:00
998500 -- (-475.003) (-474.722) [-474.909] (-473.985) * (-481.160) [-472.516] (-482.568) (-478.703) -- 0:00:00
999000 -- [-474.580] (-476.246) (-473.948) (-472.953) * [-477.055] (-474.500) (-475.157) (-475.838) -- 0:00:00
999500 -- (-480.589) (-475.899) [-474.469] (-474.426) * [-475.944] (-476.615) (-473.335) (-473.942) -- 0:00:00
1000000 -- [-473.295] (-475.560) (-475.821) (-478.488) * (-474.084) (-479.748) [-473.641] (-474.112) -- 0:00:00
Average standard deviation of split frequencies: 0.008134
Analysis completed in 59 seconds
Analysis used 58.23 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -472.02
Likelihood of best state for "cold" chain of run 2 was -472.02
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.8 % ( 27 %) Dirichlet(Pi{all})
36.8 % ( 31 %) Slider(Pi{all})
79.3 % ( 55 %) Multiplier(Alpha{1,2})
78.4 % ( 56 %) Multiplier(Alpha{3})
26.1 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 16 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 75 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
36.4 % ( 29 %) Dirichlet(Pi{all})
37.1 % ( 25 %) Slider(Pi{all})
79.2 % ( 59 %) Multiplier(Alpha{1,2})
77.7 % ( 51 %) Multiplier(Alpha{3})
25.9 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
31.0 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166272 0.83 0.67
3 | 166085 166366 0.84
4 | 167533 167620 166124
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167351 0.82 0.67
3 | 167484 166138 0.84
4 | 166264 165802 166961
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -473.81
| 2 |
| 1 2 1 2 |
| 11 12 2 1 2 1 2 2 |
|11 1 12 1 1 2 2 1 1 2 |
| 2 2 1 1 1 1 1|
| 1 2 22 1 1 1 * 1 1 11 1 1 2|
| 1 22 112 1 2 1 2 2 2 *1 2 |
|2 1 2 2 2 122 2 2122 22 2 |
| 2 1 2 1 121 2 22 1 2 |
| 2 12 1 1 1 1 2 1 2 2 |
| 2 1 1 2 2 1 1 |
| 2 |
| 1 2 2 1 |
| 2 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -475.42
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -473.76 -478.17
2 -473.76 -476.65
--------------------------------------
TOTAL -473.76 -477.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894479 0.086450 0.360527 1.479809 0.863748 1333.35 1417.18 1.000
r(A<->C){all} 0.174471 0.020861 0.000076 0.456536 0.136866 216.66 254.69 1.001
r(A<->G){all} 0.166253 0.019610 0.000370 0.449344 0.129846 202.95 311.46 1.001
r(A<->T){all} 0.173759 0.019991 0.000035 0.447257 0.142760 208.38 331.07 1.000
r(C<->G){all} 0.160721 0.019228 0.000038 0.435920 0.124018 205.43 209.94 1.004
r(C<->T){all} 0.165997 0.019000 0.000006 0.446956 0.131803 153.13 188.60 1.000
r(G<->T){all} 0.158799 0.017882 0.000029 0.426625 0.126487 316.67 320.39 1.002
pi(A){all} 0.208972 0.000450 0.167617 0.249308 0.208984 1235.09 1299.92 1.000
pi(C){all} 0.304392 0.000613 0.256720 0.353295 0.304088 1161.74 1193.01 1.000
pi(G){all} 0.289402 0.000590 0.240927 0.333854 0.289060 1246.35 1373.68 1.000
pi(T){all} 0.197233 0.000462 0.153252 0.236785 0.197080 1268.99 1297.95 1.001
alpha{1,2} 0.412959 0.233241 0.000166 1.368643 0.238711 1110.23 1126.94 1.000
alpha{3} 0.444289 0.248938 0.000174 1.439089 0.271827 1254.40 1377.70 1.001
pinvar{all} 0.995270 0.000035 0.984840 0.999999 0.996989 1175.89 1243.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ..**..
9 -- ..****
10 -- ..*..*
11 -- .**.**
12 -- .***.*
13 -- ..*.*.
14 -- .*..*.
15 -- .*.*..
16 -- .*...*
17 -- .****.
18 -- ...*.*
19 -- .**...
20 -- .*.***
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.007537 0.147235 0.157895 2
8 448 0.149234 0.002827 0.147235 0.151233 2
9 446 0.148568 0.002827 0.146569 0.150566 2
10 445 0.148235 0.004240 0.145237 0.151233 2
11 443 0.147568 0.032505 0.124584 0.170553 2
12 440 0.146569 0.003769 0.143904 0.149234 2
13 436 0.145237 0.001884 0.143904 0.146569 2
14 436 0.145237 0.000942 0.144570 0.145903 2
15 436 0.145237 0.010364 0.137908 0.152565 2
16 423 0.140906 0.018373 0.127915 0.153897 2
17 419 0.139574 0.018373 0.126582 0.152565 2
18 416 0.138574 0.003769 0.135909 0.141239 2
19 411 0.136909 0.005182 0.133245 0.140573 2
20 409 0.136243 0.001413 0.135243 0.137242 2
21 409 0.136243 0.008009 0.130580 0.141905 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101699 0.010790 0.000062 0.312902 0.069876 1.000 2
length{all}[2] 0.098961 0.010037 0.000009 0.299939 0.068900 1.000 2
length{all}[3] 0.099132 0.009939 0.000018 0.305127 0.067351 1.000 2
length{all}[4] 0.097897 0.009935 0.000128 0.307936 0.064636 1.000 2
length{all}[5] 0.097442 0.009740 0.000025 0.288702 0.067408 1.000 2
length{all}[6] 0.102179 0.010489 0.000071 0.304426 0.071706 1.000 2
length{all}[7] 0.096406 0.009260 0.000345 0.289034 0.064608 0.998 2
length{all}[8] 0.095751 0.008290 0.000266 0.278166 0.064312 0.998 2
length{all}[9] 0.100866 0.009231 0.000067 0.280351 0.075210 0.998 2
length{all}[10] 0.098386 0.010893 0.000116 0.298830 0.061639 0.999 2
length{all}[11] 0.096096 0.009824 0.000023 0.308250 0.061131 1.001 2
length{all}[12] 0.101593 0.011065 0.000194 0.303901 0.072138 0.998 2
length{all}[13] 0.094347 0.009166 0.000264 0.275642 0.062022 0.998 2
length{all}[14] 0.099163 0.010197 0.000101 0.302804 0.065230 0.999 2
length{all}[15] 0.096324 0.008192 0.000237 0.272930 0.067207 0.998 2
length{all}[16] 0.110275 0.009519 0.000548 0.305333 0.080363 0.998 2
length{all}[17] 0.103840 0.009696 0.000170 0.291863 0.076574 0.998 2
length{all}[18] 0.091655 0.009091 0.000114 0.279095 0.061047 1.002 2
length{all}[19] 0.098898 0.008294 0.000009 0.277986 0.075107 0.999 2
length{all}[20] 0.098266 0.009614 0.000455 0.303923 0.067170 0.999 2
length{all}[21] 0.091382 0.007544 0.000002 0.256540 0.063992 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008134
Maximum standard deviation of split frequencies = 0.032505
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------- C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 345
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 115 / 115 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 115 / 115 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048398 0.019667 0.086660 0.051323 0.023717 0.108783 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -495.661613
Iterating by ming2
Initial: fx= 495.661613
x= 0.04840 0.01967 0.08666 0.05132 0.02372 0.10878 0.30000 1.30000
1 h-m-p 0.0000 0.0002 275.9601 +++ 482.437404 m 0.0002 14 | 1/8
2 h-m-p 0.0015 0.0488 28.2775 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 252.4939 ++ 480.158779 m 0.0000 45 | 2/8
4 h-m-p 0.0003 0.0592 23.8394 ----------.. | 2/8
5 h-m-p 0.0000 0.0002 225.5816 +++ 469.001733 m 0.0002 76 | 3/8
6 h-m-p 0.0022 0.0731 19.4623 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 195.9526 ++ 468.005603 m 0.0000 108 | 4/8
8 h-m-p 0.0003 0.0962 14.9487 ----------.. | 4/8
9 h-m-p 0.0000 0.0003 159.6144 +++ 459.941630 m 0.0003 139 | 5/8
10 h-m-p 0.0035 0.1428 10.2070 ------------.. | 5/8
11 h-m-p 0.0000 0.0002 113.3808 +++ 457.386563 m 0.0002 172 | 6/8
12 h-m-p 0.9557 8.0000 0.0000 ++ 457.386563 m 8.0000 183 | 6/8
13 h-m-p 0.4206 8.0000 0.0001 +++ 457.386563 m 8.0000 197 | 6/8
14 h-m-p 0.0160 8.0000 0.3154 +++++ 457.386553 m 8.0000 213 | 6/8
15 h-m-p 0.0502 0.2509 11.2884 --------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 457.386553 m 8.0000 252 | 6/8
17 h-m-p 0.0318 8.0000 0.0010 ---C 457.386553 0 0.0001 268 | 6/8
18 h-m-p 0.0160 8.0000 0.0004 +++++ 457.386553 m 8.0000 284 | 6/8
19 h-m-p 0.0160 8.0000 1.3118 ++++C 457.386546 0 3.4955 301 | 6/8
20 h-m-p 1.6000 8.0000 0.1140 Y 457.386546 0 2.7591 312 | 6/8
21 h-m-p 1.6000 8.0000 0.0069 Y 457.386546 0 3.4068 325 | 6/8
22 h-m-p 1.6000 8.0000 0.0023 ++ 457.386546 m 8.0000 338 | 6/8
23 h-m-p 0.0539 8.0000 0.3448 +++Y 457.386546 0 2.1803 354 | 6/8
24 h-m-p 1.6000 8.0000 0.0375 ++ 457.386546 m 8.0000 367 | 6/8
25 h-m-p 0.0160 8.0000 29.5601 +++++ 457.386508 m 8.0000 383 | 6/8
26 h-m-p 1.6000 8.0000 2.9213 ++ 457.386508 m 8.0000 394 | 6/8
27 h-m-p 1.6000 8.0000 13.6674 ++ 457.386507 m 8.0000 405 | 6/8
28 h-m-p 1.6000 8.0000 1.1954 --------C 457.386507 0 0.0000 424 | 6/8
29 h-m-p 0.0160 8.0000 0.0223 -------------.. | 6/8
30 h-m-p 0.0160 8.0000 0.0000 Y 457.386507 0 0.0160 459
Out..
lnL = -457.386507
460 lfun, 460 eigenQcodon, 2760 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032943 0.056788 0.041793 0.098630 0.106664 0.063571 374.046814 0.541489 0.569206
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.057514
np = 9
lnL0 = -501.751778
Iterating by ming2
Initial: fx= 501.751778
x= 0.03294 0.05679 0.04179 0.09863 0.10666 0.06357 374.04681 0.54149 0.56921
1 h-m-p 0.0000 0.0003 266.0036 +++ 480.389469 m 0.0003 15 | 1/9
2 h-m-p 0.0004 0.0022 59.4596 ++ 474.571937 m 0.0022 27 | 2/9
3 h-m-p 0.0006 0.0032 116.6768 -----------.. | 2/9
4 h-m-p 0.0000 0.0001 220.9478 ++ 468.163965 m 0.0001 60 | 3/9
5 h-m-p 0.0011 0.0202 21.8066 +++ 467.234488 m 0.0202 73 | 4/9
6 h-m-p 0.0006 0.0028 24.4674 ++ 466.010804 m 0.0028 85 | 5/9
7 h-m-p 0.0001 0.0003 71.1335 ++ 463.434384 m 0.0003 97 | 6/9
8 h-m-p 0.0029 0.1329 3.8929 ------------.. | 6/9
9 h-m-p 0.0000 0.0005 108.2345 +++ 457.386573 m 0.0005 132 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 457.386573 m 8.0000 144 | 6/9
11 h-m-p 0.0160 8.0000 0.0021 +++++ 457.386572 m 8.0000 161 | 6/9
12 h-m-p 0.0447 1.2468 0.3839 +++ 457.386550 m 1.2468 177 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ----C 457.386550 0 0.0016 196 | 7/9
14 h-m-p 1.4645 8.0000 0.0000 Y 457.386550 0 1.4645 210
Out..
lnL = -457.386550
211 lfun, 633 eigenQcodon, 2532 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026152 0.037855 0.049883 0.098877 0.061764 0.023242 374.071908 1.786394 0.216284 0.209448 56.939701
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.008922
np = 11
lnL0 = -472.231120
Iterating by ming2
Initial: fx= 472.231120
x= 0.02615 0.03786 0.04988 0.09888 0.06176 0.02324 374.07191 1.78639 0.21628 0.20945 56.93970
1 h-m-p 0.0000 0.0009 60.1978 ++++ 468.093296 m 0.0009 18 | 1/11
2 h-m-p 0.0042 0.0209 10.0841 ++ 465.680169 m 0.0209 32 | 2/11
3 h-m-p 0.0000 0.0001 2014.7145 ++ 463.660220 m 0.0001 46 | 3/11
4 h-m-p 0.0002 0.0011 352.1280 ++ 461.393886 m 0.0011 60 | 4/11
5 h-m-p 0.0013 0.0063 44.8292 ++ 459.824980 m 0.0063 74 | 5/11
6 h-m-p 0.0000 0.0000 20737.5693 ++ 459.198110 m 0.0000 88 | 6/11
7 h-m-p 0.0348 8.0000 6.9881 --------------.. | 6/11
8 h-m-p 0.0000 0.0003 75.6349 +++ 457.386521 m 0.0003 129 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 457.386521 m 8.0000 143 | 6/11
10 h-m-p 0.0160 8.0000 0.0015 +++++ 457.386521 m 8.0000 164 | 6/11
11 h-m-p 0.0434 8.0000 0.2731 ++++ 457.386520 m 8.0000 185 | 6/11
12 h-m-p 1.6000 8.0000 0.3910 ++ 457.386520 m 8.0000 204 | 6/11
13 h-m-p 1.6000 8.0000 0.0186 Y 457.386520 0 3.2111 223 | 6/11
14 h-m-p 1.6000 8.0000 0.0104 Y 457.386520 0 1.0462 242 | 6/11
15 h-m-p 1.6000 8.0000 0.0041 ++ 457.386520 m 8.0000 261 | 6/11
16 h-m-p 0.9061 8.0000 0.0362 C 457.386520 0 1.3808 280 | 6/11
17 h-m-p 1.6000 8.0000 0.0217 Y 457.386520 0 3.2975 299 | 6/11
18 h-m-p 1.6000 8.0000 0.0264 +Y 457.386520 0 5.1902 319 | 6/11
19 h-m-p 1.6000 8.0000 0.0005 ++ 457.386520 m 8.0000 338 | 6/11
20 h-m-p 0.0039 1.9090 1.0751 +++++ 457.386517 m 1.9090 360 | 7/11
21 h-m-p 0.4431 8.0000 4.1746 Y 457.386517 0 0.4431 374 | 7/11
22 h-m-p 1.2506 8.0000 1.4792 ++ 457.386516 m 8.0000 388 | 7/11
23 h-m-p 1.6000 8.0000 4.5495 ++ 457.386511 m 8.0000 402 | 7/11
24 h-m-p 1.2176 8.0000 29.8920 ++ 457.386506 m 8.0000 416 | 7/11
25 h-m-p 1.6000 8.0000 14.0652 ++ 457.386506 m 8.0000 430 | 7/11
26 h-m-p 1.6000 8.0000 20.2118 ----------------.. | 7/11
27 h-m-p 0.0160 8.0000 0.0000 -----N 457.386506 0 0.0000 477
Out..
lnL = -457.386506
478 lfun, 1912 eigenQcodon, 8604 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -457.383853 S = -457.383834 -0.000007
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:04
did 20 / 48 patterns 0:04
did 30 / 48 patterns 0:04
did 40 / 48 patterns 0:04
did 48 / 48 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026775 0.011531 0.079748 0.033304 0.066095 0.011441 379.696303 0.807337 1.160079
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.080994
np = 9
lnL0 = -482.806854
Iterating by ming2
Initial: fx= 482.806854
x= 0.02677 0.01153 0.07975 0.03330 0.06609 0.01144 379.69630 0.80734 1.16008
1 h-m-p 0.0000 0.0001 266.3937 ++ 475.400469 m 0.0001 14 | 1/9
2 h-m-p 0.0029 0.0999 8.6595 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 246.2088 ++ 475.351564 m 0.0000 48 | 2/9
4 h-m-p 0.0003 0.1364 6.5526 ----------.. | 2/9
5 h-m-p 0.0000 0.0001 219.1952 ++ 468.664805 m 0.0001 80 | 3/9
6 h-m-p 0.0054 0.1972 4.7960 ------------.. | 3/9
7 h-m-p 0.0000 0.0001 192.1126 ++ 466.485455 m 0.0001 114 | 4/9
8 h-m-p 0.0032 0.4241 2.8820 ------------.. | 4/9
9 h-m-p 0.0000 0.0003 156.6143 +++ 459.005303 m 0.0003 149 | 5/9
10 h-m-p 0.0185 0.8488 1.7932 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 113.4687 ++ 457.386582 m 0.0001 184 | 6/9
12 h-m-p 0.9473 8.0000 0.0000 ++ 457.386582 m 8.0000 196 | 6/9
13 h-m-p 0.1212 8.0000 0.0001 -----C 457.386582 0 0.0000 216
Out..
lnL = -457.386582
217 lfun, 2387 eigenQcodon, 13020 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058036 0.088697 0.031533 0.087540 0.016915 0.091814 379.696303 0.900000 0.541679 1.442052 49.883010
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.011911
np = 11
lnL0 = -472.987838
Iterating by ming2
Initial: fx= 472.987838
x= 0.05804 0.08870 0.03153 0.08754 0.01691 0.09181 379.69630 0.90000 0.54168 1.44205 49.88301
1 h-m-p 0.0000 0.0008 65.9436 ++++ 469.738492 m 0.0008 18 | 1/11
2 h-m-p 0.0000 0.0001 587.1130 ++ 467.598869 m 0.0001 32 | 2/11
3 h-m-p 0.0001 0.0007 110.2009 +CYCCC 465.228096 4 0.0006 54 | 2/11
4 h-m-p 0.0038 0.0191 7.2027 ++ 464.160620 m 0.0191 68 | 3/11
5 h-m-p 0.0001 0.0003 462.2691 ++ 461.038487 m 0.0003 82 | 4/11
6 h-m-p 0.0036 0.0181 2.1376 ++ 460.178955 m 0.0181 96 | 5/11
7 h-m-p 0.0012 0.0087 26.6151 ++ 457.386541 m 0.0087 110 | 6/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 457.386541 m 8.0000 124 | 6/11
9 h-m-p 0.0130 6.5158 0.1189 ---------C 457.386541 0 0.0000 152 | 6/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 457.386541 m 8.0000 174 | 6/11
11 h-m-p 0.0160 8.0000 0.6361 +++++ 457.386514 m 8.0000 196 | 6/11
12 h-m-p 1.6000 8.0000 0.2383 ++ 457.386513 m 8.0000 215 | 6/11
13 h-m-p 0.6197 8.0000 3.0768 ++ 457.386508 m 8.0000 234 | 6/11
14 h-m-p 1.3018 6.5092 1.8212 +
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
+ 457.386507 m 6.5092 248
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12952, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
15 h-m-p 0.0000 0.0000 17.3043
h-m-p: 1.60857341e-18 8.04286703e-18 1.73043189e+01 457.386507
..
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12952, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
C 457.386507 0 0.0010 274
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -457.386507
275 lfun, 3300 eigenQcodon, 18150 P(t)
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -457.384053 S = -457.383860 -0.000084
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:13
did 20 / 48 patterns 0:13
did 30 / 48 patterns 0:13
did 40 / 48 patterns 0:13
did 48 / 48 patterns 0:13
QuantileBeta(0.85, 44.12950, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=115
NC_011896_1_WP_010908233_1_1332_MLBR_RS06255 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
NC_002677_1_NP_301912_1_784_hisI MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
NZ_AP014567_1_WP_010908233_1_1385_hisI MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
**************************************************
NC_011896_1_WP_010908233_1_1332_MLBR_RS06255 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
NC_002677_1_NP_301912_1_784_hisI ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
NZ_AP014567_1_WP_010908233_1_1385_hisI ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
**************************************************
NC_011896_1_WP_010908233_1_1332_MLBR_RS06255 AHSCFDSAMLLAPQD
NC_002677_1_NP_301912_1_784_hisI AHSCFDSAMLLAPQD
NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025 AHSCFDSAMLLAPQD
NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770 AHSCFDSAMLLAPQD
NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875 AHSCFDSAMLLAPQD
NZ_AP014567_1_WP_010908233_1_1385_hisI AHSCFDSAMLLAPQD
***************
>NC_011896_1_WP_010908233_1_1332_MLBR_RS06255 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC >NC_002677_1_NP_301912_1_784_hisI ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC >NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC >NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC >NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC >NZ_AP014567_1_WP_010908233_1_1385_hisI ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>NC_011896_1_WP_010908233_1_1332_MLBR_RS06255 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG AHSCFDSAMLLAPQD >NC_002677_1_NP_301912_1_784_hisI MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG AHSCFDSAMLLAPQD >NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG AHSCFDSAMLLAPQD >NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG AHSCFDSAMLLAPQD >NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG AHSCFDSAMLLAPQD >NZ_AP014567_1_WP_010908233_1_1385_hisI MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG AHSCFDSAMLLAPQD
#NEXUS
[ID: 0483566634]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908233_1_1332_MLBR_RS06255
NC_002677_1_NP_301912_1_784_hisI
NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025
NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770
NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875
NZ_AP014567_1_WP_010908233_1_1385_hisI
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908233_1_1332_MLBR_RS06255,
2 NC_002677_1_NP_301912_1_784_hisI,
3 NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025,
4 NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770,
5 NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875,
6 NZ_AP014567_1_WP_010908233_1_1385_hisI
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06987585,2:0.06889985,3:0.06735144,4:0.06463631,5:0.0674078,6:0.07170645);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06987585,2:0.06889985,3:0.06735144,4:0.06463631,5:0.0674078,6:0.07170645);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -473.76 -478.17
2 -473.76 -476.65
--------------------------------------
TOTAL -473.76 -477.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894479 0.086450 0.360527 1.479809 0.863748 1333.35 1417.18 1.000
r(A<->C){all} 0.174471 0.020861 0.000076 0.456536 0.136866 216.66 254.69 1.001
r(A<->G){all} 0.166253 0.019610 0.000370 0.449344 0.129846 202.95 311.46 1.001
r(A<->T){all} 0.173759 0.019991 0.000035 0.447257 0.142760 208.38 331.07 1.000
r(C<->G){all} 0.160721 0.019228 0.000038 0.435920 0.124018 205.43 209.94 1.004
r(C<->T){all} 0.165997 0.019000 0.000006 0.446956 0.131803 153.13 188.60 1.000
r(G<->T){all} 0.158799 0.017882 0.000029 0.426625 0.126487 316.67 320.39 1.002
pi(A){all} 0.208972 0.000450 0.167617 0.249308 0.208984 1235.09 1299.92 1.000
pi(C){all} 0.304392 0.000613 0.256720 0.353295 0.304088 1161.74 1193.01 1.000
pi(G){all} 0.289402 0.000590 0.240927 0.333854 0.289060 1246.35 1373.68 1.000
pi(T){all} 0.197233 0.000462 0.153252 0.236785 0.197080 1268.99 1297.95 1.001
alpha{1,2} 0.412959 0.233241 0.000166 1.368643 0.238711 1110.23 1126.94 1.000
alpha{3} 0.444289 0.248938 0.000174 1.439089 0.271827 1254.40 1377.70 1.001
pinvar{all} 0.995270 0.000035 0.984840 0.999999 0.996989 1175.89 1243.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/hisI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 115
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 4 4 4 4 4 4 | TAC 0 0 0 0 0 0 | TGC 3 3 3 3 3 3
Leu TTA 3 3 3 3 3 3 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 5 5 5 5 5 5
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 0 0 0 0 0 0 | CAG 5 5 5 5 5 5 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 6 6 6 6 6 6 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 4 4 4 4 4 4 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 4 4 4 4 4 4 | GCC 5 5 5 5 5 5 | GAC 9 9 9 9 9 9 | GGC 3 3 3 3 3 3
GTA 2 2 2 2 2 2 | GCA 2 2 2 2 2 2 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 3 3 3 3 3 3 | GCG 1 1 1 1 1 1 | GAG 3 3 3 3 3 3 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908233_1_1332_MLBR_RS06255
position 1: T:0.17391 C:0.23478 A:0.19130 G:0.40000
position 2: T:0.25217 C:0.26087 A:0.28696 G:0.20000
position 3: T:0.16522 C:0.41739 A:0.14783 G:0.26957
Average T:0.19710 C:0.30435 A:0.20870 G:0.28986
#2: NC_002677_1_NP_301912_1_784_hisI
position 1: T:0.17391 C:0.23478 A:0.19130 G:0.40000
position 2: T:0.25217 C:0.26087 A:0.28696 G:0.20000
position 3: T:0.16522 C:0.41739 A:0.14783 G:0.26957
Average T:0.19710 C:0.30435 A:0.20870 G:0.28986
#3: NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025
position 1: T:0.17391 C:0.23478 A:0.19130 G:0.40000
position 2: T:0.25217 C:0.26087 A:0.28696 G:0.20000
position 3: T:0.16522 C:0.41739 A:0.14783 G:0.26957
Average T:0.19710 C:0.30435 A:0.20870 G:0.28986
#4: NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770
position 1: T:0.17391 C:0.23478 A:0.19130 G:0.40000
position 2: T:0.25217 C:0.26087 A:0.28696 G:0.20000
position 3: T:0.16522 C:0.41739 A:0.14783 G:0.26957
Average T:0.19710 C:0.30435 A:0.20870 G:0.28986
#5: NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875
position 1: T:0.17391 C:0.23478 A:0.19130 G:0.40000
position 2: T:0.25217 C:0.26087 A:0.28696 G:0.20000
position 3: T:0.16522 C:0.41739 A:0.14783 G:0.26957
Average T:0.19710 C:0.30435 A:0.20870 G:0.28986
#6: NZ_AP014567_1_WP_010908233_1_1385_hisI
position 1: T:0.17391 C:0.23478 A:0.19130 G:0.40000
position 2: T:0.25217 C:0.26087 A:0.28696 G:0.20000
position 3: T:0.16522 C:0.41739 A:0.14783 G:0.26957
Average T:0.19710 C:0.30435 A:0.20870 G:0.28986
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0
TTC 6 | TCC 24 | TAC 0 | TGC 18
Leu L TTA 18 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 18 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 6
CTC 12 | CCC 0 | CAC 12 | CGC 30
CTA 6 | CCA 6 | Gln Q CAA 6 | CGA 6
CTG 24 | CCG 0 | CAG 30 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 6 | ACC 36 | AAC 12 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 24 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 24 | Asp D GAT 12 | Gly G GGT 12
GTC 24 | GCC 30 | GAC 54 | GGC 18
GTA 12 | GCA 12 | Glu E GAA 12 | GGA 18
GTG 18 | GCG 6 | GAG 18 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17391 C:0.23478 A:0.19130 G:0.40000
position 2: T:0.25217 C:0.26087 A:0.28696 G:0.20000
position 3: T:0.16522 C:0.41739 A:0.14783 G:0.26957
Average T:0.19710 C:0.30435 A:0.20870 G:0.28986
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -457.386507 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 374.046814 49.883010
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908233_1_1332_MLBR_RS06255: 0.000004, NC_002677_1_NP_301912_1_784_hisI: 0.000004, NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025: 0.000004, NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770: 0.000004, NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875: 0.000004, NZ_AP014567_1_WP_010908233_1_1385_hisI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 374.04681
omega (dN/dS) = 49.88301
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 242.6 102.4 49.8830 0.0000 0.0000 0.0 0.0
7..2 0.000 242.6 102.4 49.8830 0.0000 0.0000 0.0 0.0
7..3 0.000 242.6 102.4 49.8830 0.0000 0.0000 0.0 0.0
7..4 0.000 242.6 102.4 49.8830 0.0000 0.0000 0.0 0.0
7..5 0.000 242.6 102.4 49.8830 0.0000 0.0000 0.0 0.0
7..6 0.000 242.6 102.4 49.8830 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -457.386550 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 374.071908 0.000010 0.096435
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908233_1_1332_MLBR_RS06255: 0.000004, NC_002677_1_NP_301912_1_784_hisI: 0.000004, NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025: 0.000004, NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770: 0.000004, NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875: 0.000004, NZ_AP014567_1_WP_010908233_1_1385_hisI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 374.07191
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.09643 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 242.6 102.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 242.6 102.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 242.6 102.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 242.6 102.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 242.6 102.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 242.6 102.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -457.386506 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 379.696303 0.230645 0.000000 1.000000 447.530278
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908233_1_1332_MLBR_RS06255: 0.000004, NC_002677_1_NP_301912_1_784_hisI: 0.000004, NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025: 0.000004, NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770: 0.000004, NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875: 0.000004, NZ_AP014567_1_WP_010908233_1_1385_hisI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 379.69630
MLEs of dN/dS (w) for site classes (K=3)
p: 0.23065 0.00000 0.76935
w: 1.00000 1.00000 447.53028
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 242.6 102.4 344.5402 0.0000 0.0000 0.0 0.0
7..2 0.000 242.6 102.4 344.5402 0.0000 0.0000 0.0 0.0
7..3 0.000 242.6 102.4 344.5402 0.0000 0.0000 0.0 0.0
7..4 0.000 242.6 102.4 344.5402 0.0000 0.0000 0.0 0.0
7..5 0.000 242.6 102.4 344.5402 0.0000 0.0000 0.0 0.0
7..6 0.000 242.6 102.4 344.5402 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908233_1_1332_MLBR_RS06255)
Pr(w>1) post mean +- SE for w
1 M 0.769 344.537
2 T 0.769 344.539
3 L 0.769 344.537
4 D 0.769 344.537
5 P 0.769 344.539
6 D 0.769 344.537
7 I 0.769 344.539
8 A 0.769 344.539
9 V 0.769 344.539
10 R 0.769 344.537
11 L 0.769 344.537
12 K 0.769 344.537
13 R 0.769 344.537
14 N 0.769 344.536
15 A 0.769 344.536
16 E 0.769 344.539
17 G 0.769 344.539
18 L 0.769 344.540
19 F 0.769 344.537
20 T 0.769 344.536
21 A 0.769 344.536
22 V 0.769 344.536
23 V 0.769 344.539
24 Q 0.769 344.539
25 E 0.769 344.538
26 R 0.769 344.537
27 S 0.769 344.537
28 S 0.769 344.537
29 G 0.769 344.539
30 D 0.769 344.537
31 V 0.769 344.538
32 L 0.769 344.540
33 M 0.769 344.537
34 V 0.769 344.536
35 A 0.769 344.539
36 W 0.769 344.539
37 M 0.769 344.537
38 D 0.769 344.537
39 D 0.769 344.537
40 Q 0.769 344.540
41 A 0.769 344.539
42 L 0.769 344.539
43 A 0.769 344.539
44 R 0.769 344.537
45 T 0.769 344.536
46 L 0.769 344.539
47 E 0.769 344.539
48 T 0.769 344.536
49 R 0.769 344.539
50 E 0.769 344.538
51 A 0.769 344.538
52 N 0.769 344.539
53 Y 0.769 344.539
54 Y 0.769 344.539
55 S 0.769 344.538
56 R 0.769 344.540
57 S 0.769 344.537
58 R 0.769 344.538
59 A 0.769 344.536
60 E 0.769 344.538
61 Q 0.769 344.539
62 W 0.769 344.539
63 I 0.769 344.536
64 K 0.769 344.537
65 G 0.769 344.539
66 S 0.769 344.538
67 T 0.769 344.536
68 S 0.769 344.537
69 G 0.769 344.536
70 N 0.769 344.536
71 T 0.769 344.538
72 Q 0.769 344.539
73 H 0.769 344.539
74 V 0.769 344.539
75 H 0.769 344.538
76 S 0.769 344.538
77 V 0.769 344.538
78 R 0.769 344.537
79 L 0.769 344.539
80 D 0.769 344.539
81 C 0.769 344.538
82 D 0.769 344.537
83 G 0.769 344.536
84 D 0.769 344.537
85 T 0.769 344.536
86 V 0.769 344.538
87 L 0.769 344.539
88 L 0.769 344.539
89 T 0.769 344.538
90 V 0.769 344.536
91 D 0.769 344.537
92 Q 0.769 344.539
93 V 0.769 344.536
94 G 0.769 344.539
95 G 0.769 344.539
96 A 0.769 344.536
97 C 0.769 344.538
98 H 0.769 344.539
99 T 0.769 344.536
100 G 0.769 344.536
101 A 0.769 344.539
102 H 0.769 344.538
103 S 0.769 344.539
104 C 0.769 344.538
105 F 0.769 344.539
106 D 0.769 344.539
107 S 0.769 344.537
108 A 0.769 344.539
109 M 0.769 344.537
110 L 0.769 344.540
111 L 0.769 344.540
112 A 0.769 344.536
113 P 0.769 344.539
114 Q 0.769 344.539
115 D 0.769 344.537
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908233_1_1332_MLBR_RS06255)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -457.386582 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 379.696303 0.807325 1.160047
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908233_1_1332_MLBR_RS06255: 0.000004, NC_002677_1_NP_301912_1_784_hisI: 0.000004, NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025: 0.000004, NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770: 0.000004, NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875: 0.000004, NZ_AP014567_1_WP_010908233_1_1385_hisI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 379.69630
Parameters in M7 (beta):
p = 0.80733 q = 1.16005
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.02090 0.08197 0.15542 0.23775 0.32774 0.42501 0.52980 0.64301 0.76690 0.90828
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 242.6 102.4 0.4097 0.0000 0.0000 0.0 0.0
7..2 0.000 242.6 102.4 0.4097 0.0000 0.0000 0.0 0.0
7..3 0.000 242.6 102.4 0.4097 0.0000 0.0000 0.0 0.0
7..4 0.000 242.6 102.4 0.4097 0.0000 0.0000 0.0 0.0
7..5 0.000 242.6 102.4 0.4097 0.0000 0.0000 0.0 0.0
7..6 0.000 242.6 102.4 0.4097 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -457.386507 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 380.075666 0.092936 44.129496 0.005000 48.476379
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908233_1_1332_MLBR_RS06255: 0.000004, NC_002677_1_NP_301912_1_784_hisI: 0.000004, NZ_LVXE01000031_1_WP_010908233_1_1433_A3216_RS09025: 0.000004, NZ_LYPH01000034_1_WP_010908233_1_1415_A8144_RS06770: 0.000004, NZ_CP029543_1_WP_010908233_1_1354_DIJ64_RS06875: 0.000004, NZ_AP014567_1_WP_010908233_1_1385_hisI: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 380.07567
Parameters in M8 (beta&w>1):
p0 = 0.09294 p = 44.12950 q = 0.00500
(p1 = 0.90706) w = 48.47638
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00929 0.00929 0.00929 0.00929 0.00929 0.00929 0.00929 0.00929 0.00929 0.00929 0.90706
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 48.47638
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 242.6 102.4 44.0641 0.0000 0.0000 0.0 0.0
7..2 0.000 242.6 102.4 44.0641 0.0000 0.0000 0.0 0.0
7..3 0.000 242.6 102.4 44.0641 0.0000 0.0000 0.0 0.0
7..4 0.000 242.6 102.4 44.0641 0.0000 0.0000 0.0 0.0
7..5 0.000 242.6 102.4 44.0641 0.0000 0.0000 0.0 0.0
7..6 0.000 242.6 102.4 44.0641 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908233_1_1332_MLBR_RS06255)
Pr(w>1) post mean +- SE for w
1 M 0.907 44.064
2 T 0.907 44.064
3 L 0.907 44.064
4 D 0.907 44.064
5 P 0.907 44.064
6 D 0.907 44.064
7 I 0.907 44.064
8 A 0.907 44.064
9 V 0.907 44.064
10 R 0.907 44.064
11 L 0.907 44.064
12 K 0.907 44.064
13 R 0.907 44.064
14 N 0.907 44.064
15 A 0.907 44.064
16 E 0.907 44.064
17 G 0.907 44.064
18 L 0.907 44.064
19 F 0.907 44.064
20 T 0.907 44.064
21 A 0.907 44.064
22 V 0.907 44.064
23 V 0.907 44.064
24 Q 0.907 44.064
25 E 0.907 44.064
26 R 0.907 44.064
27 S 0.907 44.064
28 S 0.907 44.064
29 G 0.907 44.064
30 D 0.907 44.064
31 V 0.907 44.064
32 L 0.907 44.064
33 M 0.907 44.064
34 V 0.907 44.064
35 A 0.907 44.064
36 W 0.907 44.064
37 M 0.907 44.064
38 D 0.907 44.064
39 D 0.907 44.064
40 Q 0.907 44.064
41 A 0.907 44.064
42 L 0.907 44.064
43 A 0.907 44.064
44 R 0.907 44.064
45 T 0.907 44.064
46 L 0.907 44.064
47 E 0.907 44.064
48 T 0.907 44.064
49 R 0.907 44.064
50 E 0.907 44.064
51 A 0.907 44.064
52 N 0.907 44.064
53 Y 0.907 44.064
54 Y 0.907 44.064
55 S 0.907 44.064
56 R 0.907 44.064
57 S 0.907 44.064
58 R 0.907 44.064
59 A 0.907 44.064
60 E 0.907 44.064
61 Q 0.907 44.064
62 W 0.907 44.064
63 I 0.907 44.064
64 K 0.907 44.064
65 G 0.907 44.064
66 S 0.907 44.064
67 T 0.907 44.064
68 S 0.907 44.064
69 G 0.907 44.064
70 N 0.907 44.064
71 T 0.907 44.064
72 Q 0.907 44.064
73 H 0.907 44.064
74 V 0.907 44.064
75 H 0.907 44.064
76 S 0.907 44.064
77 V 0.907 44.064
78 R 0.907 44.064
79 L 0.907 44.064
80 D 0.907 44.064
81 C 0.907 44.064
82 D 0.907 44.064
83 G 0.907 44.064
84 D 0.907 44.064
85 T 0.907 44.064
86 V 0.907 44.064
87 L 0.907 44.064
88 L 0.907 44.064
89 T 0.907 44.064
90 V 0.907 44.064
91 D 0.907 44.064
92 Q 0.907 44.064
93 V 0.907 44.064
94 G 0.907 44.064
95 G 0.907 44.064
96 A 0.907 44.064
97 C 0.907 44.064
98 H 0.907 44.064
99 T 0.907 44.064
100 G 0.907 44.064
101 A 0.907 44.064
102 H 0.907 44.064
103 S 0.907 44.064
104 C 0.907 44.064
105 F 0.907 44.064
106 D 0.907 44.064
107 S 0.907 44.064
108 A 0.907 44.064
109 M 0.907 44.064
110 L 0.907 44.064
111 L 0.907 44.064
112 A 0.907 44.064
113 P 0.907 44.064
114 Q 0.907 44.064
115 D 0.907 44.064
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908233_1_1332_MLBR_RS06255)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -457.38655 Model 2: PositiveSelection -457.386506 Model 0: one-ratio -457.386507 Model 7: beta -457.386582 Model 8: beta&w>1 -457.386507 Model 0 vs 1 8.600000001024455E-5 Model 2 vs 1 8.800000000519503E-5 Model 8 vs 7 1.4999999996234692E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
