--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:07:41 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/hisI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -473.76 -478.17
2 -473.76 -476.65
--------------------------------------
TOTAL -473.76 -477.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894479 0.086450 0.360527 1.479809 0.863748 1333.35 1417.18 1.000
r(A<->C){all} 0.174471 0.020861 0.000076 0.456536 0.136866 216.66 254.69 1.001
r(A<->G){all} 0.166253 0.019610 0.000370 0.449344 0.129846 202.95 311.46 1.001
r(A<->T){all} 0.173759 0.019991 0.000035 0.447257 0.142760 208.38 331.07 1.000
r(C<->G){all} 0.160721 0.019228 0.000038 0.435920 0.124018 205.43 209.94 1.004
r(C<->T){all} 0.165997 0.019000 0.000006 0.446956 0.131803 153.13 188.60 1.000
r(G<->T){all} 0.158799 0.017882 0.000029 0.426625 0.126487 316.67 320.39 1.002
pi(A){all} 0.208972 0.000450 0.167617 0.249308 0.208984 1235.09 1299.92 1.000
pi(C){all} 0.304392 0.000613 0.256720 0.353295 0.304088 1161.74 1193.01 1.000
pi(G){all} 0.289402 0.000590 0.240927 0.333854 0.289060 1246.35 1373.68 1.000
pi(T){all} 0.197233 0.000462 0.153252 0.236785 0.197080 1268.99 1297.95 1.001
alpha{1,2} 0.412959 0.233241 0.000166 1.368643 0.238711 1110.23 1126.94 1.000
alpha{3} 0.444289 0.248938 0.000174 1.439089 0.271827 1254.40 1377.70 1.001
pinvar{all} 0.995270 0.000035 0.984840 0.999999 0.996989 1175.89 1243.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -457.38655
Model 2: PositiveSelection -457.386506
Model 0: one-ratio -457.386507
Model 7: beta -457.386582
Model 8: beta&w>1 -457.386507
Model 0 vs 1 8.600000001024455E-5
Model 2 vs 1 8.800000000519503E-5
Model 8 vs 7 1.4999999996234692E-4
>C1
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C2
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C3
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C4
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C5
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C6
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=115
C1 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C2 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C3 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C4 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C5 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C6 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
**************************************************
C1 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C2 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C3 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C4 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C5 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C6 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
**************************************************
C1 AHSCFDSAMLLAPQD
C2 AHSCFDSAMLLAPQD
C3 AHSCFDSAMLLAPQD
C4 AHSCFDSAMLLAPQD
C5 AHSCFDSAMLLAPQD
C6 AHSCFDSAMLLAPQD
***************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 115 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 115 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3450]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3450]--->[3450]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.458 Mb, Max= 30.642 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C2 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C3 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C4 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C5 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
C6 MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
**************************************************
C1 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C2 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C3 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C4 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C5 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
C6 ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
**************************************************
C1 AHSCFDSAMLLAPQD
C2 AHSCFDSAMLLAPQD
C3 AHSCFDSAMLLAPQD
C4 AHSCFDSAMLLAPQD
C5 AHSCFDSAMLLAPQD
C6 AHSCFDSAMLLAPQD
***************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C2 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C3 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C4 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C5 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
C6 ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
**************************************************
C1 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C2 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C3 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C4 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C5 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
C6 TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
**************************************************
C1 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C2 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C3 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C4 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C5 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
C6 TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
**************************************************
C1 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C2 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C3 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C4 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C5 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
C6 GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
**************************************************
C1 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C2 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C3 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C4 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C5 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
C6 CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
**************************************************
C1 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C2 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C3 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C4 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C5 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
C6 ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
**************************************************
C1 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C2 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C3 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C4 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C5 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
C6 GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
*********************************************
>C1
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C2
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C3
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C4
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C5
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C6
ATGACACTCGACCCAGACATTGCTGTACGCCTCAAGCGCAACGCCGAAGG
TTTATTCACCGCCGTCGTACAGGAGCGCTCCAGCGGAGACGTGCTAATGG
TCGCTTGGATGGACGACCAAGCACTGGCTCGCACCCTGGAAACCCGTGAG
GCGAATTATTATTCGCGATCCCGGGCCGAGCAGTGGATCAAGGGATCGAC
CTCCGGCAACACGCAGCATGTTCACTCGGTGCGCCTGGATTGCGACGGCG
ACACCGTGCTGTTGACGGTCGACCAGGTCGGTGGAGCCTGCCATACCGGC
GCTCACAGTTGCTTTGATTCCGCAATGTTATTAGCCCCTCAGGAC
>C1
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C2
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C3
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C4
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C5
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
>C6
MTLDPDIAVRLKRNAEGLFTAVVQERSSGDVLMVAWMDDQALARTLETRE
ANYYSRSRAEQWIKGSTSGNTQHVHSVRLDCDGDTVLLTVDQVGGACHTG
AHSCFDSAMLLAPQD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 345 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791985
Setting output file names to "/data/2res/hisI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1981071593
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0483566634
Seed = 257141974
Swapseed = 1579791985
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -772.126541 -- -24.965149
Chain 2 -- -772.126541 -- -24.965149
Chain 3 -- -772.126541 -- -24.965149
Chain 4 -- -772.126541 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -772.126541 -- -24.965149
Chain 2 -- -772.126496 -- -24.965149
Chain 3 -- -772.126496 -- -24.965149
Chain 4 -- -772.126541 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-772.127] (-772.127) (-772.127) (-772.127) * [-772.127] (-772.126) (-772.126) (-772.127)
500 -- (-479.542) (-491.734) [-484.012] (-482.560) * (-486.208) (-483.921) (-478.041) [-479.113] -- 0:00:00
1000 -- (-485.953) (-487.372) [-480.782] (-480.273) * (-483.232) (-484.294) [-478.544] (-485.064) -- 0:00:00
1500 -- (-484.878) (-488.313) (-483.252) [-493.922] * (-485.049) (-483.950) (-483.905) [-482.727] -- 0:00:00
2000 -- (-484.949) (-482.026) [-484.445] (-482.492) * (-482.597) (-483.638) (-481.484) [-483.142] -- 0:00:00
2500 -- (-481.296) (-487.931) (-483.590) [-475.192] * (-483.772) (-497.275) (-485.842) [-483.005] -- 0:00:00
3000 -- [-482.854] (-481.947) (-481.405) (-491.499) * (-481.887) [-485.748] (-483.462) (-491.190) -- 0:00:00
3500 -- (-484.949) (-486.825) (-482.155) [-483.611] * [-479.973] (-484.718) (-486.993) (-483.822) -- 0:00:00
4000 -- (-495.485) (-486.299) [-486.922] (-483.688) * [-485.910] (-486.065) (-480.498) (-483.872) -- 0:00:00
4500 -- [-482.883] (-484.768) (-486.951) (-483.391) * (-484.813) (-496.421) (-482.139) [-486.205] -- 0:00:00
5000 -- (-480.572) (-485.161) (-489.519) [-481.154] * [-480.313] (-484.989) (-488.630) (-482.433) -- 0:00:00
Average standard deviation of split frequencies: 0.096027
5500 -- (-485.762) (-484.213) (-480.902) [-484.370] * (-483.104) (-487.910) (-489.053) [-483.306] -- 0:00:00
6000 -- (-482.145) (-477.243) (-488.257) [-481.525] * [-477.160] (-480.474) (-478.903) (-491.252) -- 0:00:00
6500 -- (-490.002) (-484.434) (-491.022) [-481.756] * [-488.877] (-499.782) (-493.274) (-482.619) -- 0:00:00
7000 -- (-483.655) (-485.530) (-479.597) [-482.577] * (-487.710) [-484.369] (-486.561) (-489.126) -- 0:00:00
7500 -- (-484.283) [-480.867] (-479.046) (-482.598) * (-482.942) [-481.452] (-487.585) (-485.619) -- 0:00:00
8000 -- (-484.941) (-492.398) [-484.545] (-480.594) * (-482.871) (-488.790) (-479.845) [-491.524] -- 0:00:00
8500 -- (-486.226) [-478.435] (-479.163) (-483.908) * (-480.220) [-480.302] (-482.153) (-493.916) -- 0:00:00
9000 -- (-482.197) [-482.794] (-485.629) (-481.653) * [-480.184] (-493.523) (-482.863) (-482.241) -- 0:00:00
9500 -- (-477.746) (-480.845) (-487.032) [-483.456] * (-489.706) (-487.316) (-481.177) [-475.719] -- 0:00:00
10000 -- (-483.658) (-482.853) [-480.901] (-489.836) * [-481.932] (-490.149) (-484.750) (-479.888) -- 0:00:00
Average standard deviation of split frequencies: 0.080589
10500 -- (-489.404) [-484.420] (-486.475) (-484.434) * [-491.708] (-482.354) (-478.359) (-476.218) -- 0:00:00
11000 -- (-479.357) [-482.398] (-483.776) (-479.929) * (-485.593) (-478.412) [-482.046] (-491.351) -- 0:00:00
11500 -- (-483.533) [-479.576] (-484.257) (-483.333) * (-490.958) [-480.386] (-484.805) (-485.397) -- 0:00:00
12000 -- [-480.926] (-485.112) (-478.267) (-490.531) * [-483.388] (-480.367) (-486.880) (-489.661) -- 0:00:00
12500 -- (-480.980) [-482.668] (-485.048) (-482.491) * (-481.985) (-484.531) [-486.635] (-487.540) -- 0:00:00
13000 -- (-486.712) (-484.611) (-478.429) [-481.800] * [-486.976] (-483.833) (-491.224) (-482.273) -- 0:00:00
13500 -- (-487.835) [-488.342] (-484.235) (-483.070) * [-477.805] (-493.374) (-479.329) (-486.657) -- 0:01:13
14000 -- (-486.677) (-482.275) [-489.131] (-485.525) * [-477.207] (-488.426) (-481.137) (-487.463) -- 0:01:10
14500 -- (-478.891) [-481.885] (-487.733) (-483.080) * (-491.308) [-485.255] (-484.512) (-488.018) -- 0:01:07
15000 -- [-484.887] (-487.310) (-485.546) (-482.571) * (-483.218) [-482.677] (-492.758) (-481.095) -- 0:01:05
Average standard deviation of split frequencies: 0.045831
15500 -- (-485.241) (-474.895) [-487.395] (-484.543) * (-479.527) (-483.132) (-485.421) [-484.517] -- 0:01:03
16000 -- (-482.855) (-485.468) [-483.707] (-482.843) * (-491.764) [-482.705] (-487.058) (-490.330) -- 0:01:01
16500 -- (-490.065) (-480.095) [-483.614] (-503.218) * (-482.936) [-483.813] (-486.268) (-494.565) -- 0:00:59
17000 -- (-490.301) (-486.787) [-487.011] (-490.346) * (-481.318) [-478.539] (-485.967) (-489.421) -- 0:00:57
17500 -- (-485.946) [-483.712] (-481.304) (-489.607) * [-478.570] (-482.685) (-482.904) (-485.613) -- 0:00:56
18000 -- (-489.152) [-490.542] (-479.438) (-498.887) * [-480.245] (-488.889) (-488.059) (-483.721) -- 0:00:54
18500 -- (-482.862) (-492.493) (-484.661) [-479.125] * (-483.867) (-477.202) (-491.876) [-485.980] -- 0:00:53
19000 -- [-479.440] (-490.447) (-483.451) (-472.722) * (-487.361) (-485.123) (-486.190) [-482.428] -- 0:00:51
19500 -- (-485.650) (-489.222) [-479.513] (-474.300) * (-481.205) [-487.966] (-479.440) (-485.261) -- 0:00:50
20000 -- [-489.632] (-490.182) (-484.675) (-475.731) * (-490.385) [-492.930] (-484.455) (-486.815) -- 0:00:49
Average standard deviation of split frequencies: 0.038492
20500 -- (-485.602) (-489.174) [-478.887] (-475.872) * (-485.350) (-502.408) [-483.759] (-479.850) -- 0:00:47
21000 -- (-481.687) [-478.441] (-485.921) (-474.585) * (-480.145) (-496.970) [-483.893] (-478.443) -- 0:00:46
21500 -- (-482.735) [-479.938] (-485.034) (-472.555) * [-480.952] (-493.676) (-487.040) (-482.461) -- 0:00:45
22000 -- (-485.195) (-482.276) [-482.210] (-472.795) * (-487.904) (-489.002) (-486.128) [-480.271] -- 0:00:44
22500 -- [-478.980] (-485.466) (-486.311) (-476.838) * (-484.799) [-476.668] (-486.060) (-492.051) -- 0:00:43
23000 -- (-490.742) (-490.114) [-481.165] (-473.627) * (-485.178) (-474.419) [-482.613] (-489.683) -- 0:00:42
23500 -- (-482.938) (-486.925) (-481.897) [-474.259] * [-479.920] (-472.751) (-490.858) (-489.253) -- 0:00:41
24000 -- (-479.052) (-489.405) [-480.205] (-475.816) * [-483.727] (-472.780) (-480.451) (-485.268) -- 0:00:40
24500 -- (-483.409) (-482.663) (-483.815) [-476.326] * (-486.487) [-472.214] (-510.961) (-495.421) -- 0:00:39
25000 -- [-485.052] (-480.296) (-480.616) (-477.097) * [-486.730] (-472.684) (-486.334) (-486.161) -- 0:00:39
Average standard deviation of split frequencies: 0.039715
25500 -- (-478.442) [-489.499] (-478.867) (-473.229) * (-478.792) [-472.572] (-498.891) (-482.327) -- 0:00:38
26000 -- [-484.312] (-483.534) (-484.646) (-475.225) * (-492.226) (-473.254) [-475.939] (-483.633) -- 0:00:37
26500 -- (-487.911) (-479.324) [-482.121] (-476.379) * (-481.640) [-473.098] (-474.249) (-495.286) -- 0:00:36
27000 -- (-486.286) (-478.511) (-486.190) [-474.143] * (-480.546) (-473.231) [-475.142] (-490.514) -- 0:00:36
27500 -- (-485.804) [-481.707] (-483.381) (-473.659) * (-486.776) [-476.618] (-472.973) (-481.956) -- 0:00:35
28000 -- (-484.300) [-485.560] (-483.422) (-480.381) * (-479.006) (-478.213) [-475.231] (-480.420) -- 0:00:34
28500 -- (-482.524) (-481.640) [-483.627] (-474.812) * (-486.288) (-474.032) [-474.344] (-485.797) -- 0:00:34
29000 -- (-488.811) [-482.904] (-479.906) (-475.532) * [-477.819] (-476.016) (-478.245) (-482.658) -- 0:00:33
29500 -- (-481.163) [-482.118] (-486.449) (-476.337) * [-481.595] (-475.790) (-472.596) (-482.592) -- 0:01:05
30000 -- (-497.994) [-481.991] (-483.255) (-476.971) * [-493.301] (-477.425) (-475.429) (-478.983) -- 0:01:04
Average standard deviation of split frequencies: 0.045211
30500 -- (-486.373) (-478.183) [-484.117] (-474.772) * (-484.870) [-473.565] (-478.218) (-479.539) -- 0:01:03
31000 -- [-478.103] (-481.833) (-484.840) (-473.901) * (-483.114) [-472.244] (-480.829) (-484.084) -- 0:01:02
31500 -- [-483.505] (-486.015) (-483.588) (-474.152) * (-484.379) (-475.544) (-475.573) [-482.987] -- 0:01:01
32000 -- (-482.862) (-481.617) [-482.492] (-474.982) * (-485.353) [-477.156] (-473.738) (-486.637) -- 0:01:00
32500 -- [-478.204] (-506.271) (-486.343) (-473.663) * (-482.280) (-473.927) [-473.327] (-485.652) -- 0:00:59
33000 -- (-483.363) (-507.968) (-476.879) [-476.547] * (-481.030) (-475.210) [-473.239] (-478.358) -- 0:00:58
33500 -- (-486.308) (-491.253) (-488.765) [-476.893] * (-486.200) (-473.283) (-472.939) [-481.048] -- 0:00:57
34000 -- (-486.204) (-487.903) [-481.018] (-474.074) * [-480.638] (-476.456) (-475.554) (-489.884) -- 0:00:56
34500 -- [-480.053] (-484.454) (-482.507) (-474.743) * (-494.179) (-473.600) (-481.263) [-483.704] -- 0:00:55
35000 -- (-484.933) (-483.341) (-483.430) [-478.154] * (-488.156) [-472.876] (-477.243) (-488.318) -- 0:00:55
Average standard deviation of split frequencies: 0.048741
35500 -- (-484.385) [-473.595] (-485.696) (-476.256) * (-495.207) [-474.315] (-475.278) (-483.775) -- 0:00:54
36000 -- [-485.365] (-473.723) (-482.337) (-477.725) * (-492.714) (-473.773) [-476.864] (-486.931) -- 0:00:53
36500 -- (-494.358) [-473.415] (-486.377) (-477.080) * (-489.769) (-473.952) [-476.026] (-479.867) -- 0:00:52
37000 -- (-485.996) [-476.735] (-479.518) (-475.311) * (-482.926) (-474.846) [-473.622] (-492.838) -- 0:00:52
37500 -- (-484.491) [-474.006] (-485.931) (-476.607) * [-472.721] (-473.336) (-472.590) (-489.124) -- 0:00:51
38000 -- (-483.470) (-479.303) [-483.011] (-474.010) * (-472.390) (-475.492) [-472.172] (-483.193) -- 0:00:50
38500 -- (-481.674) [-474.010] (-490.860) (-473.209) * [-472.189] (-473.969) (-475.669) (-491.919) -- 0:00:49
39000 -- (-489.067) (-475.874) (-482.237) [-473.411] * (-473.634) (-473.384) (-473.747) [-478.718] -- 0:00:49
39500 -- [-485.177] (-472.981) (-484.627) (-474.700) * (-478.931) (-477.243) (-475.125) [-478.095] -- 0:00:48
40000 -- (-489.804) (-473.394) [-479.520] (-473.013) * [-473.800] (-475.123) (-473.458) (-480.034) -- 0:00:48
Average standard deviation of split frequencies: 0.036606
40500 -- (-480.840) [-474.156] (-485.108) (-474.251) * [-473.266] (-475.245) (-474.027) (-483.721) -- 0:00:47
41000 -- [-481.008] (-474.604) (-486.556) (-474.275) * (-473.501) [-476.434] (-476.934) (-484.673) -- 0:00:46
41500 -- (-482.582) (-475.355) [-483.267] (-473.759) * (-473.101) (-476.098) [-477.625] (-480.241) -- 0:00:46
42000 -- [-489.475] (-472.755) (-480.847) (-475.914) * (-473.709) (-472.791) (-474.303) [-485.355] -- 0:00:45
42500 -- (-482.428) (-473.004) [-482.553] (-473.928) * (-474.919) [-476.101] (-477.603) (-485.741) -- 0:00:45
43000 -- (-487.356) (-475.987) (-479.766) [-472.861] * (-476.302) (-475.605) (-476.060) [-484.046] -- 0:00:44
43500 -- (-484.732) (-473.707) (-485.280) [-475.225] * (-475.239) (-475.893) (-472.263) [-483.362] -- 0:00:43
44000 -- (-483.203) (-478.075) (-479.304) [-476.973] * (-474.060) (-479.826) [-473.321] (-479.403) -- 0:00:43
44500 -- (-478.291) (-473.983) (-482.545) [-474.415] * (-473.468) [-476.944] (-478.049) (-495.194) -- 0:00:42
45000 -- (-487.201) (-475.135) (-487.203) [-476.331] * (-477.651) [-475.178] (-473.682) (-483.049) -- 0:00:42
Average standard deviation of split frequencies: 0.038197
45500 -- [-483.213] (-472.913) (-480.521) (-473.743) * (-475.364) (-473.100) (-474.162) [-482.368] -- 0:01:02
46000 -- (-489.360) [-473.517] (-486.972) (-475.099) * (-474.892) [-473.688] (-474.452) (-489.443) -- 0:01:02
46500 -- (-481.970) [-474.214] (-487.057) (-477.482) * (-474.777) (-473.837) [-474.461] (-486.372) -- 0:01:01
47000 -- (-493.452) [-474.747] (-478.822) (-473.166) * [-480.822] (-473.209) (-476.668) (-482.138) -- 0:01:00
47500 -- (-487.652) (-475.405) (-481.775) [-472.600] * (-474.331) [-476.388] (-476.662) (-490.762) -- 0:01:00
48000 -- (-483.311) [-474.366] (-480.944) (-476.958) * (-473.405) (-477.740) (-477.511) [-489.514] -- 0:00:59
48500 -- (-483.525) [-473.326] (-491.395) (-473.008) * (-477.002) [-476.729] (-477.103) (-492.885) -- 0:00:58
49000 -- (-482.758) (-475.795) [-482.189] (-473.391) * (-473.833) (-475.582) (-474.253) [-483.099] -- 0:00:58
49500 -- [-480.643] (-474.745) (-486.160) (-474.825) * (-473.445) (-476.091) [-473.742] (-492.785) -- 0:00:57
50000 -- (-489.390) (-477.870) [-484.439] (-473.341) * (-472.195) (-476.351) [-472.848] (-484.952) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
50500 -- (-479.176) (-478.541) (-477.061) [-476.347] * (-473.519) [-475.596] (-478.497) (-492.806) -- 0:00:56
51000 -- (-474.239) (-483.509) (-489.259) [-473.345] * (-474.041) [-473.012] (-473.284) (-486.216) -- 0:00:55
51500 -- (-474.678) (-473.639) (-481.412) [-473.556] * (-476.493) (-474.775) (-473.159) [-484.639] -- 0:00:55
52000 -- [-475.770] (-477.994) (-477.741) (-474.785) * (-473.921) [-473.328] (-474.048) (-490.808) -- 0:00:54
52500 -- (-475.321) [-476.064] (-473.082) (-474.884) * (-475.063) (-474.582) [-473.367] (-485.543) -- 0:00:54
53000 -- [-474.963] (-478.642) (-472.944) (-476.451) * (-474.606) [-475.997] (-472.806) (-483.608) -- 0:00:53
53500 -- (-474.146) (-474.417) (-472.720) [-473.233] * (-475.132) (-473.819) [-474.724] (-488.921) -- 0:00:53
54000 -- (-474.524) (-473.339) (-475.651) [-474.056] * (-473.699) [-479.666] (-478.275) (-490.014) -- 0:00:52
54500 -- (-474.285) (-473.514) [-472.772] (-475.370) * (-475.979) (-477.950) (-479.881) [-483.649] -- 0:00:52
55000 -- (-472.698) (-475.133) [-475.135] (-473.607) * [-473.853] (-476.886) (-481.231) (-480.379) -- 0:00:51
Average standard deviation of split frequencies: 0.031988
55500 -- [-474.454] (-475.415) (-474.208) (-474.529) * (-473.946) (-475.114) [-474.023] (-485.430) -- 0:00:51
56000 -- [-473.975] (-475.515) (-473.226) (-475.405) * [-476.194] (-472.306) (-473.380) (-483.470) -- 0:00:50
56500 -- [-472.986] (-475.511) (-477.025) (-477.498) * (-475.027) [-477.379] (-473.128) (-483.743) -- 0:00:50
57000 -- (-473.980) (-479.193) (-478.617) [-472.876] * (-474.184) [-474.756] (-477.737) (-489.282) -- 0:00:49
57500 -- (-472.963) [-474.815] (-475.737) (-476.219) * (-473.637) (-474.399) (-473.555) [-479.587] -- 0:00:49
58000 -- (-475.089) (-473.284) (-473.702) [-473.512] * (-473.374) [-473.022] (-473.220) (-489.466) -- 0:00:48
58500 -- (-480.209) (-475.729) [-472.783] (-473.982) * [-473.277] (-475.656) (-472.533) (-477.309) -- 0:00:48
59000 -- (-474.984) (-475.279) [-473.721] (-474.468) * (-477.165) (-475.410) [-472.965] (-480.337) -- 0:00:47
59500 -- (-475.314) (-475.539) [-475.411] (-475.215) * [-474.185] (-479.744) (-476.762) (-482.886) -- 0:00:47
60000 -- (-474.847) [-472.724] (-474.490) (-477.012) * [-476.943] (-478.310) (-473.243) (-480.167) -- 0:00:47
Average standard deviation of split frequencies: 0.028219
60500 -- (-475.425) [-472.881] (-473.767) (-474.773) * (-479.885) (-474.766) (-474.425) [-480.216] -- 0:00:46
61000 -- (-475.360) (-475.308) [-474.037] (-472.804) * [-474.343] (-473.958) (-474.406) (-488.590) -- 0:00:46
61500 -- (-474.485) (-474.596) (-476.153) [-472.510] * (-474.595) [-473.201] (-475.634) (-488.249) -- 0:01:01
62000 -- (-472.604) [-474.058] (-476.025) (-473.746) * (-474.993) (-475.189) (-476.991) [-481.657] -- 0:01:00
62500 -- (-473.248) (-475.061) [-475.075] (-474.081) * (-473.990) [-476.425] (-473.729) (-499.717) -- 0:01:00
63000 -- [-473.059] (-475.781) (-473.167) (-475.689) * (-474.452) (-475.247) (-474.242) [-474.373] -- 0:00:59
63500 -- [-473.539] (-473.824) (-476.869) (-473.537) * (-478.418) (-476.696) (-474.782) [-476.228] -- 0:00:58
64000 -- (-474.694) (-474.143) [-474.213] (-475.668) * (-475.953) (-473.396) [-480.598] (-473.259) -- 0:00:58
64500 -- (-474.947) [-474.699] (-474.579) (-473.788) * (-474.039) (-473.830) [-473.034] (-472.850) -- 0:00:58
65000 -- (-477.197) (-474.212) (-473.061) [-473.938] * (-472.857) (-476.021) [-474.646] (-477.030) -- 0:00:57
Average standard deviation of split frequencies: 0.030450
65500 -- (-477.769) [-473.505] (-478.731) (-475.652) * (-475.084) [-477.193] (-474.003) (-480.103) -- 0:00:57
66000 -- (-472.923) (-477.368) [-473.045] (-475.756) * (-476.013) (-479.139) (-473.708) [-474.310] -- 0:00:56
66500 -- (-472.690) (-475.210) [-476.921] (-476.110) * [-475.209] (-476.235) (-472.302) (-473.717) -- 0:00:56
67000 -- (-472.721) [-472.644] (-477.500) (-474.565) * (-474.818) (-475.002) (-474.666) [-473.847] -- 0:00:55
67500 -- [-473.138] (-474.552) (-474.098) (-474.665) * (-476.571) (-475.492) (-475.447) [-472.517] -- 0:00:55
68000 -- (-474.842) (-474.277) (-477.319) [-474.307] * (-473.066) (-480.852) (-476.046) [-476.839] -- 0:00:54
68500 -- (-474.473) [-473.550] (-476.448) (-477.712) * (-476.399) [-473.996] (-474.471) (-473.245) -- 0:00:54
69000 -- (-472.530) (-474.881) [-476.999] (-472.656) * (-474.286) [-473.344] (-474.309) (-476.958) -- 0:00:53
69500 -- [-473.183] (-473.667) (-475.813) (-473.355) * (-473.775) (-474.473) [-476.112] (-476.500) -- 0:00:53
70000 -- (-473.686) [-479.487] (-478.915) (-475.161) * (-473.893) (-476.028) (-477.895) [-476.216] -- 0:00:53
Average standard deviation of split frequencies: 0.027737
70500 -- (-474.414) (-475.795) (-476.755) [-473.710] * (-475.353) (-476.337) (-475.272) [-473.745] -- 0:00:52
71000 -- (-476.193) (-476.090) [-478.177] (-473.502) * (-480.062) [-474.042] (-476.067) (-473.083) -- 0:00:52
71500 -- (-481.453) (-481.402) (-479.522) [-474.380] * (-473.497) (-473.763) [-473.066] (-473.429) -- 0:00:51
72000 -- (-473.620) [-475.481] (-477.410) (-473.531) * [-473.592] (-476.356) (-473.238) (-476.059) -- 0:00:51
72500 -- [-472.716] (-474.110) (-472.995) (-477.657) * (-474.402) [-474.583] (-473.136) (-474.286) -- 0:00:51
73000 -- (-476.719) [-474.902] (-477.049) (-475.270) * (-472.843) [-474.415] (-472.944) (-472.836) -- 0:00:50
73500 -- (-473.984) (-477.759) [-472.934] (-474.435) * (-472.761) [-472.801] (-475.986) (-474.176) -- 0:00:50
74000 -- (-475.368) (-476.210) [-475.557] (-472.495) * (-476.254) [-472.878] (-475.339) (-482.627) -- 0:00:50
74500 -- (-478.069) (-473.204) (-473.966) [-472.159] * (-474.205) (-472.632) (-481.628) [-475.785] -- 0:00:49
75000 -- [-473.752] (-476.408) (-474.967) (-473.567) * (-475.911) (-474.712) (-476.566) [-475.863] -- 0:00:49
Average standard deviation of split frequencies: 0.027096
75500 -- (-474.987) [-472.707] (-477.078) (-473.010) * (-476.509) [-473.927] (-477.432) (-476.470) -- 0:00:48
76000 -- (-479.004) (-473.810) (-477.151) [-475.524] * (-478.245) (-473.678) [-476.982] (-476.256) -- 0:00:48
76500 -- (-477.886) (-474.353) (-472.534) [-472.966] * (-472.798) (-476.306) (-476.895) [-477.757] -- 0:00:48
77000 -- (-476.755) (-475.539) (-472.494) [-475.150] * (-472.436) (-475.322) [-474.320] (-475.122) -- 0:00:47
77500 -- (-472.525) (-475.044) (-476.878) [-472.789] * (-477.688) [-473.527] (-479.415) (-475.652) -- 0:00:59
78000 -- (-473.752) (-474.324) [-475.520] (-472.889) * (-474.964) [-475.070] (-476.652) (-475.698) -- 0:00:59
78500 -- [-476.787] (-476.371) (-475.637) (-474.216) * (-475.276) [-474.532] (-478.408) (-473.933) -- 0:00:58
79000 -- (-473.109) [-475.703] (-474.681) (-477.671) * [-473.591] (-472.395) (-474.492) (-476.061) -- 0:00:58
79500 -- (-472.734) (-476.508) (-473.476) [-476.801] * (-474.400) (-472.640) [-476.726] (-476.570) -- 0:00:57
80000 -- (-474.044) (-475.327) [-474.127] (-475.063) * (-476.102) (-474.603) [-477.752] (-474.637) -- 0:00:57
Average standard deviation of split frequencies: 0.026451
80500 -- (-473.558) (-473.961) (-472.561) [-473.661] * (-475.184) (-474.104) [-476.529] (-474.671) -- 0:00:57
81000 -- (-473.827) (-474.205) [-472.386] (-478.877) * [-475.275] (-473.933) (-472.744) (-474.118) -- 0:00:56
81500 -- (-473.595) (-473.408) (-475.553) [-480.266] * (-472.780) (-473.293) [-472.567] (-474.338) -- 0:00:56
82000 -- [-474.584] (-474.951) (-474.826) (-473.496) * [-474.762] (-472.953) (-472.881) (-474.418) -- 0:00:55
82500 -- [-474.646] (-476.326) (-475.196) (-473.213) * (-472.893) (-473.711) [-473.880] (-473.800) -- 0:00:55
83000 -- (-473.209) [-474.179] (-474.569) (-473.209) * [-474.520] (-473.750) (-473.858) (-477.112) -- 0:00:55
83500 -- (-472.948) [-474.839] (-474.278) (-474.382) * (-475.990) (-475.918) [-474.629] (-472.364) -- 0:00:54
84000 -- (-475.993) (-474.639) [-472.664] (-475.248) * (-477.610) [-475.383] (-474.267) (-473.472) -- 0:00:54
84500 -- (-476.277) (-473.188) [-476.271] (-477.222) * (-476.594) [-477.674] (-473.660) (-476.952) -- 0:00:54
85000 -- (-474.271) (-472.648) (-476.739) [-477.499] * (-473.312) (-475.768) (-473.049) [-472.897] -- 0:00:53
Average standard deviation of split frequencies: 0.026624
85500 -- (-473.754) (-472.467) [-474.568] (-474.429) * (-475.435) (-474.230) [-473.507] (-476.737) -- 0:00:53
86000 -- (-473.106) (-473.271) (-476.012) [-472.952] * [-476.266] (-473.212) (-474.915) (-474.903) -- 0:00:53
86500 -- (-472.892) (-479.781) (-477.952) [-473.895] * (-474.723) (-473.376) (-473.822) [-475.181] -- 0:00:52
87000 -- (-475.014) (-475.041) (-476.440) [-474.266] * (-476.016) [-474.888] (-472.882) (-474.878) -- 0:00:52
87500 -- (-475.206) (-476.484) [-477.664] (-472.660) * (-474.620) (-476.303) (-473.355) [-477.603] -- 0:00:52
88000 -- (-474.797) (-473.739) [-473.828] (-473.913) * (-474.328) (-475.490) (-472.891) [-473.597] -- 0:00:51
88500 -- [-476.243] (-473.395) (-478.657) (-473.902) * (-473.971) (-473.873) [-473.038] (-473.377) -- 0:00:51
89000 -- (-476.739) [-473.126] (-477.129) (-475.073) * (-476.702) (-475.098) (-476.251) [-472.907] -- 0:00:51
89500 -- (-473.646) (-473.920) (-472.608) [-473.456] * (-474.704) [-474.497] (-476.108) (-474.403) -- 0:00:50
90000 -- (-477.677) [-475.026] (-473.449) (-473.129) * (-477.263) (-476.306) (-475.867) [-472.777] -- 0:00:50
Average standard deviation of split frequencies: 0.026244
90500 -- (-477.357) (-473.732) (-477.951) [-474.135] * (-475.812) (-474.795) (-475.752) [-481.236] -- 0:00:50
91000 -- (-473.575) [-473.370] (-477.131) (-473.721) * (-476.817) [-473.234] (-472.964) (-479.231) -- 0:00:49
91500 -- (-473.245) [-474.951] (-476.532) (-472.893) * (-476.857) (-476.739) (-474.887) [-473.765] -- 0:00:49
92000 -- (-473.764) (-474.060) [-474.434] (-474.233) * [-474.192] (-473.412) (-478.036) (-477.140) -- 0:00:49
92500 -- (-475.613) (-473.993) [-474.220] (-475.981) * [-472.344] (-472.796) (-473.453) (-475.575) -- 0:00:49
93000 -- [-474.181] (-474.119) (-473.715) (-475.078) * [-473.170] (-477.912) (-474.441) (-474.637) -- 0:00:48
93500 -- [-472.786] (-475.909) (-474.334) (-475.632) * (-473.629) [-472.592] (-477.565) (-473.296) -- 0:00:48
94000 -- [-473.558] (-473.334) (-473.525) (-473.422) * (-475.760) [-472.790] (-478.332) (-476.895) -- 0:00:57
94500 -- (-474.897) [-472.552] (-474.241) (-475.427) * (-473.789) (-475.648) (-483.429) [-473.138] -- 0:00:57
95000 -- (-477.068) (-473.202) (-479.123) [-474.406] * [-476.732] (-473.630) (-477.721) (-476.390) -- 0:00:57
Average standard deviation of split frequencies: 0.026891
95500 -- [-474.636] (-473.905) (-474.024) (-472.659) * [-474.823] (-474.694) (-473.635) (-474.645) -- 0:00:56
96000 -- [-474.379] (-474.490) (-478.274) (-473.358) * (-473.524) [-482.110] (-474.517) (-476.416) -- 0:00:56
96500 -- (-474.318) (-474.368) (-476.533) [-472.653] * (-475.169) (-481.913) [-475.169] (-475.016) -- 0:00:56
97000 -- (-473.684) (-477.547) (-474.153) [-476.515] * (-473.256) (-482.104) (-473.462) [-473.614] -- 0:00:55
97500 -- (-477.514) (-473.213) [-473.830] (-476.047) * (-472.747) (-479.338) (-474.389) [-472.917] -- 0:00:55
98000 -- (-475.199) (-476.701) [-472.600] (-479.956) * [-472.668] (-479.145) (-472.266) (-474.678) -- 0:00:55
98500 -- [-475.113] (-472.260) (-476.721) (-476.291) * [-475.522] (-475.769) (-473.100) (-472.796) -- 0:00:54
99000 -- (-476.125) (-474.193) [-473.130] (-472.497) * (-473.886) (-472.035) (-476.115) [-474.171] -- 0:00:54
99500 -- (-483.076) (-473.241) [-475.542] (-474.726) * (-475.030) (-476.117) (-473.616) [-473.603] -- 0:00:54
100000 -- (-475.105) (-475.693) [-472.438] (-474.269) * [-474.592] (-476.874) (-474.336) (-474.491) -- 0:00:54
Average standard deviation of split frequencies: 0.026276
100500 -- (-473.108) (-476.943) [-473.624] (-474.234) * (-474.998) (-472.963) (-477.972) [-476.386] -- 0:00:53
101000 -- (-474.980) [-474.739] (-476.937) (-473.513) * (-476.066) [-473.684] (-476.320) (-472.974) -- 0:00:53
101500 -- (-474.555) [-472.907] (-474.210) (-474.074) * (-474.622) (-475.082) (-473.466) [-473.499] -- 0:00:53
102000 -- (-473.074) (-474.201) (-476.140) [-474.173] * (-472.983) (-477.082) (-474.668) [-474.340] -- 0:00:52
102500 -- (-476.929) (-473.360) (-474.354) [-474.137] * [-473.081] (-474.450) (-473.709) (-473.136) -- 0:00:52
103000 -- [-475.666] (-473.283) (-475.496) (-478.646) * (-473.025) (-476.373) (-472.961) [-473.435] -- 0:00:52
103500 -- (-473.814) (-475.208) (-473.793) [-472.847] * [-474.724] (-472.337) (-475.374) (-476.080) -- 0:00:51
104000 -- (-476.094) [-475.459] (-474.303) (-478.663) * (-480.000) (-472.210) [-474.586] (-472.434) -- 0:00:51
104500 -- [-473.810] (-474.723) (-476.142) (-473.192) * (-478.934) (-475.254) [-472.512] (-472.934) -- 0:00:51
105000 -- (-474.529) (-475.189) (-477.679) [-477.054] * (-473.458) [-473.719] (-474.122) (-473.880) -- 0:00:51
Average standard deviation of split frequencies: 0.025045
105500 -- (-477.104) (-473.839) [-474.602] (-475.184) * (-476.399) (-478.047) [-473.545] (-473.325) -- 0:00:50
106000 -- [-474.556] (-477.086) (-472.777) (-478.063) * (-474.891) (-481.305) [-472.770] (-473.778) -- 0:00:50
106500 -- (-476.214) (-475.861) [-476.108] (-478.490) * [-477.833] (-477.159) (-478.640) (-474.093) -- 0:00:50
107000 -- [-474.339] (-475.883) (-475.973) (-477.807) * [-474.074] (-473.982) (-476.176) (-476.192) -- 0:00:50
107500 -- [-473.198] (-474.820) (-476.997) (-474.738) * (-474.383) [-473.853] (-474.702) (-474.047) -- 0:00:49
108000 -- [-473.354] (-474.615) (-472.899) (-476.742) * (-476.663) (-473.268) [-473.406] (-475.640) -- 0:00:49
108500 -- (-474.907) (-475.398) [-473.610] (-474.935) * (-474.000) (-473.757) [-473.938] (-477.234) -- 0:00:49
109000 -- [-476.302] (-473.672) (-472.656) (-474.550) * [-473.545] (-475.122) (-475.933) (-472.007) -- 0:00:49
109500 -- (-476.572) (-475.758) (-474.418) [-474.515] * [-472.495] (-475.359) (-481.845) (-472.807) -- 0:00:48
110000 -- (-474.736) (-476.684) (-474.643) [-474.448] * (-475.007) (-474.510) (-473.870) [-472.851] -- 0:00:48
Average standard deviation of split frequencies: 0.023540
110500 -- (-474.936) (-474.975) [-475.231] (-473.785) * [-473.765] (-479.057) (-476.062) (-472.915) -- 0:00:56
111000 -- (-473.596) [-472.857] (-476.661) (-477.280) * (-475.419) (-473.264) (-476.099) [-473.270] -- 0:00:56
111500 -- (-473.214) (-472.781) (-476.873) [-472.826] * (-474.457) (-475.110) (-474.624) [-473.652] -- 0:00:55
112000 -- (-473.986) [-473.956] (-474.399) (-472.366) * [-472.862] (-473.297) (-473.138) (-475.481) -- 0:00:55
112500 -- (-474.420) [-476.819] (-473.658) (-473.711) * (-473.629) (-474.914) (-474.079) [-473.869] -- 0:00:55
113000 -- (-477.692) (-473.884) (-473.064) [-474.515] * (-476.734) (-472.761) (-478.748) [-472.891] -- 0:00:54
113500 -- (-478.384) (-473.116) [-473.227] (-473.254) * [-472.551] (-474.677) (-478.725) (-473.576) -- 0:00:54
114000 -- (-477.141) [-473.154] (-473.329) (-472.771) * (-473.010) (-473.435) [-474.143] (-472.876) -- 0:00:54
114500 -- (-475.003) [-473.614] (-477.390) (-476.690) * (-475.481) (-473.124) (-473.700) [-473.868] -- 0:00:54
115000 -- (-474.704) (-474.963) (-473.132) [-476.394] * (-473.718) (-472.355) [-473.785] (-473.332) -- 0:00:53
Average standard deviation of split frequencies: 0.022448
115500 -- (-472.766) (-476.716) (-473.575) [-472.437] * (-472.753) (-479.306) (-476.619) [-478.550] -- 0:00:53
116000 -- [-472.699] (-474.851) (-473.853) (-474.510) * (-473.725) (-472.772) (-480.900) [-478.093] -- 0:00:53
116500 -- [-472.675] (-473.553) (-475.900) (-472.727) * (-474.825) [-473.522] (-483.141) (-474.724) -- 0:00:53
117000 -- (-473.865) (-472.994) [-474.964] (-482.292) * (-474.313) (-475.333) (-476.092) [-479.494] -- 0:00:52
117500 -- (-473.096) (-473.085) (-474.584) [-473.522] * (-473.387) (-474.569) (-473.434) [-473.039] -- 0:00:52
118000 -- (-477.125) (-473.324) [-474.054] (-474.490) * [-475.182] (-474.071) (-473.392) (-472.825) -- 0:00:52
118500 -- [-475.205] (-474.984) (-472.905) (-478.537) * [-472.485] (-474.548) (-473.888) (-473.321) -- 0:00:52
119000 -- (-475.194) (-475.060) (-474.451) [-473.071] * (-472.735) [-474.241] (-473.818) (-474.921) -- 0:00:51
119500 -- (-476.430) [-472.761] (-477.377) (-472.588) * (-475.093) (-476.722) [-472.572] (-478.160) -- 0:00:51
120000 -- (-475.711) [-476.101] (-473.276) (-475.175) * (-473.844) [-473.660] (-472.376) (-474.633) -- 0:00:51
Average standard deviation of split frequencies: 0.021178
120500 -- (-473.420) (-474.836) (-473.759) [-474.300] * (-476.724) [-473.158] (-473.699) (-473.875) -- 0:00:51
121000 -- (-475.621) (-477.365) [-476.505] (-474.496) * (-473.041) [-475.004] (-474.037) (-472.825) -- 0:00:50
121500 -- (-473.685) (-475.739) (-474.797) [-473.747] * [-473.919] (-474.694) (-472.524) (-473.477) -- 0:00:50
122000 -- (-472.339) (-477.416) [-472.367] (-474.319) * (-476.124) (-477.408) [-474.020] (-475.432) -- 0:00:50
122500 -- (-473.282) (-473.304) (-472.708) [-475.860] * [-476.610] (-473.701) (-473.575) (-474.091) -- 0:00:50
123000 -- (-474.897) (-476.363) (-474.261) [-472.887] * [-472.951] (-476.825) (-473.718) (-473.294) -- 0:00:49
123500 -- (-473.231) (-473.174) (-473.730) [-476.196] * (-477.532) [-472.534] (-473.172) (-474.419) -- 0:00:49
124000 -- (-475.072) [-473.721] (-477.782) (-473.878) * (-473.177) [-476.276] (-473.496) (-474.790) -- 0:00:49
124500 -- (-475.412) (-472.627) [-477.122] (-474.408) * [-473.724] (-474.046) (-477.854) (-479.277) -- 0:00:49
125000 -- (-473.337) (-474.848) [-476.696] (-473.968) * (-476.997) (-474.206) (-473.959) [-475.184] -- 0:00:49
Average standard deviation of split frequencies: 0.020488
125500 -- (-476.446) (-474.676) (-475.107) [-476.870] * [-473.930] (-472.716) (-475.185) (-474.707) -- 0:00:48
126000 -- (-475.995) (-474.997) (-477.973) [-472.805] * (-474.369) (-476.165) (-473.788) [-476.325] -- 0:00:48
126500 -- (-478.844) (-475.603) (-473.933) [-475.052] * (-478.596) (-472.321) (-478.528) [-473.190] -- 0:00:55
127000 -- [-473.113] (-473.691) (-473.366) (-473.765) * [-474.309] (-472.723) (-474.406) (-473.465) -- 0:00:54
127500 -- (-473.857) (-474.446) [-475.070] (-472.945) * [-477.925] (-472.619) (-473.387) (-474.133) -- 0:00:54
128000 -- (-473.068) [-473.605] (-475.925) (-473.521) * (-477.581) [-473.297] (-474.589) (-476.592) -- 0:00:54
128500 -- (-474.125) [-472.916] (-473.060) (-474.727) * [-476.651] (-478.068) (-475.475) (-473.346) -- 0:00:54
129000 -- (-473.713) [-475.035] (-476.002) (-473.207) * (-477.924) (-473.790) (-474.359) [-473.277] -- 0:00:54
129500 -- [-473.225] (-472.591) (-474.787) (-473.006) * (-479.865) [-477.684] (-472.703) (-473.868) -- 0:00:53
130000 -- (-475.560) (-472.955) (-475.873) [-472.372] * (-475.036) (-478.678) (-472.586) [-474.474] -- 0:00:53
Average standard deviation of split frequencies: 0.017678
130500 -- [-473.271] (-472.716) (-473.255) (-473.293) * [-477.829] (-477.613) (-472.544) (-474.053) -- 0:00:53
131000 -- (-474.405) (-473.565) [-473.611] (-473.268) * [-476.373] (-475.369) (-473.277) (-474.605) -- 0:00:53
131500 -- (-475.545) [-474.415] (-475.270) (-472.277) * [-475.090] (-474.590) (-474.005) (-474.996) -- 0:00:52
132000 -- (-473.518) (-475.462) (-472.813) [-473.646] * (-476.593) (-480.381) (-473.819) [-476.716] -- 0:00:52
132500 -- (-477.086) (-476.789) (-474.989) [-474.838] * [-478.742] (-477.488) (-473.919) (-472.907) -- 0:00:52
133000 -- (-476.347) [-475.087] (-473.862) (-475.547) * (-474.341) (-477.380) (-473.888) [-476.809] -- 0:00:52
133500 -- (-477.452) (-473.609) [-474.337] (-473.055) * (-479.535) (-475.013) [-476.328] (-475.630) -- 0:00:51
134000 -- [-473.047] (-473.014) (-472.480) (-478.985) * (-477.990) (-476.620) [-472.903] (-473.645) -- 0:00:51
134500 -- [-474.495] (-472.640) (-473.229) (-473.894) * (-472.589) (-477.679) (-473.825) [-473.989] -- 0:00:51
135000 -- [-474.975] (-477.195) (-475.144) (-474.705) * (-474.387) (-474.240) [-474.839] (-472.561) -- 0:00:51
Average standard deviation of split frequencies: 0.017331
135500 -- (-480.425) (-473.781) (-472.884) [-473.194] * (-472.425) (-476.348) [-472.912] (-474.292) -- 0:00:51
136000 -- [-473.251] (-474.194) (-477.086) (-473.128) * (-472.767) (-476.055) [-473.157] (-474.067) -- 0:00:50
136500 -- [-474.215] (-475.413) (-473.301) (-475.837) * (-473.972) [-476.818] (-473.388) (-475.508) -- 0:00:50
137000 -- (-472.774) (-475.635) [-473.323] (-475.322) * (-472.694) (-474.927) [-473.810] (-476.532) -- 0:00:50
137500 -- (-473.930) [-474.049] (-474.407) (-475.715) * (-472.778) (-472.897) (-473.102) [-475.771] -- 0:00:50
138000 -- (-474.542) (-473.486) [-475.350] (-475.652) * [-474.643] (-472.669) (-473.421) (-473.600) -- 0:00:49
138500 -- (-474.306) (-473.732) [-473.135] (-473.640) * (-474.913) (-473.183) [-472.718] (-475.903) -- 0:00:49
139000 -- (-477.644) (-474.985) [-472.913] (-472.750) * (-474.621) (-473.618) (-476.209) [-474.168] -- 0:00:49
139500 -- [-473.399] (-472.282) (-473.084) (-474.582) * (-476.174) [-472.785] (-473.506) (-475.208) -- 0:00:49
140000 -- (-476.055) (-478.164) (-473.706) [-474.219] * (-474.699) (-473.583) (-476.505) [-475.268] -- 0:00:49
Average standard deviation of split frequencies: 0.017761
140500 -- (-475.942) (-473.900) [-473.661] (-473.419) * (-476.365) (-472.943) [-473.733] (-478.341) -- 0:00:48
141000 -- [-474.067] (-478.739) (-477.795) (-475.224) * (-475.370) (-476.105) [-473.602] (-477.866) -- 0:00:48
141500 -- (-474.739) (-472.699) [-475.640] (-477.181) * (-475.266) [-473.643] (-475.521) (-476.885) -- 0:00:48
142000 -- (-475.951) (-472.350) [-477.468] (-473.627) * (-475.166) (-475.642) (-477.014) [-474.034] -- 0:00:48
142500 -- (-473.649) (-474.979) (-474.015) [-475.973] * (-473.995) (-474.293) (-475.371) [-477.723] -- 0:00:48
143000 -- (-478.164) (-475.447) [-475.618] (-473.147) * (-475.650) (-478.061) (-475.579) [-475.904] -- 0:00:47
143500 -- (-478.443) [-476.723] (-472.722) (-473.417) * (-478.403) [-476.481] (-473.539) (-473.913) -- 0:00:53
144000 -- (-472.903) (-475.724) (-472.313) [-472.397] * (-479.386) (-473.888) [-473.316] (-473.889) -- 0:00:53
144500 -- [-474.896] (-479.420) (-472.721) (-473.535) * (-479.208) (-481.291) [-474.201] (-475.113) -- 0:00:53
145000 -- (-477.932) (-476.498) [-476.894] (-473.259) * (-475.805) (-475.687) [-474.337] (-475.295) -- 0:00:53
Average standard deviation of split frequencies: 0.016951
145500 -- (-480.599) [-472.486] (-475.454) (-472.486) * (-477.549) (-474.237) [-475.011] (-472.379) -- 0:00:52
146000 -- (-473.401) [-473.269] (-473.376) (-473.898) * (-474.078) [-472.906] (-473.759) (-475.031) -- 0:00:52
146500 -- [-473.633] (-474.015) (-473.616) (-473.355) * [-476.626] (-472.849) (-479.000) (-479.056) -- 0:00:52
147000 -- (-476.116) (-473.367) (-476.146) [-478.314] * (-473.090) (-473.874) [-476.991] (-473.473) -- 0:00:52
147500 -- (-473.964) (-473.318) [-476.350] (-474.126) * (-476.898) (-473.387) [-477.860] (-472.930) -- 0:00:52
148000 -- (-477.488) [-473.853] (-473.023) (-473.004) * [-474.077] (-473.282) (-475.225) (-473.822) -- 0:00:51
148500 -- (-476.273) (-473.155) (-474.971) [-472.688] * (-474.045) (-474.027) (-476.077) [-475.890] -- 0:00:51
149000 -- (-474.172) [-472.934] (-473.877) (-472.672) * [-476.801] (-474.525) (-475.489) (-473.886) -- 0:00:51
149500 -- (-477.161) (-473.601) [-474.891] (-475.472) * (-478.065) (-473.326) (-476.144) [-475.536] -- 0:00:51
150000 -- (-476.006) (-473.804) (-472.925) [-475.574] * (-476.783) (-473.567) [-474.151] (-477.081) -- 0:00:51
Average standard deviation of split frequencies: 0.017134
150500 -- [-474.839] (-472.338) (-474.191) (-473.802) * (-475.088) [-475.938] (-475.324) (-472.842) -- 0:00:50
151000 -- (-476.099) (-474.239) [-473.306] (-476.928) * (-473.838) (-476.135) (-474.573) [-473.874] -- 0:00:50
151500 -- (-476.822) (-474.492) [-473.997] (-476.649) * (-474.389) [-474.236] (-473.203) (-474.275) -- 0:00:50
152000 -- (-475.500) [-475.646] (-474.253) (-474.426) * (-475.738) [-473.040] (-475.096) (-473.273) -- 0:00:50
152500 -- [-473.329] (-472.623) (-472.618) (-476.561) * (-481.501) (-476.008) (-477.100) [-475.065] -- 0:00:50
153000 -- (-475.301) (-472.838) [-473.765] (-474.531) * (-474.871) [-472.799] (-472.994) (-475.083) -- 0:00:49
153500 -- (-479.070) [-472.318] (-475.113) (-478.982) * [-473.034] (-474.428) (-476.748) (-475.499) -- 0:00:49
154000 -- [-475.605] (-476.424) (-475.217) (-474.537) * [-475.368] (-477.881) (-475.604) (-473.695) -- 0:00:49
154500 -- (-475.592) (-474.180) [-474.293] (-474.025) * (-476.444) [-475.395] (-472.531) (-473.254) -- 0:00:49
155000 -- (-473.210) (-476.899) (-473.856) [-475.925] * [-473.926] (-475.106) (-474.392) (-476.321) -- 0:00:49
Average standard deviation of split frequencies: 0.016063
155500 -- [-476.598] (-474.695) (-473.863) (-475.571) * (-476.948) (-474.496) [-473.465] (-473.423) -- 0:00:48
156000 -- [-472.355] (-477.087) (-473.472) (-479.316) * (-475.262) [-474.097] (-474.759) (-476.992) -- 0:00:48
156500 -- [-474.636] (-477.351) (-472.872) (-479.461) * (-473.516) (-475.472) (-474.108) [-473.904] -- 0:00:48
157000 -- (-474.885) (-475.118) (-476.399) [-477.337] * (-476.472) [-474.838] (-475.267) (-473.945) -- 0:00:48
157500 -- (-475.005) (-473.577) (-475.401) [-475.697] * (-472.882) (-473.218) [-476.333] (-476.272) -- 0:00:48
158000 -- (-476.793) (-477.483) [-475.878] (-478.385) * (-475.838) [-475.083] (-474.949) (-478.973) -- 0:00:47
158500 -- (-476.628) (-477.833) [-474.168] (-473.482) * (-473.212) (-475.098) (-473.965) [-475.116] -- 0:00:47
159000 -- (-476.154) (-475.522) [-474.539] (-473.348) * [-473.287] (-473.384) (-476.536) (-474.071) -- 0:00:47
159500 -- [-477.225] (-473.260) (-474.316) (-475.523) * [-472.399] (-475.114) (-474.129) (-473.111) -- 0:00:47
160000 -- (-473.312) [-474.056] (-476.092) (-474.496) * (-472.932) (-475.065) [-474.647] (-473.151) -- 0:00:47
Average standard deviation of split frequencies: 0.016832
160500 -- (-476.821) (-474.550) (-474.801) [-476.743] * (-473.921) [-474.946] (-476.234) (-475.497) -- 0:00:52
161000 -- (-474.223) (-475.327) (-476.779) [-474.012] * (-473.952) (-474.668) (-480.521) [-474.165] -- 0:00:52
161500 -- [-476.095] (-473.819) (-473.587) (-473.590) * (-476.819) (-475.661) (-476.194) [-472.834] -- 0:00:51
162000 -- (-475.436) (-473.533) [-472.414] (-473.079) * (-480.466) [-473.864] (-472.539) (-472.943) -- 0:00:51
162500 -- (-476.022) (-475.093) [-475.472] (-480.291) * (-483.883) (-479.199) [-474.549] (-473.992) -- 0:00:51
163000 -- (-473.761) [-473.362] (-475.045) (-473.800) * (-475.362) (-473.851) (-476.817) [-473.495] -- 0:00:51
163500 -- [-475.935] (-473.541) (-476.704) (-473.092) * (-477.111) [-472.289] (-479.515) (-479.231) -- 0:00:51
164000 -- (-472.524) [-473.345] (-473.752) (-473.949) * (-473.656) (-477.731) (-475.928) [-475.500] -- 0:00:50
164500 -- (-473.344) [-476.285] (-475.271) (-474.102) * [-473.658] (-478.889) (-473.971) (-475.728) -- 0:00:50
165000 -- (-475.726) (-477.132) (-475.193) [-476.307] * (-473.478) (-473.955) [-474.479] (-474.532) -- 0:00:50
Average standard deviation of split frequencies: 0.014348
165500 -- (-482.203) [-473.766] (-474.439) (-473.946) * (-472.050) (-474.682) [-474.500] (-473.063) -- 0:00:50
166000 -- (-475.562) [-473.471] (-474.986) (-474.477) * (-473.555) (-474.392) (-474.875) [-474.728] -- 0:00:50
166500 -- (-475.733) [-474.543] (-476.763) (-475.129) * (-473.567) (-472.999) [-475.221] (-474.372) -- 0:00:50
167000 -- [-477.038] (-478.255) (-472.363) (-477.013) * [-474.424] (-473.850) (-476.848) (-473.491) -- 0:00:49
167500 -- (-473.748) [-474.976] (-473.485) (-474.599) * (-473.503) (-472.939) (-475.847) [-472.919] -- 0:00:49
168000 -- (-476.184) (-474.193) [-473.134] (-474.788) * [-473.281] (-472.352) (-475.203) (-474.030) -- 0:00:49
168500 -- (-472.372) [-473.359] (-474.926) (-474.714) * [-472.801] (-476.138) (-472.682) (-473.439) -- 0:00:49
169000 -- [-472.970] (-474.162) (-475.052) (-475.542) * [-476.280] (-477.719) (-474.608) (-473.106) -- 0:00:49
169500 -- [-473.215] (-474.178) (-473.846) (-477.885) * (-474.409) (-475.802) (-475.791) [-473.048] -- 0:00:48
170000 -- [-472.708] (-473.171) (-475.202) (-476.652) * (-472.949) (-477.601) (-477.712) [-472.742] -- 0:00:48
Average standard deviation of split frequencies: 0.014885
170500 -- (-476.354) (-475.683) [-475.517] (-473.963) * (-473.127) [-473.673] (-475.318) (-473.564) -- 0:00:48
171000 -- [-473.432] (-473.364) (-475.188) (-474.788) * (-477.167) (-473.574) (-473.317) [-473.195] -- 0:00:48
171500 -- (-473.165) (-473.681) (-474.092) [-474.871] * [-475.825] (-477.219) (-474.172) (-475.943) -- 0:00:48
172000 -- (-472.698) (-472.748) (-475.266) [-474.350] * (-476.850) (-474.297) (-472.694) [-473.521] -- 0:00:48
172500 -- (-480.049) (-473.180) (-475.650) [-475.483] * (-473.370) (-475.707) (-474.678) [-476.224] -- 0:00:47
173000 -- (-472.517) [-472.320] (-476.008) (-473.430) * (-473.306) [-478.021] (-476.785) (-473.836) -- 0:00:47
173500 -- (-475.101) (-476.269) (-475.936) [-476.963] * [-473.129] (-475.559) (-475.821) (-474.447) -- 0:00:47
174000 -- [-474.241] (-473.723) (-476.435) (-478.030) * (-472.985) [-474.198] (-474.536) (-473.723) -- 0:00:47
174500 -- [-472.499] (-481.724) (-475.740) (-474.850) * (-477.816) (-473.812) [-473.684] (-474.253) -- 0:00:47
175000 -- (-473.234) (-474.224) [-472.953] (-473.576) * (-474.731) (-477.299) (-475.291) [-472.546] -- 0:00:47
Average standard deviation of split frequencies: 0.013541
175500 -- (-474.760) (-473.618) [-475.051] (-472.618) * (-472.510) (-474.138) (-475.546) [-472.848] -- 0:00:46
176000 -- (-473.085) (-476.229) (-475.914) [-473.278] * (-476.333) (-476.561) (-481.173) [-475.051] -- 0:00:46
176500 -- [-472.234] (-477.918) (-474.463) (-474.045) * (-482.499) (-477.562) [-478.574] (-481.609) -- 0:00:46
177000 -- (-472.895) (-474.676) (-473.814) [-474.002] * (-474.297) (-473.884) [-475.786] (-476.695) -- 0:00:46
177500 -- [-472.816] (-478.756) (-477.089) (-475.564) * (-474.178) (-473.949) (-473.000) [-475.247] -- 0:00:50
178000 -- [-474.678] (-473.986) (-472.357) (-474.534) * (-472.545) (-473.557) [-472.452] (-472.914) -- 0:00:50
178500 -- (-473.682) (-474.859) [-473.916] (-476.056) * (-474.125) (-474.371) (-473.252) [-472.214] -- 0:00:50
179000 -- (-478.371) (-476.196) [-473.825] (-476.697) * (-473.731) [-476.103] (-477.512) (-476.585) -- 0:00:50
179500 -- (-475.216) (-475.056) (-476.367) [-476.917] * [-473.165] (-478.024) (-476.332) (-477.398) -- 0:00:50
180000 -- [-473.148] (-474.498) (-474.633) (-480.121) * (-476.677) (-475.738) [-474.099] (-472.549) -- 0:00:50
Average standard deviation of split frequencies: 0.013916
180500 -- [-473.156] (-472.409) (-476.313) (-473.694) * (-474.014) (-474.434) (-474.189) [-473.444] -- 0:00:49
181000 -- [-473.289] (-475.636) (-476.759) (-474.812) * (-474.976) (-473.280) [-476.674] (-472.962) -- 0:00:49
181500 -- (-472.871) [-477.904] (-474.978) (-476.442) * (-475.390) (-473.219) (-475.401) [-475.639] -- 0:00:49
182000 -- [-474.581] (-475.056) (-478.899) (-473.178) * (-473.833) (-472.534) [-473.994] (-472.930) -- 0:00:49
182500 -- [-473.024] (-476.435) (-478.274) (-482.798) * (-474.910) (-474.287) [-476.117] (-474.638) -- 0:00:49
183000 -- [-474.405] (-478.922) (-475.540) (-475.942) * (-472.583) (-472.249) [-473.882] (-476.682) -- 0:00:49
183500 -- (-478.036) [-474.982] (-473.531) (-480.023) * [-474.148] (-472.563) (-475.476) (-473.587) -- 0:00:48
184000 -- (-473.923) (-472.669) (-474.192) [-477.530] * (-475.632) (-472.402) (-478.124) [-474.140] -- 0:00:48
184500 -- (-475.096) [-473.727] (-475.037) (-479.826) * (-476.199) [-472.934] (-477.863) (-475.228) -- 0:00:48
185000 -- (-474.828) [-473.217] (-474.744) (-474.559) * (-474.805) [-473.224] (-482.226) (-473.769) -- 0:00:48
Average standard deviation of split frequencies: 0.014673
185500 -- (-473.142) (-473.984) [-474.890] (-475.320) * (-475.134) [-472.608] (-474.606) (-475.169) -- 0:00:48
186000 -- [-472.719] (-474.138) (-475.582) (-481.328) * (-472.686) [-475.514] (-474.532) (-476.394) -- 0:00:48
186500 -- [-477.094] (-476.526) (-475.725) (-473.154) * (-473.441) (-474.600) [-473.654] (-474.568) -- 0:00:47
187000 -- (-473.981) (-474.131) [-474.054] (-475.374) * [-472.483] (-474.085) (-476.315) (-476.850) -- 0:00:47
187500 -- (-475.518) [-476.238] (-473.486) (-473.811) * [-474.759] (-475.121) (-476.455) (-473.502) -- 0:00:47
188000 -- (-473.333) (-474.836) (-473.901) [-474.165] * (-473.792) (-475.904) (-473.853) [-473.826] -- 0:00:47
188500 -- (-474.601) [-474.512] (-474.720) (-473.014) * [-476.515] (-473.540) (-477.524) (-473.405) -- 0:00:47
189000 -- (-478.639) [-473.365] (-472.896) (-473.401) * (-474.791) (-475.820) (-474.336) [-474.032] -- 0:00:47
189500 -- (-474.677) (-475.471) (-474.311) [-473.228] * (-476.038) (-473.058) [-473.544] (-473.081) -- 0:00:47
190000 -- (-473.319) [-478.424] (-474.492) (-474.678) * (-474.833) [-475.471] (-475.668) (-473.590) -- 0:00:46
Average standard deviation of split frequencies: 0.014965
190500 -- (-473.335) (-473.553) [-474.478] (-475.244) * (-474.906) (-473.041) (-474.770) [-472.208] -- 0:00:46
191000 -- (-473.476) (-472.719) [-473.558] (-473.527) * (-475.080) (-476.402) [-478.000] (-473.471) -- 0:00:46
191500 -- (-473.957) [-473.723] (-475.234) (-474.772) * (-472.839) (-477.589) (-474.198) [-473.508] -- 0:00:46
192000 -- (-473.419) [-474.226] (-475.255) (-476.091) * [-475.536] (-477.065) (-473.989) (-476.136) -- 0:00:46
192500 -- (-474.555) (-473.690) (-475.913) [-473.265] * (-477.891) (-473.890) (-478.832) [-473.995] -- 0:00:46
193000 -- (-472.808) [-477.220] (-475.633) (-473.613) * [-475.101] (-473.551) (-472.356) (-479.386) -- 0:00:45
193500 -- (-472.660) (-474.154) (-476.822) [-474.063] * (-476.076) (-477.671) [-473.278] (-477.307) -- 0:00:45
194000 -- (-474.049) (-475.512) [-474.588] (-472.338) * (-473.567) (-474.642) [-473.197] (-475.171) -- 0:00:45
194500 -- (-472.873) (-474.616) [-473.093] (-473.926) * (-473.833) (-485.790) [-477.081] (-475.381) -- 0:00:45
195000 -- (-476.226) [-476.217] (-475.583) (-474.185) * (-475.406) [-476.258] (-474.393) (-477.124) -- 0:00:49
Average standard deviation of split frequencies: 0.015190
195500 -- [-474.405] (-473.980) (-472.521) (-476.322) * (-475.179) [-473.627] (-474.069) (-480.233) -- 0:00:49
196000 -- (-477.045) [-472.655] (-477.715) (-476.277) * (-474.389) [-473.791] (-473.889) (-476.606) -- 0:00:49
196500 -- (-475.807) [-474.899] (-475.959) (-473.765) * (-478.884) (-472.590) [-472.931] (-476.179) -- 0:00:49
197000 -- (-474.632) (-476.665) (-475.114) [-473.115] * (-473.248) [-473.784] (-473.508) (-474.687) -- 0:00:48
197500 -- (-476.282) [-473.122] (-477.126) (-472.520) * [-475.674] (-475.645) (-474.489) (-476.658) -- 0:00:48
198000 -- (-477.584) (-475.745) [-474.258] (-473.534) * (-474.866) (-473.974) (-472.993) [-474.540] -- 0:00:48
198500 -- (-473.541) (-476.165) [-475.004] (-475.958) * (-473.675) (-472.960) [-478.462] (-478.176) -- 0:00:48
199000 -- (-476.728) (-473.454) (-476.318) [-474.415] * (-475.368) (-472.806) [-477.375] (-476.038) -- 0:00:48
199500 -- [-473.047] (-475.572) (-477.285) (-474.913) * (-475.699) [-473.029] (-474.083) (-475.627) -- 0:00:48
200000 -- (-474.092) [-475.487] (-479.410) (-472.648) * (-473.256) (-475.846) (-474.920) [-479.563] -- 0:00:48
Average standard deviation of split frequencies: 0.014961
200500 -- (-473.568) (-476.473) [-474.048] (-473.747) * (-472.843) [-473.410] (-474.104) (-474.396) -- 0:00:47
201000 -- (-476.133) (-477.272) (-473.064) [-474.583] * (-476.043) (-474.708) (-475.967) [-473.713] -- 0:00:47
201500 -- (-472.607) (-475.621) [-474.494] (-474.939) * (-476.144) (-475.899) [-473.324] (-473.774) -- 0:00:47
202000 -- (-476.800) [-473.061] (-478.040) (-473.791) * [-477.592] (-474.710) (-472.979) (-475.419) -- 0:00:47
202500 -- (-475.937) (-474.409) (-477.211) [-473.745] * (-480.706) [-483.207] (-474.762) (-473.254) -- 0:00:47
203000 -- (-474.453) (-475.173) [-473.863] (-474.976) * (-480.481) (-477.283) [-473.564] (-479.551) -- 0:00:47
203500 -- (-476.668) (-474.930) [-473.227] (-475.977) * [-473.517] (-475.050) (-473.856) (-479.365) -- 0:00:46
204000 -- [-474.784] (-474.351) (-474.741) (-475.042) * (-477.363) [-475.331] (-474.007) (-473.574) -- 0:00:46
204500 -- (-473.188) (-474.705) (-475.441) [-476.024] * (-473.262) (-475.169) (-472.807) [-476.122] -- 0:00:46
205000 -- (-476.291) (-476.168) (-479.373) [-474.220] * (-473.239) (-482.181) [-473.165] (-472.834) -- 0:00:46
Average standard deviation of split frequencies: 0.015904
205500 -- (-476.972) [-476.271] (-473.814) (-477.434) * [-475.570] (-479.286) (-473.002) (-477.383) -- 0:00:46
206000 -- (-473.056) (-473.806) (-475.593) [-475.025] * (-475.605) (-481.760) (-472.365) [-473.768] -- 0:00:46
206500 -- (-476.189) (-474.128) (-476.778) [-474.497] * [-475.600] (-476.115) (-473.652) (-474.390) -- 0:00:46
207000 -- (-476.793) [-473.629] (-472.948) (-475.934) * (-473.443) (-474.699) [-473.866] (-473.658) -- 0:00:45
207500 -- (-473.387) (-473.707) [-473.928] (-475.487) * (-472.360) (-475.015) (-473.311) [-472.453] -- 0:00:45
208000 -- [-473.083] (-474.940) (-473.850) (-474.934) * (-475.776) (-475.674) [-473.042] (-474.950) -- 0:00:45
208500 -- [-474.158] (-475.353) (-480.251) (-474.296) * (-473.217) (-474.581) (-477.974) [-474.798] -- 0:00:45
209000 -- (-477.191) (-473.604) (-474.979) [-474.402] * [-477.338] (-472.506) (-474.361) (-474.460) -- 0:00:45
209500 -- (-477.468) (-474.291) [-474.884] (-473.464) * (-472.839) (-472.703) (-472.908) [-472.350] -- 0:00:45
210000 -- (-474.722) (-474.691) [-476.955] (-473.437) * [-475.887] (-473.572) (-473.463) (-473.852) -- 0:00:45
Average standard deviation of split frequencies: 0.015888
210500 -- (-476.520) (-473.627) [-473.238] (-473.391) * (-477.487) [-475.543] (-476.339) (-475.206) -- 0:00:45
211000 -- (-473.138) (-475.112) (-473.587) [-476.217] * (-473.177) (-476.205) (-474.730) [-475.254] -- 0:00:44
211500 -- (-474.388) (-474.808) (-475.786) [-472.920] * [-473.168] (-474.079) (-475.273) (-473.862) -- 0:00:48
212000 -- (-476.782) [-474.154] (-477.535) (-474.662) * [-475.060] (-475.283) (-475.371) (-473.579) -- 0:00:48
212500 -- (-473.289) (-473.608) [-475.970] (-474.638) * (-474.414) (-476.527) [-472.448] (-474.120) -- 0:00:48
213000 -- (-473.857) (-473.023) (-475.002) [-475.638] * (-477.128) (-472.667) [-474.665] (-474.251) -- 0:00:48
213500 -- (-473.074) (-474.153) [-478.125] (-473.103) * (-474.916) (-474.160) (-476.122) [-475.503] -- 0:00:47
214000 -- (-476.565) (-473.088) [-473.916] (-474.049) * (-473.754) [-475.301] (-474.633) (-473.444) -- 0:00:47
214500 -- (-476.357) (-474.741) [-474.422] (-473.587) * (-474.157) (-475.665) [-472.583] (-472.804) -- 0:00:47
215000 -- (-474.043) (-477.279) (-475.804) [-473.631] * (-475.253) (-472.442) [-476.920] (-472.474) -- 0:00:47
Average standard deviation of split frequencies: 0.017132
215500 -- (-474.223) (-474.695) [-477.060] (-477.155) * (-474.590) (-472.880) [-474.039] (-473.667) -- 0:00:47
216000 -- [-473.076] (-474.765) (-475.519) (-474.483) * (-474.668) [-472.962] (-474.110) (-472.734) -- 0:00:47
216500 -- (-476.456) [-475.975] (-473.660) (-475.648) * (-474.094) (-472.786) [-472.750] (-473.972) -- 0:00:47
217000 -- [-473.036] (-476.526) (-477.330) (-477.486) * (-473.336) (-478.810) [-473.186] (-474.479) -- 0:00:46
217500 -- (-478.245) (-476.829) [-474.423] (-475.150) * (-474.138) [-476.410] (-478.335) (-474.489) -- 0:00:46
218000 -- (-479.215) (-474.374) [-473.071] (-475.867) * (-473.096) (-475.009) [-474.384] (-473.535) -- 0:00:46
218500 -- (-480.338) (-475.328) [-473.723] (-474.571) * (-475.935) (-482.856) [-474.103] (-475.043) -- 0:00:46
219000 -- (-478.340) (-477.638) (-478.400) [-474.743] * (-473.563) [-479.032] (-473.258) (-474.169) -- 0:00:46
219500 -- [-475.385] (-473.800) (-473.771) (-474.752) * (-472.644) [-475.811] (-473.813) (-475.928) -- 0:00:46
220000 -- (-473.114) (-476.007) (-475.053) [-474.344] * (-475.427) (-473.123) [-474.273] (-475.836) -- 0:00:46
Average standard deviation of split frequencies: 0.016303
220500 -- (-475.298) (-476.207) [-473.599] (-473.851) * [-477.170] (-473.948) (-475.046) (-476.045) -- 0:00:45
221000 -- (-475.150) (-474.448) [-474.220] (-473.446) * (-478.646) (-475.588) (-477.306) [-472.438] -- 0:00:45
221500 -- (-476.339) [-474.384] (-473.244) (-473.519) * (-475.689) (-477.372) [-472.534] (-472.251) -- 0:00:45
222000 -- (-475.789) (-473.973) [-474.595] (-478.005) * [-474.143] (-474.223) (-479.902) (-475.011) -- 0:00:45
222500 -- (-478.371) (-475.218) (-472.900) [-474.659] * (-478.298) (-473.660) (-474.961) [-474.225] -- 0:00:45
223000 -- [-474.249] (-472.705) (-477.175) (-477.665) * (-475.589) (-474.915) [-475.133] (-474.119) -- 0:00:45
223500 -- (-475.315) (-479.911) [-475.799] (-473.497) * (-473.472) (-474.013) [-473.053] (-475.776) -- 0:00:45
224000 -- (-474.722) (-474.639) (-474.924) [-472.889] * (-473.644) (-479.117) [-479.230] (-475.075) -- 0:00:45
224500 -- (-473.879) [-473.396] (-475.042) (-475.700) * [-473.857] (-476.794) (-475.679) (-474.347) -- 0:00:44
225000 -- [-472.391] (-473.454) (-473.569) (-477.560) * (-474.779) [-474.009] (-472.846) (-475.039) -- 0:00:44
Average standard deviation of split frequencies: 0.015957
225500 -- (-476.343) (-477.531) [-473.462] (-479.726) * (-475.499) [-473.979] (-473.522) (-477.616) -- 0:00:44
226000 -- [-476.388] (-476.022) (-473.078) (-477.267) * [-473.059] (-473.842) (-475.913) (-473.657) -- 0:00:44
226500 -- [-476.050] (-476.196) (-476.171) (-473.716) * [-474.261] (-475.651) (-473.777) (-484.656) -- 0:00:44
227000 -- (-476.814) [-473.432] (-474.405) (-476.742) * (-476.133) (-476.855) [-475.505] (-476.081) -- 0:00:44
227500 -- (-473.693) (-473.084) (-473.908) [-473.388] * [-475.920] (-472.414) (-474.389) (-472.764) -- 0:00:44
228000 -- [-475.129] (-473.755) (-473.270) (-473.822) * (-475.691) (-475.905) (-473.172) [-473.819] -- 0:00:44
228500 -- (-474.352) (-474.894) (-472.856) [-472.896] * (-473.390) [-481.930] (-476.056) (-473.141) -- 0:00:47
229000 -- (-474.399) (-473.241) (-473.352) [-472.593] * (-472.772) (-483.623) (-474.531) [-476.175] -- 0:00:47
229500 -- (-473.156) (-472.729) [-474.458] (-476.700) * (-473.751) (-473.744) (-474.169) [-474.388] -- 0:00:47
230000 -- (-473.522) (-474.355) [-477.023] (-474.774) * (-473.860) (-474.545) [-475.178] (-475.266) -- 0:00:46
Average standard deviation of split frequencies: 0.017065
230500 -- (-473.805) (-472.993) [-479.278] (-481.275) * (-476.001) (-476.659) [-473.505] (-476.793) -- 0:00:46
231000 -- (-477.292) (-475.808) (-474.601) [-476.363] * (-475.373) (-472.901) [-479.753] (-475.078) -- 0:00:46
231500 -- [-472.472] (-475.623) (-474.067) (-476.053) * [-476.069] (-474.260) (-477.387) (-473.410) -- 0:00:46
232000 -- (-474.869) (-474.725) [-476.958] (-472.854) * (-472.990) (-474.527) (-476.854) [-476.722] -- 0:00:46
232500 -- (-475.283) (-474.753) (-475.895) [-474.632] * (-473.923) (-474.960) [-475.156] (-478.152) -- 0:00:46
233000 -- [-473.362] (-474.115) (-474.753) (-475.478) * [-476.250] (-472.576) (-475.752) (-475.537) -- 0:00:46
233500 -- [-473.001] (-475.583) (-478.269) (-474.036) * [-472.632] (-473.509) (-477.018) (-475.660) -- 0:00:45
234000 -- (-474.362) [-473.126] (-475.292) (-474.038) * (-476.092) [-472.897] (-473.253) (-473.198) -- 0:00:45
234500 -- (-473.826) (-474.190) (-474.797) [-473.580] * (-474.266) (-474.564) [-475.561] (-474.957) -- 0:00:45
235000 -- (-474.234) (-473.789) [-476.759] (-476.863) * (-476.646) (-472.617) [-475.502] (-475.660) -- 0:00:45
Average standard deviation of split frequencies: 0.017662
235500 -- (-478.313) (-475.289) [-473.317] (-473.473) * [-473.322] (-476.230) (-473.161) (-472.893) -- 0:00:45
236000 -- (-473.906) (-477.599) [-472.485] (-472.632) * (-474.250) (-472.730) [-473.740] (-474.588) -- 0:00:45
236500 -- (-473.709) [-472.578] (-476.287) (-474.627) * (-475.247) [-472.642] (-473.967) (-474.899) -- 0:00:45
237000 -- [-474.114] (-473.005) (-473.690) (-474.666) * (-473.774) [-473.444] (-474.809) (-473.947) -- 0:00:45
237500 -- (-473.079) [-473.738] (-473.098) (-472.997) * (-472.932) (-473.744) [-473.547] (-474.306) -- 0:00:44
238000 -- [-472.702] (-481.317) (-476.912) (-473.018) * (-473.560) (-472.629) (-474.196) [-473.346] -- 0:00:44
238500 -- [-472.500] (-477.402) (-473.258) (-474.984) * (-475.023) (-473.055) [-474.380] (-474.785) -- 0:00:44
239000 -- (-474.205) [-472.996] (-475.210) (-474.390) * (-473.120) (-475.777) (-473.423) [-473.087] -- 0:00:44
239500 -- (-475.792) (-475.086) [-475.933] (-473.389) * (-473.833) (-475.589) [-474.067] (-478.052) -- 0:00:44
240000 -- [-473.606] (-473.243) (-474.582) (-473.642) * (-485.498) (-475.545) (-474.356) [-476.348] -- 0:00:44
Average standard deviation of split frequencies: 0.017732
240500 -- (-475.561) (-473.292) [-475.288] (-474.936) * [-476.352] (-476.279) (-475.328) (-475.938) -- 0:00:44
241000 -- (-475.359) (-472.147) [-474.195] (-475.227) * (-480.299) (-473.804) (-476.560) [-477.077] -- 0:00:44
241500 -- (-473.467) (-473.972) [-473.618] (-474.547) * (-474.882) (-473.332) [-473.347] (-478.869) -- 0:00:43
242000 -- [-474.084] (-475.025) (-475.109) (-472.930) * [-476.626] (-473.052) (-473.924) (-475.663) -- 0:00:43
242500 -- [-474.286] (-474.351) (-473.125) (-475.763) * (-479.007) (-478.949) [-477.892] (-474.223) -- 0:00:43
243000 -- (-474.713) (-473.631) [-477.299] (-473.338) * (-474.283) (-476.277) (-478.288) [-472.850] -- 0:00:43
243500 -- (-474.434) [-476.054] (-478.894) (-472.820) * (-477.535) (-474.224) (-476.182) [-477.765] -- 0:00:43
244000 -- [-482.182] (-476.892) (-476.830) (-473.499) * (-472.400) (-474.772) [-473.867] (-473.982) -- 0:00:43
244500 -- (-474.690) (-474.482) (-476.992) [-475.656] * [-473.846] (-474.698) (-473.463) (-475.924) -- 0:00:43
245000 -- (-474.451) [-477.790] (-479.411) (-472.798) * (-476.469) (-473.407) [-474.140] (-478.891) -- 0:00:43
Average standard deviation of split frequencies: 0.016767
245500 -- (-472.748) (-480.187) [-475.591] (-472.559) * (-479.081) [-476.222] (-472.915) (-477.411) -- 0:00:46
246000 -- (-473.705) [-479.509] (-477.504) (-475.653) * (-475.184) (-477.303) [-476.321] (-477.058) -- 0:00:45
246500 -- (-476.452) (-474.855) [-474.999] (-473.457) * [-472.733] (-473.781) (-472.736) (-477.808) -- 0:00:45
247000 -- (-474.294) [-474.125] (-473.225) (-473.953) * [-474.810] (-472.964) (-474.062) (-473.490) -- 0:00:45
247500 -- [-473.146] (-474.622) (-475.040) (-472.998) * (-474.567) (-474.328) (-476.481) [-472.897] -- 0:00:45
248000 -- (-476.155) (-473.521) (-474.647) [-474.227] * (-473.506) (-475.395) [-474.332] (-473.173) -- 0:00:45
248500 -- (-480.027) (-474.108) [-474.872] (-472.875) * (-473.802) (-474.977) (-474.236) [-473.898] -- 0:00:45
249000 -- [-472.792] (-474.563) (-474.114) (-474.407) * (-473.877) [-475.384] (-472.306) (-474.810) -- 0:00:45
249500 -- [-472.844] (-474.722) (-475.607) (-479.201) * [-473.515] (-476.096) (-480.558) (-472.415) -- 0:00:45
250000 -- (-476.519) [-473.602] (-473.511) (-476.281) * [-473.875] (-473.107) (-473.782) (-474.812) -- 0:00:45
Average standard deviation of split frequencies: 0.015233
250500 -- (-479.975) (-481.658) (-477.453) [-474.176] * (-474.517) (-478.253) [-472.687] (-475.399) -- 0:00:44
251000 -- (-477.268) (-476.194) (-474.075) [-475.763] * [-472.991] (-475.846) (-472.576) (-475.603) -- 0:00:44
251500 -- (-479.733) (-475.386) (-474.419) [-475.523] * (-474.928) (-478.815) (-472.301) [-477.109] -- 0:00:44
252000 -- (-477.421) (-474.699) (-476.467) [-474.618] * (-475.501) (-473.609) (-472.941) [-473.392] -- 0:00:44
252500 -- (-475.095) (-474.708) (-474.865) [-477.353] * (-475.634) (-472.429) [-476.841] (-474.836) -- 0:00:44
253000 -- (-474.463) [-473.463] (-477.103) (-473.005) * [-474.823] (-473.618) (-476.990) (-473.571) -- 0:00:44
253500 -- (-475.185) [-475.307] (-473.535) (-474.779) * [-473.520] (-473.528) (-475.212) (-474.207) -- 0:00:44
254000 -- (-477.741) (-477.006) (-473.038) [-473.510] * (-473.407) (-474.952) [-473.331] (-475.987) -- 0:00:44
254500 -- [-474.260] (-472.713) (-475.325) (-473.564) * (-473.840) (-473.773) [-474.988] (-473.762) -- 0:00:43
255000 -- (-475.536) (-476.629) (-475.629) [-472.607] * (-475.063) [-474.363] (-478.120) (-472.869) -- 0:00:43
Average standard deviation of split frequencies: 0.016282
255500 -- (-476.703) (-477.275) (-476.551) [-472.755] * (-475.270) (-475.928) [-473.957] (-473.334) -- 0:00:43
256000 -- (-479.189) (-473.826) (-472.130) [-473.813] * (-473.056) [-473.505] (-475.727) (-476.116) -- 0:00:43
256500 -- (-473.671) (-473.025) [-472.087] (-474.710) * (-473.525) (-473.469) [-473.022] (-472.671) -- 0:00:43
257000 -- (-474.640) (-474.698) [-474.320] (-476.348) * (-476.627) [-474.814] (-474.008) (-474.991) -- 0:00:43
257500 -- (-475.327) (-477.000) [-472.584] (-472.737) * [-472.963] (-474.868) (-477.303) (-473.857) -- 0:00:43
258000 -- (-474.796) (-476.126) (-474.346) [-472.794] * (-474.199) (-478.657) [-478.101] (-475.047) -- 0:00:43
258500 -- (-476.329) (-479.154) [-476.221] (-474.652) * (-473.158) (-473.841) [-476.865] (-477.023) -- 0:00:43
259000 -- [-475.211] (-480.344) (-476.485) (-475.828) * (-475.518) (-475.484) [-475.362] (-473.731) -- 0:00:42
259500 -- [-474.290] (-481.099) (-475.487) (-475.157) * (-474.347) (-473.221) [-473.930] (-477.614) -- 0:00:42
260000 -- (-474.986) (-473.950) (-476.312) [-474.138] * (-476.048) [-472.892] (-476.806) (-474.681) -- 0:00:42
Average standard deviation of split frequencies: 0.015673
260500 -- (-476.043) (-474.208) [-473.226] (-473.098) * (-473.576) [-474.085] (-478.543) (-475.327) -- 0:00:42
261000 -- (-474.984) (-473.065) (-472.987) [-475.786] * (-474.608) (-475.552) (-476.620) [-476.080] -- 0:00:42
261500 -- (-473.630) [-475.159] (-473.525) (-477.611) * (-472.153) [-479.203] (-475.823) (-474.003) -- 0:00:42
262000 -- (-475.544) [-472.887] (-478.725) (-474.021) * (-472.154) (-473.633) [-472.908] (-479.124) -- 0:00:42
262500 -- [-472.777] (-475.013) (-473.373) (-474.408) * (-472.688) (-474.401) [-472.377] (-474.865) -- 0:00:44
263000 -- (-472.723) (-474.411) (-473.576) [-473.755] * (-472.872) (-475.049) [-473.461] (-473.614) -- 0:00:44
263500 -- (-473.364) (-475.780) [-472.309] (-473.129) * (-476.215) [-473.692] (-477.804) (-473.994) -- 0:00:44
264000 -- [-474.175] (-474.753) (-472.267) (-474.488) * (-473.863) (-472.876) [-472.802] (-476.147) -- 0:00:44
264500 -- [-475.081] (-474.651) (-475.099) (-476.845) * (-472.271) (-473.582) (-475.129) [-472.973] -- 0:00:44
265000 -- (-474.512) (-474.311) [-477.067] (-473.925) * [-473.270] (-476.961) (-474.905) (-474.435) -- 0:00:44
Average standard deviation of split frequencies: 0.016481
265500 -- [-472.822] (-474.850) (-474.177) (-472.846) * (-473.589) (-476.051) [-472.448] (-476.926) -- 0:00:44
266000 -- (-475.209) (-473.579) (-474.440) [-475.131] * (-473.192) (-473.370) (-473.670) [-474.041] -- 0:00:44
266500 -- [-474.109] (-475.871) (-476.816) (-475.690) * (-477.243) (-472.319) (-472.638) [-472.984] -- 0:00:44
267000 -- (-477.339) (-477.023) (-473.871) [-476.307] * (-476.215) (-472.730) (-473.006) [-473.507] -- 0:00:43
267500 -- (-477.512) (-477.169) (-474.982) [-472.366] * [-475.689] (-473.834) (-473.865) (-476.056) -- 0:00:43
268000 -- (-476.675) [-473.572] (-474.909) (-475.617) * [-474.734] (-475.750) (-477.732) (-475.501) -- 0:00:43
268500 -- (-477.098) (-477.206) (-475.007) [-473.197] * (-474.041) (-472.695) (-474.961) [-473.010] -- 0:00:43
269000 -- (-478.178) [-473.561] (-474.553) (-473.873) * (-474.618) (-472.865) [-474.278] (-473.758) -- 0:00:43
269500 -- (-475.865) [-476.351] (-477.400) (-475.805) * (-473.274) [-475.120] (-473.026) (-478.429) -- 0:00:43
270000 -- [-473.323] (-473.451) (-472.949) (-474.745) * (-476.226) (-475.581) (-475.282) [-473.566] -- 0:00:43
Average standard deviation of split frequencies: 0.015094
270500 -- (-477.829) [-473.041] (-473.554) (-475.725) * (-474.391) (-476.259) [-478.548] (-474.143) -- 0:00:43
271000 -- (-472.623) [-474.475] (-473.189) (-476.273) * (-477.370) [-475.020] (-476.332) (-473.111) -- 0:00:43
271500 -- (-474.648) [-476.178] (-474.684) (-473.811) * (-478.513) (-476.074) [-474.604] (-473.028) -- 0:00:42
272000 -- (-472.972) (-476.168) (-474.057) [-474.535] * (-480.110) [-475.440] (-475.305) (-474.685) -- 0:00:42
272500 -- (-474.800) [-474.670] (-474.689) (-472.747) * (-474.995) (-476.624) (-475.493) [-473.639] -- 0:00:42
273000 -- (-472.364) (-473.095) [-473.815] (-475.501) * [-476.404] (-473.308) (-474.901) (-475.453) -- 0:00:42
273500 -- (-473.158) (-473.514) (-473.971) [-474.141] * (-473.780) (-474.836) (-473.276) [-473.983] -- 0:00:42
274000 -- [-474.595] (-474.225) (-472.636) (-473.214) * [-475.478] (-475.857) (-474.752) (-472.644) -- 0:00:42
274500 -- (-474.033) (-474.901) (-474.494) [-474.343] * (-473.841) [-475.817] (-475.075) (-474.255) -- 0:00:42
275000 -- (-473.741) (-475.354) (-473.950) [-472.751] * (-473.712) [-475.865] (-474.268) (-474.338) -- 0:00:42
Average standard deviation of split frequencies: 0.014367
275500 -- (-475.589) [-473.510] (-478.081) (-473.145) * [-475.649] (-474.064) (-473.713) (-472.985) -- 0:00:42
276000 -- (-474.642) [-477.965] (-472.638) (-474.210) * (-474.797) [-478.364] (-473.720) (-475.053) -- 0:00:41
276500 -- [-473.194] (-474.494) (-473.515) (-473.233) * [-475.441] (-476.271) (-473.815) (-475.008) -- 0:00:41
277000 -- (-474.338) (-474.125) [-474.062] (-475.269) * (-477.314) (-477.412) [-473.281] (-474.335) -- 0:00:41
277500 -- [-472.819] (-473.566) (-476.247) (-473.308) * [-473.646] (-474.645) (-476.544) (-474.150) -- 0:00:41
278000 -- (-474.646) [-474.120] (-474.539) (-478.388) * (-474.848) (-476.278) (-477.280) [-473.346] -- 0:00:41
278500 -- (-474.945) (-475.340) (-476.949) [-474.704] * (-476.282) [-474.331] (-475.780) (-475.016) -- 0:00:41
279000 -- (-474.263) (-474.317) (-476.265) [-473.248] * [-475.846] (-475.819) (-474.159) (-473.102) -- 0:00:41
279500 -- (-474.953) (-473.377) [-475.778] (-473.492) * [-473.694] (-477.973) (-472.780) (-474.284) -- 0:00:43
280000 -- (-474.741) (-473.134) [-476.182] (-473.516) * (-472.981) [-473.224] (-472.573) (-478.611) -- 0:00:43
Average standard deviation of split frequencies: 0.014463
280500 -- (-477.506) (-472.939) [-474.770] (-473.052) * (-475.809) (-473.870) (-473.579) [-475.595] -- 0:00:43
281000 -- (-473.557) (-474.335) [-474.525] (-473.088) * (-477.751) [-474.504] (-473.626) (-477.051) -- 0:00:43
281500 -- [-473.026] (-474.209) (-477.587) (-474.987) * (-479.496) [-475.714] (-473.458) (-475.675) -- 0:00:43
282000 -- (-472.736) (-475.000) (-474.418) [-476.463] * (-477.306) (-473.113) [-476.854] (-475.219) -- 0:00:43
282500 -- (-473.748) (-473.425) (-472.579) [-475.177] * (-475.465) (-474.166) [-474.804] (-477.374) -- 0:00:43
283000 -- (-475.727) (-474.787) (-472.510) [-476.099] * [-473.801] (-477.836) (-478.079) (-476.063) -- 0:00:43
283500 -- (-473.411) [-473.262] (-477.706) (-474.057) * (-475.280) (-474.179) [-476.611] (-477.078) -- 0:00:42
284000 -- (-478.824) [-475.108] (-476.922) (-474.298) * (-473.720) (-477.423) (-473.311) [-475.140] -- 0:00:42
284500 -- (-477.829) [-473.932] (-472.805) (-474.051) * [-473.007] (-475.563) (-474.546) (-475.693) -- 0:00:42
285000 -- (-480.736) (-476.117) [-473.606] (-474.353) * [-472.664] (-477.935) (-474.284) (-475.836) -- 0:00:42
Average standard deviation of split frequencies: 0.014314
285500 -- (-475.559) (-476.410) (-475.397) [-474.359] * (-474.751) (-473.346) (-476.798) [-473.988] -- 0:00:42
286000 -- (-474.910) (-473.629) [-474.274] (-475.065) * (-472.729) (-475.012) (-473.316) [-475.244] -- 0:00:42
286500 -- (-472.787) (-473.581) [-473.951] (-475.206) * (-474.354) [-472.830] (-476.666) (-477.638) -- 0:00:42
287000 -- (-472.454) (-476.184) (-473.240) [-474.457] * [-475.397] (-474.213) (-472.733) (-473.799) -- 0:00:42
287500 -- (-473.945) (-472.752) (-477.515) [-473.849] * (-474.200) [-474.073] (-472.504) (-472.710) -- 0:00:42
288000 -- (-475.682) (-476.701) (-474.559) [-474.349] * (-474.045) (-474.687) [-474.149] (-474.234) -- 0:00:42
288500 -- [-475.308] (-476.688) (-475.202) (-473.871) * (-475.206) [-474.440] (-472.977) (-473.131) -- 0:00:41
289000 -- (-474.529) (-476.440) (-479.003) [-473.689] * (-474.682) (-475.671) (-473.504) [-474.271] -- 0:00:41
289500 -- (-476.862) (-474.058) (-473.540) [-474.189] * (-474.035) (-475.632) (-476.263) [-475.007] -- 0:00:41
290000 -- (-476.853) [-473.822] (-475.520) (-473.974) * (-473.424) [-475.569] (-476.170) (-477.354) -- 0:00:41
Average standard deviation of split frequencies: 0.013401
290500 -- (-472.682) [-475.799] (-478.502) (-473.161) * [-473.948] (-475.983) (-476.834) (-474.366) -- 0:00:41
291000 -- [-472.370] (-474.719) (-476.279) (-474.297) * (-473.465) (-474.163) (-477.343) [-473.641] -- 0:00:41
291500 -- (-478.034) (-474.386) (-476.124) [-474.094] * [-475.818] (-478.485) (-474.548) (-475.022) -- 0:00:41
292000 -- (-482.270) (-472.935) (-475.145) [-473.454] * (-475.442) (-473.982) (-474.685) [-475.615] -- 0:00:41
292500 -- (-472.998) [-474.876] (-475.582) (-476.175) * (-475.692) (-479.916) (-473.614) [-472.963] -- 0:00:41
293000 -- (-475.911) [-474.560] (-474.251) (-472.373) * (-474.411) (-474.608) [-475.019] (-474.891) -- 0:00:41
293500 -- (-476.691) (-472.206) (-476.150) [-475.061] * (-472.463) [-476.192] (-478.551) (-474.483) -- 0:00:40
294000 -- (-476.022) (-473.738) (-475.124) [-475.232] * (-473.912) (-473.453) (-476.838) [-475.299] -- 0:00:40
294500 -- (-475.594) (-473.618) [-476.481] (-473.291) * (-474.883) (-472.635) (-474.214) [-476.348] -- 0:00:40
295000 -- (-475.071) (-474.143) [-474.740] (-474.146) * [-473.226] (-474.062) (-475.109) (-475.823) -- 0:00:40
Average standard deviation of split frequencies: 0.012179
295500 -- (-479.279) [-474.049] (-475.160) (-476.513) * [-476.002] (-473.826) (-473.365) (-475.409) -- 0:00:40
296000 -- [-474.019] (-474.133) (-477.306) (-474.022) * (-475.528) (-473.713) [-472.782] (-474.197) -- 0:00:40
296500 -- (-474.249) (-480.837) (-474.036) [-473.934] * (-474.679) [-474.468] (-478.823) (-473.508) -- 0:00:42
297000 -- (-475.774) [-473.093] (-473.878) (-478.231) * (-473.047) (-474.390) (-473.138) [-476.364] -- 0:00:42
297500 -- [-473.863] (-473.663) (-472.713) (-478.580) * (-474.405) (-476.099) (-475.175) [-473.869] -- 0:00:42
298000 -- (-478.237) [-475.858] (-476.694) (-477.425) * [-477.697] (-475.225) (-476.067) (-473.445) -- 0:00:42
298500 -- (-475.827) [-474.167] (-475.729) (-473.264) * (-476.105) [-475.792] (-473.911) (-473.035) -- 0:00:42
299000 -- (-472.926) (-475.061) [-475.996] (-474.946) * [-474.490] (-474.359) (-475.484) (-473.107) -- 0:00:42
299500 -- (-474.889) (-476.222) (-473.234) [-475.006] * [-473.436] (-474.495) (-477.086) (-473.951) -- 0:00:42
300000 -- (-476.560) [-473.837] (-474.869) (-475.730) * [-473.844] (-474.053) (-473.763) (-475.210) -- 0:00:42
Average standard deviation of split frequencies: 0.012727
300500 -- (-484.386) (-475.245) (-473.915) [-476.240] * [-473.357] (-473.834) (-475.568) (-473.380) -- 0:00:41
301000 -- [-481.529] (-474.619) (-475.854) (-480.294) * (-473.488) [-473.682] (-474.334) (-476.990) -- 0:00:41
301500 -- (-477.294) (-473.792) (-474.302) [-473.514] * (-474.971) (-472.710) [-472.303] (-476.380) -- 0:00:41
302000 -- [-475.888] (-475.783) (-475.080) (-476.904) * (-475.469) [-472.853] (-473.530) (-473.692) -- 0:00:41
302500 -- (-474.673) (-475.499) (-477.948) [-473.505] * (-475.483) [-473.453] (-473.099) (-476.428) -- 0:00:41
303000 -- (-475.338) (-476.281) (-474.218) [-474.599] * (-478.634) [-475.793] (-472.467) (-475.122) -- 0:00:41
303500 -- (-472.269) (-473.775) [-472.187] (-473.416) * (-475.300) (-472.604) [-474.076] (-473.496) -- 0:00:41
304000 -- (-474.536) (-478.819) (-474.436) [-473.105] * (-473.422) (-475.450) (-476.108) [-474.129] -- 0:00:41
304500 -- (-475.994) [-473.223] (-479.612) (-474.216) * (-473.340) (-474.963) (-479.420) [-474.139] -- 0:00:41
305000 -- (-474.354) [-473.190] (-472.229) (-473.149) * (-474.983) (-477.694) [-474.834] (-475.413) -- 0:00:41
Average standard deviation of split frequencies: 0.012752
305500 -- [-474.783] (-475.366) (-477.128) (-478.263) * [-473.879] (-473.475) (-474.089) (-478.592) -- 0:00:40
306000 -- (-475.818) (-474.173) (-474.235) [-474.367] * [-475.714] (-472.375) (-476.203) (-475.503) -- 0:00:40
306500 -- (-474.202) [-473.641] (-472.903) (-474.631) * (-474.616) (-473.589) [-475.545] (-476.814) -- 0:00:40
307000 -- (-474.919) (-472.895) (-477.834) [-473.762] * (-475.587) [-474.087] (-473.850) (-477.950) -- 0:00:40
307500 -- (-474.894) [-475.492] (-474.135) (-472.694) * [-477.318] (-473.977) (-473.611) (-477.118) -- 0:00:40
308000 -- (-473.695) (-474.891) [-474.825] (-473.606) * [-474.140] (-474.055) (-473.433) (-478.249) -- 0:00:40
308500 -- [-473.754] (-477.370) (-474.267) (-473.927) * (-477.862) (-472.759) (-474.960) [-476.257] -- 0:00:40
309000 -- (-475.373) (-476.055) (-474.456) [-473.312] * (-475.118) (-477.804) (-474.419) [-474.005] -- 0:00:40
309500 -- (-474.937) (-477.675) [-475.135] (-473.998) * (-478.790) (-474.521) (-473.774) [-473.588] -- 0:00:40
310000 -- (-474.410) (-475.419) [-473.669] (-473.439) * [-477.192] (-474.103) (-475.273) (-473.503) -- 0:00:40
Average standard deviation of split frequencies: 0.013182
310500 -- (-474.189) (-476.239) [-472.978] (-472.880) * (-473.777) (-473.959) [-473.620] (-475.015) -- 0:00:39
311000 -- (-473.401) (-477.262) (-473.423) [-472.753] * (-473.432) (-477.426) [-476.306] (-473.274) -- 0:00:39
311500 -- (-474.634) (-476.473) (-475.915) [-472.584] * [-474.645] (-476.091) (-476.413) (-474.661) -- 0:00:39
312000 -- [-473.909] (-482.813) (-473.795) (-474.434) * (-475.843) (-473.439) (-473.881) [-472.410] -- 0:00:39
312500 -- [-473.324] (-476.689) (-473.872) (-474.675) * (-476.032) (-472.458) (-474.372) [-474.768] -- 0:00:39
313000 -- (-472.887) (-474.758) (-474.453) [-475.666] * (-475.393) [-472.769] (-474.286) (-472.834) -- 0:00:39
313500 -- [-474.909] (-474.315) (-477.379) (-475.664) * (-479.964) (-472.916) [-478.817] (-473.732) -- 0:00:41
314000 -- (-473.292) (-473.169) [-477.001] (-474.515) * (-475.398) (-474.458) [-476.889] (-473.589) -- 0:00:41
314500 -- [-473.703] (-472.667) (-475.439) (-473.634) * (-475.252) (-473.687) [-475.067] (-476.586) -- 0:00:41
315000 -- [-474.514] (-476.589) (-475.334) (-472.571) * (-473.734) (-474.918) (-473.263) [-474.253] -- 0:00:41
Average standard deviation of split frequencies: 0.012867
315500 -- (-478.719) [-474.501] (-475.843) (-477.568) * (-476.896) (-475.029) [-478.171] (-473.960) -- 0:00:41
316000 -- (-477.851) [-473.443] (-473.750) (-474.097) * (-475.539) [-475.023] (-473.168) (-477.054) -- 0:00:41
316500 -- (-476.701) (-476.842) [-473.946] (-476.977) * (-473.548) (-475.393) [-474.384] (-474.032) -- 0:00:41
317000 -- (-476.796) [-475.023] (-479.265) (-473.577) * (-474.148) (-473.324) (-474.043) [-474.072] -- 0:00:40
317500 -- [-474.493] (-472.805) (-474.962) (-474.604) * (-473.883) (-473.741) (-473.185) [-473.276] -- 0:00:40
318000 -- (-472.932) [-473.564] (-476.017) (-475.855) * (-475.943) (-474.287) [-474.482] (-475.712) -- 0:00:40
318500 -- [-473.924] (-478.438) (-473.671) (-473.412) * (-473.552) (-474.587) [-473.102] (-473.974) -- 0:00:40
319000 -- (-473.015) (-476.149) [-476.345] (-473.188) * (-472.468) (-475.479) (-473.862) [-475.725] -- 0:00:40
319500 -- [-473.952] (-477.271) (-475.349) (-472.992) * (-473.099) (-473.636) [-474.867] (-472.923) -- 0:00:40
320000 -- [-472.747] (-474.392) (-473.960) (-475.514) * (-474.865) (-475.197) [-473.812] (-475.045) -- 0:00:40
Average standard deviation of split frequencies: 0.012404
320500 -- (-472.570) (-475.116) (-472.776) [-474.169] * (-474.863) (-472.805) (-473.781) [-474.367] -- 0:00:40
321000 -- [-472.828] (-476.457) (-473.286) (-474.278) * (-472.939) [-472.550] (-473.614) (-475.087) -- 0:00:40
321500 -- [-475.603] (-478.613) (-474.381) (-478.434) * [-474.851] (-473.103) (-474.608) (-473.786) -- 0:00:40
322000 -- [-474.195] (-475.464) (-479.252) (-475.599) * (-473.480) (-479.357) (-474.836) [-472.645] -- 0:00:40
322500 -- (-473.667) (-477.249) [-475.057] (-478.968) * [-472.719] (-478.359) (-474.714) (-473.552) -- 0:00:39
323000 -- (-476.019) (-475.705) (-474.258) [-478.209] * (-475.134) [-472.514] (-473.651) (-475.802) -- 0:00:39
323500 -- (-473.439) [-474.066] (-477.594) (-478.248) * (-473.286) (-474.999) [-475.749] (-475.244) -- 0:00:39
324000 -- (-474.147) (-473.736) [-475.491] (-477.670) * (-473.203) [-474.152] (-475.637) (-478.300) -- 0:00:39
324500 -- (-478.340) [-474.840] (-472.287) (-473.895) * [-473.268] (-472.728) (-473.679) (-475.304) -- 0:00:39
325000 -- (-473.012) [-473.421] (-476.806) (-475.369) * (-478.610) (-474.100) (-472.943) [-474.409] -- 0:00:39
Average standard deviation of split frequencies: 0.012079
325500 -- [-473.241] (-475.096) (-475.402) (-474.755) * [-474.804] (-474.817) (-473.501) (-474.767) -- 0:00:39
326000 -- [-475.995] (-472.696) (-477.165) (-473.103) * [-473.516] (-472.734) (-473.453) (-472.948) -- 0:00:39
326500 -- (-475.397) [-477.787] (-474.507) (-473.856) * [-475.193] (-475.696) (-474.500) (-473.957) -- 0:00:39
327000 -- (-473.678) (-475.064) (-473.668) [-474.977] * (-474.210) [-473.292] (-474.016) (-477.889) -- 0:00:39
327500 -- (-475.115) (-475.668) [-474.317] (-474.859) * (-473.311) [-474.270] (-477.531) (-479.117) -- 0:00:39
328000 -- [-474.952] (-474.919) (-474.090) (-475.882) * (-475.160) (-473.475) (-478.583) [-476.320] -- 0:00:38
328500 -- [-473.072] (-475.381) (-474.066) (-473.909) * (-474.081) [-474.069] (-474.846) (-475.577) -- 0:00:38
329000 -- (-475.483) [-474.545] (-479.054) (-474.657) * (-473.486) [-474.961] (-472.663) (-473.397) -- 0:00:38
329500 -- [-473.811] (-473.463) (-472.661) (-475.870) * [-475.736] (-475.233) (-473.263) (-474.340) -- 0:00:38
330000 -- [-473.300] (-473.807) (-474.027) (-476.981) * (-475.832) [-474.646] (-478.094) (-478.806) -- 0:00:38
Average standard deviation of split frequencies: 0.013166
330500 -- (-475.300) (-473.888) (-473.330) [-474.013] * [-477.559] (-473.802) (-474.959) (-474.358) -- 0:00:40
331000 -- (-475.920) (-475.163) (-476.915) [-474.196] * (-475.685) (-477.123) (-473.899) [-475.785] -- 0:00:40
331500 -- (-473.933) [-473.710] (-472.857) (-476.689) * (-473.152) (-473.838) (-474.658) [-476.057] -- 0:00:40
332000 -- (-475.924) (-473.539) [-473.112] (-474.093) * [-473.410] (-475.928) (-477.433) (-475.243) -- 0:00:40
332500 -- [-475.298] (-472.718) (-474.211) (-473.694) * (-474.337) (-476.365) (-475.658) [-473.251] -- 0:00:40
333000 -- [-474.026] (-475.383) (-475.706) (-474.460) * (-475.372) (-474.241) (-477.500) [-472.907] -- 0:00:40
333500 -- (-473.776) (-477.379) (-476.958) [-474.328] * (-475.505) (-474.496) (-475.283) [-472.971] -- 0:00:39
334000 -- [-473.327] (-475.307) (-473.410) (-474.291) * (-475.737) (-473.638) [-473.165] (-473.960) -- 0:00:39
334500 -- [-473.792] (-475.660) (-474.486) (-476.257) * (-472.964) [-474.995] (-473.118) (-476.358) -- 0:00:39
335000 -- (-473.025) (-477.284) (-475.193) [-473.940] * [-475.432] (-476.509) (-472.747) (-473.260) -- 0:00:39
Average standard deviation of split frequencies: 0.011967
335500 -- (-475.163) (-474.492) [-474.068] (-475.166) * (-475.446) (-475.506) (-475.162) [-472.526] -- 0:00:39
336000 -- (-477.364) (-472.237) (-473.537) [-472.301] * (-476.932) (-473.464) (-473.006) [-476.217] -- 0:00:39
336500 -- (-475.430) [-473.518] (-473.633) (-477.324) * (-473.648) (-475.872) [-474.450] (-475.392) -- 0:00:39
337000 -- (-473.851) [-476.210] (-475.204) (-473.148) * (-474.720) (-473.418) (-474.698) [-472.850] -- 0:00:39
337500 -- (-474.273) (-473.860) (-473.016) [-474.926] * (-472.890) (-473.234) [-473.354] (-475.675) -- 0:00:39
338000 -- (-473.543) (-473.255) (-475.822) [-473.186] * (-477.113) [-473.427] (-475.454) (-474.630) -- 0:00:39
338500 -- (-473.844) (-473.448) [-473.618] (-474.294) * (-474.175) (-478.811) [-472.746] (-473.268) -- 0:00:39
339000 -- (-474.213) (-474.284) (-478.151) [-474.693] * [-472.769] (-476.601) (-475.628) (-474.257) -- 0:00:38
339500 -- (-476.234) [-472.614] (-475.576) (-475.339) * [-473.802] (-476.453) (-472.822) (-478.078) -- 0:00:38
340000 -- (-477.846) (-473.045) (-474.835) [-474.227] * (-473.257) (-476.772) [-474.604] (-474.223) -- 0:00:38
Average standard deviation of split frequencies: 0.011157
340500 -- (-476.861) (-472.398) [-473.446] (-477.292) * (-472.349) [-473.453] (-474.452) (-475.073) -- 0:00:38
341000 -- (-474.951) [-476.071] (-474.290) (-473.921) * (-481.363) (-475.101) [-474.303] (-476.531) -- 0:00:38
341500 -- (-476.907) [-476.339] (-472.980) (-475.138) * (-478.931) (-475.612) (-472.590) [-473.345] -- 0:00:38
342000 -- (-476.449) (-476.027) (-472.770) [-473.948] * [-473.426] (-478.021) (-474.893) (-477.342) -- 0:00:38
342500 -- (-474.619) (-472.942) (-475.003) [-474.715] * (-473.708) (-472.634) (-476.181) [-475.292] -- 0:00:38
343000 -- (-473.271) (-472.823) [-474.640] (-474.424) * (-474.331) (-479.283) [-474.636] (-475.269) -- 0:00:38
343500 -- [-474.689] (-474.082) (-478.046) (-474.088) * [-473.304] (-481.268) (-474.214) (-473.418) -- 0:00:38
344000 -- (-475.185) [-472.942] (-474.767) (-479.582) * [-472.548] (-475.910) (-475.889) (-476.970) -- 0:00:38
344500 -- (-476.080) (-476.680) (-474.994) [-474.217] * [-473.772] (-474.370) (-475.018) (-473.346) -- 0:00:38
345000 -- (-474.106) (-473.299) [-474.983] (-473.503) * (-474.614) [-477.164] (-473.654) (-474.715) -- 0:00:37
Average standard deviation of split frequencies: 0.010419
345500 -- (-473.074) [-472.660] (-473.629) (-476.585) * (-475.928) [-476.662] (-472.346) (-478.167) -- 0:00:37
346000 -- (-473.090) (-475.360) (-475.460) [-474.690] * (-474.843) (-474.106) (-472.576) [-475.155] -- 0:00:37
346500 -- (-477.649) (-473.896) (-478.792) [-473.602] * (-475.608) (-474.957) (-475.233) [-475.341] -- 0:00:37
347000 -- (-475.593) (-481.958) (-477.257) [-474.722] * [-474.952] (-472.628) (-474.327) (-476.127) -- 0:00:37
347500 -- (-475.323) (-473.636) (-473.840) [-473.478] * (-474.246) (-474.262) [-474.123] (-475.166) -- 0:00:39
348000 -- (-475.839) (-473.743) (-472.827) [-472.602] * (-476.374) [-473.033] (-472.659) (-475.853) -- 0:00:39
348500 -- (-472.577) [-473.839] (-473.151) (-472.641) * (-475.232) [-473.622] (-473.915) (-476.144) -- 0:00:39
349000 -- (-475.385) (-478.662) (-473.975) [-475.928] * (-472.928) (-473.132) [-476.529] (-476.341) -- 0:00:39
349500 -- (-472.742) (-474.936) (-474.888) [-472.580] * (-472.377) (-476.096) (-473.586) [-473.712] -- 0:00:39
350000 -- (-473.236) [-473.561] (-476.748) (-473.750) * [-474.645] (-474.823) (-473.622) (-475.052) -- 0:00:39
Average standard deviation of split frequencies: 0.009964
350500 -- (-473.596) [-473.814] (-475.299) (-473.080) * (-473.716) [-475.831] (-479.123) (-475.459) -- 0:00:38
351000 -- (-474.052) (-475.475) [-475.369] (-474.773) * (-475.536) (-476.842) (-473.074) [-473.380] -- 0:00:38
351500 -- (-473.826) [-476.043] (-474.254) (-477.005) * (-480.180) (-475.100) [-473.372] (-477.316) -- 0:00:38
352000 -- [-475.778] (-474.136) (-477.522) (-474.102) * (-478.557) (-474.422) [-473.529] (-476.506) -- 0:00:38
352500 -- (-474.761) [-475.332] (-477.093) (-472.592) * [-473.866] (-472.859) (-474.301) (-473.645) -- 0:00:38
353000 -- [-474.401] (-472.890) (-472.723) (-473.857) * (-473.812) [-474.120] (-476.721) (-475.427) -- 0:00:38
353500 -- (-472.926) (-478.171) [-473.018] (-472.537) * (-477.080) (-473.388) [-475.266] (-476.709) -- 0:00:38
354000 -- (-472.224) (-477.242) (-475.527) [-474.743] * (-472.946) (-475.417) (-480.768) [-476.830] -- 0:00:38
354500 -- (-475.270) (-473.962) (-472.434) [-474.327] * (-476.434) (-477.041) (-475.405) [-474.913] -- 0:00:38
355000 -- (-477.079) (-475.163) [-472.427] (-473.784) * (-478.861) [-477.335] (-477.187) (-474.435) -- 0:00:38
Average standard deviation of split frequencies: 0.008524
355500 -- (-472.504) (-475.535) [-472.977] (-473.595) * (-475.200) (-474.542) (-475.682) [-473.590] -- 0:00:38
356000 -- (-473.691) [-472.933] (-474.522) (-473.393) * (-474.718) (-475.577) (-476.781) [-472.944] -- 0:00:37
356500 -- (-473.741) (-473.687) [-474.125] (-474.801) * [-476.898] (-478.371) (-474.854) (-474.253) -- 0:00:37
357000 -- [-473.234] (-473.319) (-472.933) (-473.648) * (-476.133) (-473.682) (-477.477) [-477.154] -- 0:00:37
357500 -- (-473.755) (-473.264) [-476.128] (-473.222) * (-473.549) [-475.316] (-472.977) (-475.667) -- 0:00:37
358000 -- [-473.881] (-474.500) (-473.484) (-472.744) * [-474.526] (-474.435) (-473.805) (-475.061) -- 0:00:37
358500 -- (-475.352) (-475.167) [-474.966] (-472.846) * [-474.100] (-476.589) (-474.701) (-476.903) -- 0:00:37
359000 -- (-476.974) (-477.053) (-474.795) [-472.684] * (-474.436) [-473.198] (-476.027) (-472.796) -- 0:00:37
359500 -- (-476.135) (-477.214) (-476.454) [-474.587] * [-475.285] (-474.152) (-473.897) (-472.988) -- 0:00:37
360000 -- (-477.290) (-478.357) (-475.061) [-472.889] * (-472.858) [-475.937] (-473.670) (-474.591) -- 0:00:37
Average standard deviation of split frequencies: 0.007842
360500 -- [-473.466] (-474.884) (-475.355) (-474.246) * (-475.201) (-474.341) (-474.251) [-474.110] -- 0:00:37
361000 -- (-474.601) (-474.403) (-476.286) [-473.346] * (-476.372) (-474.900) (-477.013) [-475.319] -- 0:00:37
361500 -- (-475.218) (-476.224) (-480.226) [-473.122] * (-474.414) (-472.462) [-477.375] (-478.035) -- 0:00:37
362000 -- (-473.170) (-472.759) [-474.331] (-472.715) * (-477.182) (-472.618) [-473.466] (-473.419) -- 0:00:37
362500 -- (-474.608) (-477.932) [-473.872] (-476.434) * (-475.035) [-474.299] (-473.254) (-474.396) -- 0:00:36
363000 -- [-472.267] (-475.060) (-477.573) (-477.322) * [-473.949] (-477.441) (-473.282) (-474.326) -- 0:00:36
363500 -- (-475.680) (-473.892) (-474.722) [-475.422] * (-472.653) (-472.963) [-474.335] (-475.220) -- 0:00:36
364000 -- (-477.899) (-473.880) (-473.255) [-473.214] * (-474.299) (-474.337) [-475.545] (-475.461) -- 0:00:36
364500 -- (-473.628) (-476.050) [-473.744] (-474.857) * [-476.942] (-473.099) (-475.584) (-475.100) -- 0:00:38
365000 -- (-474.040) [-473.986] (-476.665) (-474.584) * (-472.255) (-473.342) (-478.324) [-474.660] -- 0:00:38
Average standard deviation of split frequencies: 0.010161
365500 -- (-473.638) (-474.508) [-475.359] (-477.437) * [-473.598] (-473.024) (-476.259) (-476.766) -- 0:00:38
366000 -- (-474.872) (-475.160) [-474.100] (-474.799) * (-472.612) [-476.415] (-474.075) (-480.263) -- 0:00:38
366500 -- [-473.647] (-478.862) (-474.480) (-474.342) * (-472.714) (-475.656) (-472.730) [-477.841] -- 0:00:38
367000 -- [-478.542] (-474.170) (-480.241) (-474.598) * (-481.600) (-472.574) (-472.744) [-473.561] -- 0:00:37
367500 -- (-475.121) (-473.862) [-472.808] (-476.199) * [-473.481] (-478.261) (-475.458) (-474.159) -- 0:00:37
368000 -- (-474.240) [-473.413] (-473.145) (-474.571) * [-474.099] (-477.316) (-476.575) (-472.387) -- 0:00:37
368500 -- [-472.848] (-476.087) (-474.036) (-474.678) * (-472.949) (-475.549) (-472.528) [-474.348] -- 0:00:37
369000 -- [-474.090] (-473.229) (-474.699) (-474.731) * [-476.975] (-475.325) (-473.770) (-474.724) -- 0:00:37
369500 -- (-475.380) (-473.203) (-476.401) [-473.522] * [-473.311] (-480.913) (-474.379) (-473.719) -- 0:00:37
370000 -- [-474.124] (-473.206) (-476.408) (-473.602) * (-475.134) (-475.127) (-472.991) [-473.796] -- 0:00:37
Average standard deviation of split frequencies: 0.009202
370500 -- (-473.890) (-475.146) [-473.756] (-472.497) * (-476.781) [-475.055] (-473.454) (-473.530) -- 0:00:37
371000 -- (-473.193) (-478.481) [-473.823] (-473.509) * (-476.399) [-474.944] (-475.543) (-477.218) -- 0:00:37
371500 -- (-473.955) [-474.456] (-475.816) (-473.413) * (-480.446) [-472.938] (-475.475) (-475.810) -- 0:00:37
372000 -- [-472.366] (-474.213) (-473.605) (-473.855) * [-475.784] (-474.211) (-478.190) (-473.923) -- 0:00:37
372500 -- (-474.557) (-473.035) [-473.735] (-474.941) * (-475.368) (-472.538) (-478.539) [-472.523] -- 0:00:37
373000 -- [-474.749] (-472.551) (-476.056) (-474.752) * [-474.311] (-477.883) (-475.851) (-472.328) -- 0:00:36
373500 -- (-472.641) (-473.273) [-474.602] (-474.146) * [-474.610] (-475.097) (-477.514) (-478.201) -- 0:00:36
374000 -- (-475.880) (-473.586) [-474.667] (-474.228) * (-475.069) (-475.097) [-475.503] (-481.916) -- 0:00:36
374500 -- (-472.989) [-473.491] (-474.746) (-473.748) * [-473.112] (-475.047) (-477.380) (-475.984) -- 0:00:36
375000 -- [-473.748] (-475.990) (-473.678) (-474.593) * [-477.595] (-474.353) (-472.569) (-473.774) -- 0:00:36
Average standard deviation of split frequencies: 0.009661
375500 -- [-477.315] (-473.411) (-478.649) (-474.204) * (-473.135) (-476.176) (-472.339) [-476.211] -- 0:00:36
376000 -- (-475.982) (-477.738) [-474.999] (-473.347) * [-475.014] (-473.125) (-476.557) (-475.193) -- 0:00:36
376500 -- [-474.169] (-474.529) (-473.739) (-476.523) * (-472.613) (-473.325) (-475.749) [-473.012] -- 0:00:36
377000 -- [-477.062] (-476.340) (-474.171) (-473.924) * (-474.566) [-476.174] (-472.720) (-474.100) -- 0:00:36
377500 -- (-479.121) (-475.785) (-473.048) [-474.316] * [-473.932] (-474.789) (-473.246) (-475.014) -- 0:00:36
378000 -- (-476.901) (-473.394) [-473.298] (-472.368) * (-485.346) (-472.906) (-472.916) [-474.013] -- 0:00:36
378500 -- (-477.523) [-472.309] (-475.141) (-473.026) * (-473.023) [-472.851] (-472.847) (-475.497) -- 0:00:36
379000 -- (-474.478) (-472.975) [-478.179] (-472.537) * (-474.709) (-473.766) [-473.645] (-475.778) -- 0:00:36
379500 -- (-475.197) (-472.664) (-476.411) [-472.491] * [-472.670] (-474.484) (-473.424) (-479.179) -- 0:00:35
380000 -- (-475.031) [-473.742] (-474.209) (-475.383) * (-474.837) [-480.042] (-475.322) (-476.304) -- 0:00:35
Average standard deviation of split frequencies: 0.009752
380500 -- (-473.168) (-472.961) (-473.687) [-474.472] * [-473.320] (-476.505) (-479.460) (-472.533) -- 0:00:37
381000 -- (-473.516) (-474.064) (-476.084) [-472.857] * [-472.913] (-473.245) (-472.909) (-474.733) -- 0:00:37
381500 -- [-477.179] (-473.242) (-473.002) (-474.361) * (-474.376) [-473.546] (-473.996) (-474.081) -- 0:00:37
382000 -- (-480.666) (-474.609) [-474.084] (-473.393) * (-474.700) (-473.098) (-476.596) [-474.824] -- 0:00:37
382500 -- (-475.471) (-474.344) (-475.370) [-474.435] * (-474.874) (-475.778) [-475.519] (-472.849) -- 0:00:37
383000 -- [-478.032] (-475.556) (-480.028) (-474.718) * [-478.711] (-474.971) (-472.937) (-478.470) -- 0:00:37
383500 -- (-476.232) [-472.981] (-475.281) (-473.134) * (-477.290) [-475.469] (-476.877) (-476.287) -- 0:00:36
384000 -- (-474.318) (-477.354) (-473.820) [-477.080] * (-472.753) (-476.715) (-475.325) [-474.886] -- 0:00:36
384500 -- [-475.462] (-482.921) (-473.822) (-472.976) * [-473.130] (-474.076) (-473.769) (-475.573) -- 0:00:36
385000 -- [-475.344] (-474.091) (-473.157) (-472.656) * [-476.444] (-473.784) (-473.263) (-472.753) -- 0:00:36
Average standard deviation of split frequencies: 0.009626
385500 -- (-475.537) [-473.288] (-473.924) (-478.930) * (-473.075) [-475.416] (-476.776) (-473.670) -- 0:00:36
386000 -- [-472.999] (-477.520) (-477.136) (-476.615) * (-474.521) (-475.773) [-477.914] (-477.802) -- 0:00:36
386500 -- [-477.682] (-472.680) (-477.767) (-474.396) * (-475.321) (-476.229) (-479.276) [-475.445] -- 0:00:36
387000 -- [-472.967] (-473.295) (-474.692) (-473.718) * (-476.227) (-473.171) [-478.028] (-475.289) -- 0:00:36
387500 -- (-472.652) [-473.407] (-473.838) (-472.587) * (-474.813) (-475.287) [-473.617] (-477.263) -- 0:00:36
388000 -- (-474.605) [-473.958] (-476.613) (-473.442) * (-474.536) (-479.046) [-472.947] (-477.577) -- 0:00:36
388500 -- [-473.798] (-473.115) (-472.465) (-474.859) * (-474.900) (-478.930) (-477.690) [-477.500] -- 0:00:36
389000 -- (-472.394) [-472.805] (-477.830) (-473.002) * (-474.131) (-477.929) [-475.304] (-473.493) -- 0:00:36
389500 -- (-474.459) (-474.988) (-473.033) [-474.832] * [-475.737] (-474.181) (-475.683) (-474.870) -- 0:00:36
390000 -- [-474.372] (-474.519) (-473.922) (-475.844) * [-473.545] (-479.150) (-477.875) (-473.184) -- 0:00:35
Average standard deviation of split frequencies: 0.009795
390500 -- (-472.375) (-480.126) [-474.677] (-478.997) * [-475.469] (-475.171) (-480.396) (-478.630) -- 0:00:35
391000 -- [-473.268] (-477.012) (-476.858) (-473.610) * [-472.796] (-478.652) (-479.954) (-472.602) -- 0:00:35
391500 -- (-476.938) (-473.761) (-484.158) [-473.563] * [-478.099] (-474.742) (-477.098) (-473.494) -- 0:00:35
392000 -- [-473.921] (-472.770) (-475.132) (-476.706) * [-472.700] (-474.037) (-473.214) (-475.060) -- 0:00:35
392500 -- (-474.665) (-472.714) [-476.540] (-473.705) * (-474.156) [-472.591] (-476.485) (-475.171) -- 0:00:35
393000 -- (-472.812) (-473.716) [-473.118] (-474.216) * [-473.626] (-477.183) (-478.498) (-474.333) -- 0:00:35
393500 -- (-477.671) (-472.384) (-475.789) [-473.084] * (-474.013) (-473.099) (-478.637) [-474.406] -- 0:00:35
394000 -- (-474.906) [-476.481] (-473.703) (-475.130) * (-472.832) (-475.410) (-472.814) [-475.876] -- 0:00:35
394500 -- (-473.184) (-475.236) (-473.972) [-475.366] * (-472.233) [-474.340] (-473.241) (-474.339) -- 0:00:35
395000 -- (-473.386) (-474.354) (-476.524) [-477.544] * (-474.540) (-473.589) (-474.211) [-473.939] -- 0:00:35
Average standard deviation of split frequencies: 0.009523
395500 -- [-474.981] (-475.450) (-474.831) (-476.155) * (-475.995) (-473.252) [-474.155] (-473.520) -- 0:00:35
396000 -- (-474.434) (-473.617) [-473.680] (-477.857) * (-472.891) (-473.517) [-475.137] (-477.980) -- 0:00:35
396500 -- [-474.148] (-473.275) (-478.512) (-474.415) * (-476.303) (-474.917) (-473.051) [-475.824] -- 0:00:35
397000 -- [-473.514] (-472.939) (-474.625) (-473.810) * (-474.326) (-474.927) (-475.256) [-476.301] -- 0:00:36
397500 -- (-478.456) (-478.964) [-474.676] (-474.706) * (-477.327) (-474.420) [-474.653] (-475.551) -- 0:00:36
398000 -- (-477.226) (-473.805) [-473.824] (-477.314) * (-473.844) [-475.098] (-480.834) (-475.444) -- 0:00:36
398500 -- [-472.907] (-476.800) (-476.839) (-478.136) * (-477.329) [-474.976] (-474.178) (-476.032) -- 0:00:36
399000 -- (-473.473) [-474.602] (-474.770) (-475.272) * (-478.823) (-475.856) (-474.936) [-478.723] -- 0:00:36
399500 -- (-472.854) (-474.713) (-475.580) [-472.760] * [-473.533] (-473.259) (-478.573) (-473.965) -- 0:00:36
400000 -- (-473.541) (-473.642) (-482.463) [-472.535] * (-475.084) (-475.448) (-473.760) [-472.597] -- 0:00:36
Average standard deviation of split frequencies: 0.009780
400500 -- (-473.172) [-478.882] (-477.215) (-475.455) * (-474.823) [-476.734] (-473.953) (-474.538) -- 0:00:35
401000 -- (-473.380) [-475.359] (-475.115) (-473.545) * (-473.598) (-472.286) (-474.182) [-472.253] -- 0:00:35
401500 -- (-476.657) [-478.907] (-477.893) (-474.928) * (-472.709) [-474.131] (-474.340) (-472.716) -- 0:00:35
402000 -- [-474.377] (-472.970) (-472.897) (-477.565) * (-474.602) [-475.239] (-473.370) (-472.707) -- 0:00:35
402500 -- (-474.479) [-474.177] (-473.553) (-479.041) * (-474.249) (-472.767) (-478.541) [-473.213] -- 0:00:35
403000 -- (-476.623) [-474.148] (-473.478) (-473.870) * (-473.686) (-473.817) (-476.836) [-472.629] -- 0:00:35
403500 -- (-476.768) (-473.540) [-473.027] (-473.027) * (-472.893) (-475.959) [-477.492] (-475.502) -- 0:00:35
404000 -- [-477.963] (-472.999) (-474.213) (-475.096) * (-475.251) (-473.061) [-473.246] (-474.350) -- 0:00:35
404500 -- (-473.697) (-481.957) (-473.839) [-476.385] * (-473.558) [-473.923] (-473.355) (-477.734) -- 0:00:35
405000 -- [-472.642] (-473.598) (-474.542) (-477.575) * (-480.231) (-474.911) [-473.491] (-476.645) -- 0:00:35
Average standard deviation of split frequencies: 0.009224
405500 -- (-474.272) (-475.537) (-472.219) [-478.774] * [-474.566] (-474.502) (-473.063) (-475.604) -- 0:00:35
406000 -- (-474.223) (-474.276) (-473.783) [-476.065] * [-475.508] (-477.776) (-480.312) (-474.535) -- 0:00:35
406500 -- (-475.910) (-473.858) [-472.977] (-472.896) * (-474.485) (-481.401) [-476.069] (-478.898) -- 0:00:35
407000 -- (-472.348) [-473.220] (-475.022) (-475.177) * [-474.049] (-478.906) (-473.974) (-477.908) -- 0:00:34
407500 -- (-473.910) [-473.598] (-473.238) (-476.092) * (-476.841) [-477.159] (-473.797) (-474.947) -- 0:00:34
408000 -- (-475.446) [-475.279] (-473.502) (-474.768) * (-474.847) (-473.496) [-472.799] (-472.609) -- 0:00:34
408500 -- (-472.425) [-478.493] (-475.996) (-473.697) * (-473.534) [-473.339] (-473.637) (-473.778) -- 0:00:34
409000 -- (-473.361) (-473.336) [-474.585] (-477.539) * (-474.240) (-472.730) [-474.849] (-474.933) -- 0:00:34
409500 -- (-473.731) [-473.244] (-474.759) (-474.987) * [-472.345] (-472.902) (-473.997) (-477.976) -- 0:00:34
410000 -- (-475.162) (-474.580) [-473.825] (-473.133) * (-473.350) [-474.054] (-476.756) (-476.344) -- 0:00:34
Average standard deviation of split frequencies: 0.009502
410500 -- (-482.219) (-477.609) [-474.832] (-473.202) * [-473.097] (-472.903) (-473.094) (-473.151) -- 0:00:34
411000 -- (-475.304) [-473.179] (-473.017) (-476.500) * [-472.904] (-473.075) (-474.858) (-474.713) -- 0:00:34
411500 -- (-474.545) (-473.366) [-473.945] (-475.109) * (-474.398) (-478.921) (-478.700) [-476.246] -- 0:00:34
412000 -- (-480.778) [-473.439] (-474.922) (-473.005) * [-478.448] (-473.405) (-474.160) (-472.295) -- 0:00:34
412500 -- (-473.995) [-474.842] (-474.212) (-473.362) * [-475.396] (-473.437) (-475.075) (-474.813) -- 0:00:34
413000 -- (-472.791) [-474.161] (-473.191) (-476.612) * (-474.707) [-475.584] (-478.620) (-475.080) -- 0:00:34
413500 -- (-474.993) (-475.890) (-475.018) [-475.396] * (-476.634) (-474.343) [-474.129] (-474.405) -- 0:00:34
414000 -- (-472.973) (-474.383) (-475.156) [-472.912] * (-475.725) (-474.798) [-473.332] (-473.263) -- 0:00:35
414500 -- (-473.398) [-474.986] (-474.177) (-472.778) * (-476.973) (-475.286) (-477.281) [-472.492] -- 0:00:35
415000 -- [-473.891] (-473.419) (-477.128) (-473.737) * (-477.530) (-472.638) [-474.641] (-475.320) -- 0:00:35
Average standard deviation of split frequencies: 0.010065
415500 -- (-473.091) [-475.098] (-473.975) (-472.874) * [-475.460] (-477.321) (-473.001) (-476.315) -- 0:00:35
416000 -- (-473.978) (-475.569) (-473.232) [-473.279] * [-473.254] (-474.115) (-474.545) (-474.622) -- 0:00:35
416500 -- (-475.454) (-475.045) (-473.413) [-474.303] * (-473.089) (-477.813) (-472.696) [-473.578] -- 0:00:35
417000 -- (-473.728) (-474.523) [-473.973] (-474.658) * [-474.602] (-479.092) (-473.183) (-474.150) -- 0:00:34
417500 -- (-474.509) (-477.744) [-473.728] (-475.518) * [-476.538] (-473.153) (-473.229) (-472.434) -- 0:00:34
418000 -- (-475.509) (-478.657) [-473.008] (-476.277) * (-477.859) (-472.475) [-472.677] (-475.188) -- 0:00:34
418500 -- (-476.046) [-472.614] (-475.579) (-473.828) * (-476.857) [-475.394] (-473.578) (-475.077) -- 0:00:34
419000 -- [-473.337] (-472.472) (-474.225) (-473.905) * (-473.066) (-474.356) [-472.895] (-475.160) -- 0:00:34
419500 -- (-474.132) [-472.467] (-474.851) (-478.383) * [-473.352] (-476.959) (-474.199) (-481.954) -- 0:00:34
420000 -- (-472.549) [-472.913] (-475.434) (-474.347) * (-477.097) (-476.336) [-473.416] (-475.854) -- 0:00:34
Average standard deviation of split frequencies: 0.010020
420500 -- (-473.048) [-475.315] (-473.648) (-475.257) * (-474.084) (-474.845) [-473.034] (-473.831) -- 0:00:34
421000 -- (-475.493) (-474.848) (-475.362) [-476.572] * (-479.242) (-476.666) [-473.365] (-474.647) -- 0:00:34
421500 -- (-477.139) [-473.024] (-480.924) (-475.484) * (-474.634) (-475.492) [-473.570] (-475.169) -- 0:00:34
422000 -- (-474.292) (-477.139) (-474.791) [-473.961] * [-475.576] (-480.407) (-476.901) (-478.075) -- 0:00:34
422500 -- (-473.724) (-475.234) [-474.304] (-473.970) * [-473.909] (-480.754) (-472.854) (-475.620) -- 0:00:34
423000 -- [-472.257] (-476.256) (-474.710) (-477.353) * [-473.019] (-477.074) (-480.504) (-475.213) -- 0:00:34
423500 -- [-474.154] (-474.750) (-474.221) (-472.819) * [-479.769] (-472.409) (-475.815) (-474.712) -- 0:00:34
424000 -- [-476.511] (-477.026) (-475.908) (-474.870) * [-476.205] (-477.744) (-478.172) (-473.443) -- 0:00:33
424500 -- [-474.045] (-477.706) (-473.831) (-475.713) * (-473.946) (-475.009) (-472.666) [-474.224] -- 0:00:33
425000 -- (-474.256) (-475.588) [-474.187] (-474.838) * (-473.461) [-475.734] (-479.341) (-473.749) -- 0:00:33
Average standard deviation of split frequencies: 0.009439
425500 -- (-473.343) (-474.329) [-479.185] (-474.278) * (-473.261) (-476.157) [-474.280] (-478.067) -- 0:00:33
426000 -- (-476.836) [-474.236] (-479.724) (-473.302) * (-472.767) (-477.505) (-474.469) [-474.909] -- 0:00:33
426500 -- (-476.025) (-473.481) [-476.645] (-473.346) * (-478.764) (-473.100) [-474.636] (-477.710) -- 0:00:33
427000 -- [-475.526] (-475.560) (-474.115) (-474.493) * (-473.715) [-473.647] (-475.014) (-475.297) -- 0:00:33
427500 -- (-474.056) (-473.916) (-477.216) [-475.925] * (-472.520) [-473.126] (-478.129) (-474.725) -- 0:00:33
428000 -- (-474.407) (-476.855) (-478.691) [-473.635] * (-473.647) [-474.842] (-473.207) (-473.678) -- 0:00:33
428500 -- (-473.265) [-473.398] (-478.162) (-473.242) * (-474.076) (-474.786) [-473.486] (-476.960) -- 0:00:33
429000 -- (-473.880) (-473.450) [-473.466] (-474.547) * [-474.184] (-473.885) (-473.891) (-476.282) -- 0:00:33
429500 -- (-472.846) (-476.002) [-476.035] (-475.242) * (-476.392) (-473.892) [-475.777] (-474.139) -- 0:00:33
430000 -- (-474.253) (-474.551) (-472.409) [-475.198] * (-474.207) [-473.322] (-475.606) (-473.704) -- 0:00:33
Average standard deviation of split frequencies: 0.008370
430500 -- (-476.296) (-474.834) [-472.654] (-474.437) * (-474.904) (-473.973) [-474.804] (-478.687) -- 0:00:33
431000 -- (-475.690) (-472.625) (-475.868) [-475.967] * [-474.287] (-473.309) (-476.668) (-475.232) -- 0:00:34
431500 -- (-477.371) (-473.166) (-476.021) [-478.408] * (-472.948) (-476.471) [-473.974] (-473.296) -- 0:00:34
432000 -- (-478.726) [-475.211] (-473.327) (-475.745) * [-473.084] (-475.416) (-473.640) (-473.296) -- 0:00:34
432500 -- (-477.384) [-474.423] (-472.654) (-474.793) * (-473.331) (-474.669) [-473.274] (-476.721) -- 0:00:34
433000 -- [-472.676] (-472.596) (-473.281) (-473.034) * (-474.489) (-474.348) (-473.505) [-474.451] -- 0:00:34
433500 -- (-473.680) [-473.177] (-472.892) (-475.184) * (-475.384) [-475.323] (-473.570) (-474.246) -- 0:00:33
434000 -- [-472.592] (-474.033) (-473.212) (-475.191) * [-473.470] (-475.822) (-474.105) (-478.266) -- 0:00:33
434500 -- [-475.507] (-472.795) (-475.107) (-472.876) * [-474.026] (-476.913) (-473.468) (-472.348) -- 0:00:33
435000 -- (-473.630) (-472.783) [-473.574] (-475.514) * (-473.180) (-473.217) (-475.277) [-473.462] -- 0:00:33
Average standard deviation of split frequencies: 0.007771
435500 -- (-474.198) (-473.319) (-474.579) [-476.149] * (-475.742) [-472.389] (-474.484) (-474.149) -- 0:00:33
436000 -- [-474.418] (-478.864) (-474.660) (-473.251) * [-476.942] (-473.120) (-480.998) (-473.084) -- 0:00:33
436500 -- (-476.668) (-474.094) (-473.405) [-475.038] * (-473.644) [-472.526] (-475.451) (-473.801) -- 0:00:33
437000 -- (-474.072) [-475.132] (-476.501) (-474.931) * (-474.289) (-475.683) (-472.357) [-472.620] -- 0:00:33
437500 -- (-473.854) (-472.817) [-474.294] (-473.590) * [-473.035] (-473.768) (-475.253) (-477.037) -- 0:00:33
438000 -- (-476.196) (-483.154) [-473.765] (-475.299) * (-474.098) (-475.603) [-472.931] (-477.878) -- 0:00:33
438500 -- (-474.287) [-472.497] (-475.535) (-474.926) * (-476.049) (-473.922) (-478.595) [-476.215] -- 0:00:33
439000 -- (-474.413) (-472.500) (-474.664) [-478.417] * [-474.737] (-473.265) (-474.681) (-473.924) -- 0:00:33
439500 -- (-474.027) (-472.458) [-476.312] (-475.382) * (-473.634) (-476.631) (-472.631) [-472.935] -- 0:00:33
440000 -- [-474.600] (-476.101) (-477.876) (-474.476) * (-474.756) (-473.798) (-472.896) [-474.463] -- 0:00:33
Average standard deviation of split frequencies: 0.006753
440500 -- (-472.386) (-474.995) (-475.235) [-476.877] * (-480.562) (-475.947) [-476.448] (-474.934) -- 0:00:33
441000 -- (-472.778) (-473.012) [-474.968] (-473.069) * (-476.206) (-474.351) [-473.824] (-473.652) -- 0:00:32
441500 -- (-473.050) (-474.303) (-475.095) [-473.189] * (-475.015) (-473.078) (-475.455) [-474.420] -- 0:00:32
442000 -- (-475.910) [-472.291] (-475.850) (-473.410) * (-474.943) (-475.589) (-482.078) [-473.904] -- 0:00:32
442500 -- (-472.330) (-472.851) [-475.009] (-473.379) * (-476.665) [-474.118] (-473.966) (-474.513) -- 0:00:32
443000 -- [-472.444] (-478.151) (-477.009) (-473.603) * [-473.444] (-475.748) (-473.564) (-475.015) -- 0:00:32
443500 -- (-475.392) (-475.564) (-477.223) [-474.296] * (-472.610) [-475.703] (-475.785) (-473.776) -- 0:00:32
444000 -- (-477.975) [-475.082] (-474.441) (-476.786) * (-472.711) (-474.558) [-479.966] (-478.387) -- 0:00:32
444500 -- (-473.575) (-481.797) (-477.478) [-474.308] * (-475.733) [-473.317] (-476.350) (-476.798) -- 0:00:32
445000 -- (-475.886) (-475.135) [-475.077] (-473.436) * [-474.294] (-474.841) (-476.986) (-472.446) -- 0:00:32
Average standard deviation of split frequencies: 0.007201
445500 -- [-474.663] (-473.046) (-475.263) (-474.556) * (-473.796) (-476.508) [-473.734] (-474.802) -- 0:00:32
446000 -- (-474.700) [-474.401] (-475.898) (-473.326) * (-472.791) [-472.441] (-473.588) (-475.952) -- 0:00:32
446500 -- (-473.800) (-474.947) (-479.744) [-473.464] * [-477.424] (-474.705) (-472.762) (-476.292) -- 0:00:32
447000 -- (-479.507) (-474.040) (-474.325) [-476.430] * (-477.925) (-475.694) (-472.540) [-473.125] -- 0:00:32
447500 -- (-474.115) [-475.321] (-473.511) (-476.321) * (-477.135) (-473.983) [-473.354] (-472.287) -- 0:00:32
448000 -- (-473.686) (-474.109) [-474.718] (-477.331) * (-477.315) [-472.514] (-474.676) (-473.426) -- 0:00:33
448500 -- (-474.163) (-474.007) [-474.522] (-478.308) * [-476.540] (-472.825) (-474.123) (-474.598) -- 0:00:33
449000 -- (-478.214) (-474.772) (-477.089) [-475.710] * [-475.994] (-474.695) (-474.500) (-476.596) -- 0:00:33
449500 -- (-473.895) (-473.477) [-475.775] (-480.051) * (-474.744) [-477.323] (-474.381) (-478.552) -- 0:00:33
450000 -- (-474.600) [-472.735] (-475.912) (-473.339) * [-473.290] (-475.627) (-478.343) (-472.137) -- 0:00:33
Average standard deviation of split frequencies: 0.006211
450500 -- (-475.518) (-474.143) [-473.639] (-473.462) * (-474.873) (-473.677) (-473.565) [-475.140] -- 0:00:32
451000 -- (-473.053) (-474.049) (-473.190) [-473.624] * (-473.986) [-473.151] (-473.101) (-475.540) -- 0:00:32
451500 -- (-472.879) (-473.859) (-475.556) [-472.639] * [-473.823] (-475.653) (-476.310) (-472.801) -- 0:00:32
452000 -- (-473.613) (-472.660) (-473.514) [-473.927] * [-475.200] (-479.137) (-473.479) (-474.738) -- 0:00:32
452500 -- [-474.017] (-475.216) (-475.145) (-476.267) * (-473.593) [-480.043] (-474.313) (-473.918) -- 0:00:32
453000 -- (-474.948) [-474.977] (-474.046) (-473.470) * [-472.443] (-474.143) (-472.707) (-478.645) -- 0:00:32
453500 -- (-474.209) (-479.131) [-476.169] (-478.550) * (-474.798) [-474.143] (-473.901) (-476.306) -- 0:00:32
454000 -- (-474.518) (-477.852) (-473.931) [-473.466] * (-478.262) (-475.534) [-475.799] (-473.500) -- 0:00:32
454500 -- (-476.255) [-477.477] (-473.425) (-475.406) * [-473.757] (-474.697) (-474.124) (-477.006) -- 0:00:32
455000 -- (-479.184) (-477.695) [-472.865] (-475.079) * (-473.033) [-472.910] (-474.558) (-473.169) -- 0:00:32
Average standard deviation of split frequencies: 0.007236
455500 -- (-476.770) (-475.569) (-473.159) [-473.100] * [-473.187] (-472.498) (-477.415) (-475.702) -- 0:00:32
456000 -- (-475.068) (-473.494) (-472.336) [-472.886] * [-472.430] (-473.571) (-475.014) (-475.639) -- 0:00:32
456500 -- (-473.344) [-474.054] (-472.732) (-474.743) * (-473.923) [-474.000] (-473.831) (-476.402) -- 0:00:32
457000 -- (-477.722) [-473.591] (-475.724) (-473.867) * (-472.982) (-473.123) [-473.861] (-474.340) -- 0:00:32
457500 -- (-473.790) (-473.331) [-478.079] (-473.974) * (-476.310) (-474.535) [-473.227] (-474.824) -- 0:00:32
458000 -- (-476.225) [-473.594] (-480.040) (-475.376) * [-473.013] (-476.733) (-472.458) (-473.979) -- 0:00:31
458500 -- (-474.713) (-476.587) (-475.336) [-473.242] * [-473.016] (-476.254) (-474.145) (-474.863) -- 0:00:31
459000 -- (-473.237) (-476.241) (-475.235) [-473.621] * (-474.920) (-476.090) (-474.445) [-474.720] -- 0:00:31
459500 -- (-473.543) (-477.690) (-474.972) [-474.497] * (-478.556) [-475.147] (-473.867) (-474.226) -- 0:00:31
460000 -- [-477.498] (-475.148) (-473.910) (-476.862) * (-478.527) (-476.512) [-474.351] (-475.109) -- 0:00:31
Average standard deviation of split frequencies: 0.007867
460500 -- (-474.126) (-474.112) (-475.379) [-475.687] * (-474.784) (-475.176) (-478.818) [-475.110] -- 0:00:31
461000 -- (-475.628) [-480.003] (-474.137) (-475.124) * (-474.056) (-475.880) [-474.073] (-474.084) -- 0:00:31
461500 -- (-474.015) (-477.002) (-474.011) [-474.366] * (-474.459) (-474.586) (-475.040) [-473.356] -- 0:00:31
462000 -- [-472.909] (-475.942) (-475.191) (-473.958) * [-473.100] (-475.785) (-475.257) (-473.121) -- 0:00:31
462500 -- (-475.851) [-472.945] (-474.249) (-476.597) * (-475.904) (-475.607) [-474.246] (-473.697) -- 0:00:31
463000 -- (-476.733) (-474.849) [-474.568] (-474.558) * (-475.743) (-475.312) [-473.542] (-478.093) -- 0:00:31
463500 -- (-474.332) (-475.513) (-472.710) [-473.953] * (-477.866) (-473.541) [-472.982] (-472.995) -- 0:00:31
464000 -- (-473.727) [-474.519] (-473.890) (-473.468) * (-475.957) [-473.865] (-473.057) (-472.747) -- 0:00:31
464500 -- (-476.571) (-474.912) [-475.771] (-479.271) * [-472.946] (-472.728) (-474.757) (-476.487) -- 0:00:31
465000 -- (-475.209) [-475.408] (-475.943) (-475.186) * (-472.452) [-475.364] (-475.644) (-473.912) -- 0:00:32
Average standard deviation of split frequencies: 0.007688
465500 -- (-475.225) (-473.921) [-473.816] (-475.464) * [-472.835] (-482.967) (-474.499) (-474.039) -- 0:00:32
466000 -- [-473.161] (-473.029) (-474.507) (-473.612) * (-473.577) (-480.076) [-472.671] (-474.482) -- 0:00:32
466500 -- (-473.067) [-474.190] (-476.029) (-476.769) * (-472.510) (-476.147) [-472.843] (-474.635) -- 0:00:32
467000 -- [-473.023] (-474.022) (-474.090) (-474.430) * (-473.578) [-475.081] (-476.477) (-472.734) -- 0:00:31
467500 -- (-473.350) (-478.635) (-477.039) [-475.215] * [-472.837] (-475.208) (-479.155) (-473.402) -- 0:00:31
468000 -- (-476.694) (-477.223) [-473.577] (-475.610) * (-473.998) (-476.317) (-475.462) [-473.442] -- 0:00:31
468500 -- (-475.190) (-478.646) [-477.946] (-475.383) * (-472.553) (-475.105) (-474.458) [-472.949] -- 0:00:31
469000 -- (-474.770) (-478.305) (-478.659) [-473.644] * [-478.599] (-474.686) (-473.690) (-472.886) -- 0:00:31
469500 -- (-477.735) (-475.291) [-476.747] (-472.529) * (-473.318) (-475.245) [-473.694] (-472.895) -- 0:00:31
470000 -- (-481.573) (-476.130) (-475.975) [-474.906] * (-473.641) (-474.466) [-472.968] (-474.931) -- 0:00:31
Average standard deviation of split frequencies: 0.007574
470500 -- (-474.292) [-475.507] (-474.213) (-473.276) * (-474.905) (-473.332) (-474.629) [-476.375] -- 0:00:31
471000 -- (-473.365) (-473.362) [-473.217] (-478.525) * (-472.545) [-473.378] (-478.520) (-472.973) -- 0:00:31
471500 -- (-475.324) [-473.813] (-477.825) (-474.045) * [-475.388] (-476.397) (-476.458) (-476.155) -- 0:00:31
472000 -- (-474.186) (-473.863) (-481.456) [-474.747] * (-474.311) [-473.399] (-474.366) (-477.890) -- 0:00:31
472500 -- [-473.270] (-474.478) (-473.731) (-473.607) * (-476.516) (-473.712) [-474.439] (-476.922) -- 0:00:31
473000 -- (-474.103) (-476.416) [-474.353] (-474.732) * (-473.748) (-473.953) [-473.409] (-475.184) -- 0:00:31
473500 -- [-474.864] (-472.764) (-473.208) (-473.269) * (-476.001) [-475.887] (-473.761) (-477.621) -- 0:00:31
474000 -- (-480.271) (-473.602) (-474.926) [-474.429] * (-474.851) [-473.966] (-478.875) (-475.542) -- 0:00:31
474500 -- (-475.092) [-474.503] (-476.123) (-472.674) * (-474.523) (-473.065) (-477.170) [-473.097] -- 0:00:31
475000 -- (-473.153) (-477.163) (-473.139) [-474.733] * (-474.919) [-476.131] (-474.425) (-474.246) -- 0:00:30
Average standard deviation of split frequencies: 0.007366
475500 -- [-473.943] (-473.779) (-473.365) (-474.141) * (-475.912) (-476.620) [-472.948] (-476.302) -- 0:00:30
476000 -- (-475.148) (-476.064) [-473.136] (-475.900) * (-476.639) [-474.059] (-475.056) (-477.752) -- 0:00:30
476500 -- (-475.366) (-473.909) (-478.690) [-476.924] * (-477.248) (-475.987) (-477.285) [-472.641] -- 0:00:30
477000 -- (-474.147) [-473.635] (-473.364) (-476.513) * (-474.000) (-475.451) (-477.592) [-472.626] -- 0:00:30
477500 -- (-473.979) (-473.605) (-474.973) [-474.343] * (-473.888) (-477.576) [-473.207] (-473.673) -- 0:00:30
478000 -- (-473.383) (-475.892) (-474.925) [-472.463] * (-477.647) (-472.480) (-473.746) [-474.782] -- 0:00:30
478500 -- (-476.313) (-476.546) [-474.693] (-477.976) * [-475.212] (-475.313) (-476.271) (-472.649) -- 0:00:30
479000 -- (-475.528) [-477.962] (-473.437) (-473.535) * (-472.527) (-477.446) (-478.773) [-475.207] -- 0:00:30
479500 -- (-472.945) (-474.929) [-476.597] (-475.203) * (-476.173) (-477.596) [-481.619] (-472.944) -- 0:00:30
480000 -- (-475.766) (-475.798) [-475.954] (-475.689) * (-475.939) (-475.221) [-472.735] (-472.733) -- 0:00:30
Average standard deviation of split frequencies: 0.007257
480500 -- (-472.723) (-473.434) (-474.758) [-474.812] * (-476.465) (-473.522) (-480.586) [-473.003] -- 0:00:30
481000 -- [-473.190] (-477.023) (-474.051) (-474.976) * (-477.167) (-475.521) (-473.564) [-472.643] -- 0:00:30
481500 -- [-474.670] (-483.203) (-474.347) (-474.409) * [-474.603] (-477.967) (-474.071) (-473.860) -- 0:00:30
482000 -- (-472.965) [-477.360] (-476.251) (-472.941) * (-477.456) (-479.158) [-474.785] (-474.688) -- 0:00:31
482500 -- (-474.507) (-474.059) [-475.565] (-473.558) * (-477.468) (-475.331) [-475.255] (-472.215) -- 0:00:31
483000 -- (-476.479) (-475.725) [-475.235] (-472.585) * (-474.758) [-478.041] (-474.520) (-472.542) -- 0:00:31
483500 -- [-479.343] (-472.878) (-475.431) (-472.688) * [-475.329] (-474.980) (-473.585) (-473.138) -- 0:00:30
484000 -- (-473.603) (-473.182) [-473.578] (-474.212) * (-475.008) (-473.155) (-473.267) [-473.500] -- 0:00:30
484500 -- [-474.088] (-475.516) (-472.102) (-474.934) * (-474.668) (-476.512) [-473.059] (-472.427) -- 0:00:30
485000 -- (-473.093) [-475.388] (-474.807) (-472.655) * (-474.894) (-473.982) [-474.052] (-472.222) -- 0:00:30
Average standard deviation of split frequencies: 0.007214
485500 -- [-477.190] (-475.854) (-473.336) (-472.931) * (-475.335) [-475.250] (-474.293) (-476.411) -- 0:00:30
486000 -- (-481.492) (-475.124) (-473.134) [-473.661] * [-473.836] (-474.011) (-476.126) (-474.790) -- 0:00:30
486500 -- [-475.112] (-472.782) (-474.495) (-475.531) * (-473.835) (-472.863) [-473.355] (-475.772) -- 0:00:30
487000 -- (-478.727) (-474.534) (-474.019) [-474.446] * (-475.910) (-474.052) [-474.025] (-474.127) -- 0:00:30
487500 -- (-473.346) (-473.358) [-474.332] (-475.668) * (-475.649) (-472.714) [-473.005] (-477.236) -- 0:00:30
488000 -- (-474.611) [-473.707] (-472.757) (-476.397) * (-476.760) [-473.509] (-476.461) (-477.182) -- 0:00:30
488500 -- [-474.442] (-473.920) (-473.651) (-476.373) * (-476.747) [-473.763] (-477.582) (-478.170) -- 0:00:30
489000 -- (-473.446) (-482.010) (-473.734) [-474.123] * (-475.014) (-474.323) (-475.484) [-473.834] -- 0:00:30
489500 -- (-475.054) (-475.507) (-474.284) [-474.980] * [-472.905] (-477.946) (-475.041) (-475.500) -- 0:00:30
490000 -- (-475.159) (-473.918) [-474.807] (-475.991) * (-474.217) (-473.781) (-474.508) [-476.055] -- 0:00:30
Average standard deviation of split frequencies: 0.007806
490500 -- (-472.732) (-475.464) (-477.200) [-474.795] * [-474.548] (-477.522) (-475.687) (-476.077) -- 0:00:30
491000 -- (-474.044) (-476.487) (-473.345) [-477.890] * (-476.244) [-472.790] (-476.342) (-477.964) -- 0:00:30
491500 -- [-473.443] (-475.249) (-474.252) (-477.616) * (-474.356) [-476.250] (-473.433) (-474.057) -- 0:00:30
492000 -- [-479.962] (-475.114) (-473.149) (-474.323) * (-474.712) [-473.181] (-474.515) (-473.691) -- 0:00:29
492500 -- (-473.997) (-475.819) (-474.323) [-476.316] * [-475.645] (-475.127) (-473.816) (-475.127) -- 0:00:29
493000 -- (-474.369) [-473.842] (-474.253) (-474.802) * (-472.950) (-473.212) (-478.118) [-474.872] -- 0:00:29
493500 -- (-474.054) (-476.980) (-474.170) [-472.919] * (-472.544) [-474.750] (-473.384) (-475.459) -- 0:00:29
494000 -- (-474.270) (-475.218) [-473.475] (-476.900) * [-474.787] (-475.862) (-473.462) (-477.341) -- 0:00:29
494500 -- (-476.300) (-475.836) [-473.372] (-478.362) * (-477.672) (-475.791) [-474.060] (-473.091) -- 0:00:29
495000 -- [-473.898] (-474.146) (-473.615) (-477.963) * (-473.034) [-476.895] (-480.274) (-476.632) -- 0:00:29
Average standard deviation of split frequencies: 0.007722
495500 -- (-474.036) (-473.885) [-473.613] (-474.293) * (-475.872) [-474.388] (-473.682) (-475.523) -- 0:00:29
496000 -- (-476.703) (-476.927) [-474.121] (-473.855) * (-473.705) (-478.822) [-477.719] (-477.625) -- 0:00:29
496500 -- (-479.016) [-474.191] (-472.460) (-475.181) * (-474.519) (-474.905) [-476.081] (-475.334) -- 0:00:29
497000 -- (-475.163) (-475.069) (-472.682) [-474.124] * (-474.285) [-475.817] (-473.924) (-473.669) -- 0:00:29
497500 -- (-475.720) (-478.799) [-473.315] (-475.922) * (-479.470) (-472.873) [-474.220] (-476.146) -- 0:00:29
498000 -- [-475.520] (-475.481) (-476.985) (-477.112) * (-478.335) (-474.314) [-474.108] (-473.142) -- 0:00:29
498500 -- (-474.498) [-472.946] (-479.931) (-475.349) * (-472.926) [-477.472] (-474.021) (-476.800) -- 0:00:29
499000 -- (-480.023) (-473.973) [-472.597] (-475.433) * [-477.252] (-473.839) (-472.484) (-474.276) -- 0:00:30
499500 -- (-479.565) (-476.622) [-473.228] (-474.789) * (-476.605) (-472.930) (-475.728) [-475.220] -- 0:00:30
500000 -- [-473.577] (-477.060) (-473.770) (-476.514) * (-474.146) [-474.493] (-473.951) (-476.090) -- 0:00:30
Average standard deviation of split frequencies: 0.007415
500500 -- [-475.241] (-476.287) (-474.310) (-477.950) * (-474.681) [-473.652] (-472.990) (-473.691) -- 0:00:29
501000 -- (-473.375) (-477.775) (-476.759) [-476.078] * (-477.984) (-473.646) [-473.992] (-475.324) -- 0:00:29
501500 -- (-475.686) (-479.490) (-473.862) [-476.335] * (-475.203) [-474.127] (-474.386) (-473.827) -- 0:00:29
502000 -- [-474.458] (-477.168) (-473.727) (-475.727) * (-476.320) [-473.657] (-474.548) (-476.717) -- 0:00:29
502500 -- (-475.057) (-475.617) [-474.397] (-475.575) * [-474.032] (-473.185) (-473.068) (-475.445) -- 0:00:29
503000 -- [-472.609] (-475.110) (-473.487) (-472.708) * (-480.284) (-476.120) (-474.173) [-478.235] -- 0:00:29
503500 -- (-472.845) [-481.172] (-473.336) (-475.084) * (-479.976) (-474.166) (-474.245) [-478.366] -- 0:00:29
504000 -- (-474.117) (-476.302) [-473.152] (-476.785) * (-472.529) [-473.231] (-476.195) (-473.833) -- 0:00:29
504500 -- (-473.487) (-473.289) (-475.714) [-474.436] * (-476.008) (-473.539) [-475.036] (-476.014) -- 0:00:29
505000 -- [-475.355] (-474.264) (-474.952) (-474.875) * (-474.248) (-474.140) [-475.710] (-480.540) -- 0:00:29
Average standard deviation of split frequencies: 0.007511
505500 -- (-474.111) [-475.745] (-475.904) (-474.361) * (-474.251) (-474.027) [-481.625] (-477.197) -- 0:00:29
506000 -- [-476.230] (-476.424) (-472.270) (-475.134) * (-473.935) (-475.152) [-474.809] (-474.505) -- 0:00:29
506500 -- [-475.159] (-475.400) (-473.855) (-474.033) * [-473.087] (-474.511) (-477.951) (-472.896) -- 0:00:29
507000 -- (-474.596) (-472.502) (-473.026) [-473.454] * [-472.875] (-478.049) (-475.867) (-474.876) -- 0:00:29
507500 -- (-476.078) [-475.571] (-474.761) (-476.625) * (-472.310) (-474.072) [-474.220] (-473.944) -- 0:00:29
508000 -- (-473.413) (-475.324) (-475.893) [-477.526] * (-477.028) [-474.792] (-473.253) (-472.805) -- 0:00:29
508500 -- (-477.451) (-475.711) [-474.496] (-474.249) * (-474.468) (-474.341) (-473.224) [-473.909] -- 0:00:28
509000 -- [-472.896] (-473.281) (-473.164) (-474.213) * (-474.327) [-474.604] (-473.306) (-475.351) -- 0:00:28
509500 -- (-474.872) [-472.958] (-474.716) (-475.855) * (-475.905) (-474.413) (-474.168) [-476.525] -- 0:00:28
510000 -- (-476.853) (-476.468) [-484.661] (-476.554) * (-476.324) [-473.492] (-473.457) (-476.763) -- 0:00:28
Average standard deviation of split frequencies: 0.007731
510500 -- (-474.904) [-475.699] (-475.936) (-473.519) * (-476.303) (-478.205) (-478.098) [-472.873] -- 0:00:28
511000 -- (-472.194) (-475.895) [-474.283] (-473.728) * (-474.096) [-475.211] (-472.856) (-474.307) -- 0:00:28
511500 -- (-472.752) (-474.724) [-475.664] (-475.244) * (-473.298) (-476.911) (-475.008) [-476.756] -- 0:00:28
512000 -- (-474.152) [-474.327] (-472.584) (-475.346) * (-475.322) (-478.252) [-476.892] (-473.542) -- 0:00:28
512500 -- (-474.303) (-476.081) (-474.243) [-475.204] * (-474.624) (-481.583) (-475.070) [-474.480] -- 0:00:28
513000 -- (-474.884) (-480.178) [-475.001] (-473.883) * (-476.742) (-474.873) [-476.377] (-476.454) -- 0:00:28
513500 -- (-476.500) (-475.026) (-475.972) [-473.748] * (-473.121) (-477.958) (-474.040) [-473.421] -- 0:00:28
514000 -- (-474.171) (-473.047) [-473.754] (-474.919) * [-473.191] (-476.620) (-479.013) (-477.568) -- 0:00:28
514500 -- (-474.264) (-474.547) (-474.731) [-476.694] * [-475.846] (-475.516) (-475.283) (-475.316) -- 0:00:28
515000 -- [-478.141] (-475.787) (-474.178) (-474.945) * [-473.660] (-472.800) (-476.944) (-473.237) -- 0:00:28
Average standard deviation of split frequencies: 0.008336
515500 -- [-474.491] (-476.344) (-476.434) (-473.373) * [-480.951] (-474.705) (-474.436) (-473.341) -- 0:00:29
516000 -- (-476.760) (-474.205) (-475.148) [-472.770] * (-480.769) [-474.744] (-474.140) (-475.161) -- 0:00:29
516500 -- (-476.274) (-478.652) (-473.309) [-473.841] * (-474.968) (-479.724) [-474.686] (-474.623) -- 0:00:29
517000 -- (-475.933) (-474.790) (-475.530) [-475.463] * [-476.272] (-478.339) (-474.362) (-477.269) -- 0:00:28
517500 -- (-474.960) (-475.424) (-474.093) [-474.708] * (-476.433) (-476.414) (-478.207) [-477.079] -- 0:00:28
518000 -- (-475.551) [-473.290] (-472.463) (-472.623) * (-477.178) (-476.226) (-473.538) [-477.674] -- 0:00:28
518500 -- [-473.511] (-473.521) (-475.067) (-476.473) * [-473.132] (-473.390) (-473.806) (-473.979) -- 0:00:28
519000 -- (-473.910) (-477.343) (-474.615) [-475.518] * [-473.683] (-476.949) (-476.372) (-472.207) -- 0:00:28
519500 -- (-475.067) (-475.531) [-475.325] (-474.394) * (-474.420) (-473.385) (-473.603) [-473.382] -- 0:00:28
520000 -- [-473.310] (-475.271) (-474.798) (-473.803) * (-474.797) [-476.143] (-476.828) (-475.191) -- 0:00:28
Average standard deviation of split frequencies: 0.008148
520500 -- (-475.902) (-479.535) (-476.072) [-472.985] * [-473.135] (-475.133) (-476.996) (-474.566) -- 0:00:28
521000 -- (-474.036) (-475.307) (-473.184) [-474.414] * [-472.883] (-472.985) (-473.061) (-476.757) -- 0:00:28
521500 -- [-476.392] (-478.561) (-475.652) (-473.042) * (-475.235) [-473.570] (-473.627) (-475.733) -- 0:00:28
522000 -- [-473.972] (-474.823) (-477.487) (-473.141) * (-475.320) (-474.288) [-473.482] (-477.607) -- 0:00:28
522500 -- [-474.777] (-476.665) (-474.189) (-472.440) * (-476.166) (-473.587) (-473.329) [-473.914] -- 0:00:28
523000 -- (-474.942) (-474.545) [-474.379] (-473.927) * (-480.807) (-473.992) [-473.273] (-473.871) -- 0:00:28
523500 -- (-473.481) (-474.443) [-475.678] (-474.923) * (-482.894) [-473.678] (-476.231) (-474.299) -- 0:00:28
524000 -- (-473.931) (-472.440) [-473.114] (-474.295) * (-476.260) [-473.571] (-473.304) (-476.800) -- 0:00:28
524500 -- (-476.938) (-473.925) (-472.892) [-473.296] * (-474.098) (-477.475) (-472.389) [-472.247] -- 0:00:28
525000 -- (-474.084) (-476.234) (-474.993) [-475.613] * (-473.534) [-473.399] (-473.347) (-475.294) -- 0:00:28
Average standard deviation of split frequencies: 0.008290
525500 -- (-475.002) (-473.855) [-473.691] (-473.366) * [-477.724] (-474.551) (-472.676) (-481.563) -- 0:00:27
526000 -- (-474.819) [-473.163] (-476.540) (-473.243) * (-478.931) (-473.855) [-473.886] (-476.582) -- 0:00:27
526500 -- (-475.834) (-474.246) [-474.907] (-472.319) * [-477.701] (-474.115) (-474.977) (-474.599) -- 0:00:27
527000 -- (-474.929) (-474.673) [-473.073] (-473.020) * [-473.538] (-475.263) (-475.151) (-474.460) -- 0:00:27
527500 -- [-473.304] (-475.319) (-474.468) (-473.305) * (-474.516) (-472.748) (-474.791) [-473.367] -- 0:00:27
528000 -- (-473.304) (-474.405) [-473.352] (-473.213) * (-473.245) (-473.871) (-473.334) [-472.910] -- 0:00:27
528500 -- (-475.310) [-476.766] (-475.638) (-475.336) * [-475.170] (-473.450) (-477.477) (-473.104) -- 0:00:27
529000 -- (-476.410) [-474.524] (-482.806) (-473.202) * (-472.832) (-472.154) [-476.028] (-475.194) -- 0:00:27
529500 -- (-474.263) (-473.817) (-475.173) [-473.275] * (-476.210) [-473.091] (-473.625) (-473.262) -- 0:00:27
530000 -- (-473.947) (-474.277) (-474.070) [-472.977] * (-476.740) (-473.766) [-474.090] (-472.708) -- 0:00:27
Average standard deviation of split frequencies: 0.007662
530500 -- (-472.708) (-476.781) [-474.237] (-475.389) * (-475.483) (-476.887) (-474.686) [-472.695] -- 0:00:27
531000 -- [-472.727] (-475.948) (-474.086) (-477.728) * (-472.523) (-476.841) [-472.395] (-474.031) -- 0:00:27
531500 -- [-474.478] (-473.931) (-475.431) (-474.982) * (-475.138) (-474.219) [-472.800] (-474.636) -- 0:00:27
532000 -- (-474.779) (-475.389) (-480.493) [-475.264] * [-474.137] (-477.071) (-473.515) (-473.788) -- 0:00:27
532500 -- (-476.194) (-474.202) (-477.040) [-472.993] * (-475.672) [-475.099] (-474.594) (-476.864) -- 0:00:27
533000 -- [-475.264] (-474.225) (-474.350) (-473.019) * (-473.682) (-474.041) (-474.330) [-476.840] -- 0:00:28
533500 -- (-472.756) (-472.890) (-475.410) [-473.099] * (-474.022) [-475.007] (-475.353) (-475.441) -- 0:00:27
534000 -- (-473.665) (-472.667) (-475.670) [-474.294] * [-477.604] (-476.474) (-474.401) (-473.745) -- 0:00:27
534500 -- (-473.919) (-478.047) (-476.122) [-477.517] * (-477.559) (-476.272) (-473.844) [-473.879] -- 0:00:27
535000 -- [-474.159] (-477.401) (-474.082) (-472.599) * [-473.397] (-476.618) (-474.077) (-472.863) -- 0:00:27
Average standard deviation of split frequencies: 0.008025
535500 -- [-473.942] (-474.525) (-478.722) (-474.386) * (-473.537) (-472.750) [-476.290] (-472.953) -- 0:00:27
536000 -- [-472.868] (-476.525) (-473.957) (-473.744) * (-483.184) (-473.751) [-479.652] (-473.139) -- 0:00:27
536500 -- (-474.044) (-475.698) [-473.773] (-474.414) * [-473.681] (-475.472) (-472.655) (-477.981) -- 0:00:27
537000 -- (-472.770) [-472.834] (-477.100) (-474.438) * (-473.814) (-474.494) (-473.301) [-473.823] -- 0:00:27
537500 -- (-472.746) (-472.809) (-473.316) [-474.526] * (-472.397) [-474.958] (-475.578) (-475.459) -- 0:00:27
538000 -- [-472.918] (-477.428) (-472.914) (-474.234) * [-474.295] (-474.279) (-473.716) (-476.162) -- 0:00:27
538500 -- (-476.456) [-474.342] (-475.358) (-473.665) * (-476.866) (-472.497) (-474.941) [-474.299] -- 0:00:27
539000 -- (-473.078) [-473.930] (-477.266) (-472.521) * (-475.434) [-474.878] (-475.570) (-473.201) -- 0:00:27
539500 -- (-472.963) (-475.987) (-473.573) [-473.564] * [-475.918] (-473.378) (-474.319) (-473.724) -- 0:00:27
540000 -- (-473.750) (-473.919) (-475.420) [-477.016] * [-473.460] (-475.312) (-475.075) (-473.958) -- 0:00:27
Average standard deviation of split frequencies: 0.007905
540500 -- (-474.791) [-472.700] (-476.061) (-482.172) * (-473.472) (-476.764) [-474.441] (-475.615) -- 0:00:27
541000 -- (-472.633) [-472.954] (-476.826) (-472.810) * [-473.472] (-472.688) (-476.802) (-475.173) -- 0:00:27
541500 -- (-473.002) (-472.415) [-473.502] (-478.579) * (-474.325) (-474.231) [-476.865] (-473.306) -- 0:00:27
542000 -- (-478.902) (-472.430) [-472.743] (-476.272) * (-479.147) [-476.444] (-472.810) (-472.995) -- 0:00:27
542500 -- (-474.041) (-472.940) [-472.799] (-475.720) * (-474.006) (-474.313) (-475.866) [-473.620] -- 0:00:26
543000 -- [-474.557] (-477.699) (-478.429) (-474.085) * (-473.725) [-473.799] (-476.769) (-476.308) -- 0:00:26
543500 -- (-475.904) [-472.955] (-476.103) (-472.327) * (-472.424) (-475.396) (-474.489) [-472.693] -- 0:00:26
544000 -- (-473.839) (-472.323) [-475.614] (-473.099) * [-474.821] (-475.273) (-473.838) (-474.040) -- 0:00:26
544500 -- (-472.950) (-472.812) [-482.060] (-473.178) * (-473.669) (-473.578) (-475.237) [-472.594] -- 0:00:26
545000 -- (-482.730) (-473.708) (-474.628) [-476.037] * (-473.122) (-473.288) [-476.462] (-475.891) -- 0:00:26
Average standard deviation of split frequencies: 0.007655
545500 -- (-477.452) (-474.168) [-477.048] (-473.062) * (-472.924) (-476.983) (-474.667) [-472.953] -- 0:00:26
546000 -- (-475.216) [-474.346] (-480.126) (-473.845) * [-473.545] (-482.251) (-474.984) (-475.110) -- 0:00:26
546500 -- (-472.875) [-473.398] (-475.676) (-474.912) * (-472.331) (-475.701) [-472.684] (-475.091) -- 0:00:26
547000 -- (-475.068) (-475.136) (-474.716) [-473.143] * (-476.429) (-473.993) (-475.650) [-473.876] -- 0:00:26
547500 -- (-475.321) [-474.211] (-475.005) (-473.348) * (-473.502) [-472.351] (-476.996) (-474.012) -- 0:00:26
548000 -- (-475.876) (-477.838) [-474.578] (-476.540) * (-474.745) [-476.539] (-474.617) (-473.669) -- 0:00:26
548500 -- (-474.452) (-473.768) [-472.350] (-479.547) * [-474.950] (-475.059) (-473.443) (-474.740) -- 0:00:26
549000 -- (-474.451) (-473.726) (-473.180) [-476.661] * (-473.777) (-475.902) (-475.017) [-477.987] -- 0:00:26
549500 -- (-476.556) (-474.903) (-476.198) [-477.098] * (-475.669) (-478.105) (-477.722) [-474.907] -- 0:00:26
550000 -- (-475.386) (-473.438) (-476.279) [-474.317] * [-475.590] (-476.182) (-473.948) (-473.261) -- 0:00:27
Average standard deviation of split frequencies: 0.007819
550500 -- (-478.595) [-472.986] (-475.123) (-474.593) * [-472.355] (-475.393) (-472.972) (-475.181) -- 0:00:26
551000 -- (-477.201) (-473.195) (-478.843) [-474.745] * [-473.095] (-476.068) (-474.580) (-474.016) -- 0:00:26
551500 -- [-473.109] (-474.228) (-474.071) (-475.672) * (-473.364) (-476.311) (-473.610) [-473.395] -- 0:00:26
552000 -- (-475.505) (-475.431) (-479.145) [-473.697] * (-476.678) (-476.782) [-475.810] (-474.427) -- 0:00:26
552500 -- [-474.147] (-475.374) (-474.862) (-474.220) * (-475.986) [-477.340] (-475.541) (-474.938) -- 0:00:26
553000 -- [-475.522] (-474.607) (-474.261) (-476.168) * (-475.281) [-474.544] (-472.700) (-472.676) -- 0:00:26
553500 -- (-476.255) (-474.054) [-473.625] (-475.715) * (-476.478) [-475.960] (-475.424) (-473.161) -- 0:00:26
554000 -- (-475.994) [-472.645] (-473.939) (-473.258) * (-474.654) [-480.289] (-476.299) (-474.651) -- 0:00:26
554500 -- [-473.948] (-475.161) (-474.979) (-475.931) * (-474.847) (-475.917) (-477.096) [-475.441] -- 0:00:26
555000 -- [-476.991] (-473.711) (-479.801) (-474.703) * (-473.040) [-472.605] (-475.620) (-474.732) -- 0:00:26
Average standard deviation of split frequencies: 0.007744
555500 -- (-476.124) (-480.101) (-478.706) [-473.951] * [-475.011] (-472.820) (-479.381) (-474.871) -- 0:00:26
556000 -- (-474.499) [-474.402] (-479.044) (-474.686) * [-472.671] (-473.019) (-476.344) (-476.092) -- 0:00:26
556500 -- [-478.430] (-472.846) (-473.619) (-478.225) * (-476.367) [-472.831] (-474.795) (-473.768) -- 0:00:26
557000 -- [-473.111] (-474.215) (-473.604) (-477.157) * (-476.596) [-474.208] (-472.323) (-474.178) -- 0:00:26
557500 -- (-473.556) (-472.791) [-474.407] (-477.874) * (-473.266) (-472.678) [-472.660] (-472.522) -- 0:00:26
558000 -- (-472.232) (-475.884) [-474.016] (-476.241) * (-476.816) (-473.300) [-473.514] (-475.161) -- 0:00:26
558500 -- (-475.231) [-473.277] (-474.409) (-478.261) * (-473.694) [-475.361] (-476.782) (-476.725) -- 0:00:26
559000 -- (-478.333) (-475.468) (-477.836) [-476.069] * [-474.135] (-476.647) (-475.998) (-478.935) -- 0:00:26
559500 -- (-475.541) [-472.451] (-474.577) (-475.445) * (-473.722) (-479.454) [-475.392] (-480.985) -- 0:00:25
560000 -- (-477.750) (-474.081) [-476.809] (-473.997) * (-473.824) (-473.619) (-474.901) [-474.879] -- 0:00:25
Average standard deviation of split frequencies: 0.008408
560500 -- (-475.173) [-476.584] (-475.009) (-479.569) * (-473.999) [-476.864] (-472.847) (-474.046) -- 0:00:25
561000 -- [-473.665] (-477.220) (-473.269) (-473.885) * (-473.696) (-478.395) [-476.600] (-476.109) -- 0:00:25
561500 -- (-472.762) [-474.133] (-475.614) (-476.809) * (-472.458) (-473.734) (-473.049) [-473.209] -- 0:00:25
562000 -- (-477.068) (-472.927) [-474.194] (-475.975) * [-472.241] (-472.979) (-473.735) (-473.352) -- 0:00:25
562500 -- (-475.631) (-475.062) [-473.497] (-473.384) * (-472.212) (-474.650) (-473.951) [-474.666] -- 0:00:25
563000 -- (-475.759) (-474.027) (-473.744) [-473.167] * (-476.044) (-473.404) (-473.430) [-472.653] -- 0:00:25
563500 -- (-475.492) (-476.001) [-473.162] (-473.101) * (-475.480) (-478.367) (-473.052) [-478.553] -- 0:00:25
564000 -- (-475.604) [-476.973] (-476.421) (-472.997) * (-477.996) [-473.747] (-473.870) (-478.005) -- 0:00:25
564500 -- [-473.178] (-473.768) (-474.633) (-473.075) * (-474.132) (-473.909) (-472.838) [-478.824] -- 0:00:25
565000 -- [-474.418] (-472.418) (-474.089) (-473.792) * (-480.049) (-474.206) [-472.773] (-476.896) -- 0:00:25
Average standard deviation of split frequencies: 0.008107
565500 -- [-473.331] (-473.247) (-475.649) (-473.798) * [-474.359] (-473.113) (-473.436) (-476.907) -- 0:00:25
566000 -- [-473.427] (-474.538) (-473.660) (-475.108) * [-473.560] (-476.127) (-474.095) (-474.565) -- 0:00:26
566500 -- (-472.475) [-475.193] (-473.198) (-474.115) * (-473.491) (-475.488) (-473.582) [-473.706] -- 0:00:26
567000 -- (-474.057) [-477.558] (-475.454) (-473.739) * (-474.252) (-475.670) (-475.528) [-477.141] -- 0:00:25
567500 -- (-475.683) [-474.129] (-475.326) (-478.684) * (-474.950) (-475.781) (-473.706) [-473.866] -- 0:00:25
568000 -- (-474.725) (-474.371) [-477.764] (-473.734) * (-476.454) (-473.880) (-474.457) [-474.796] -- 0:00:25
568500 -- (-473.379) [-474.565] (-474.415) (-476.487) * (-474.689) [-472.917] (-475.274) (-475.397) -- 0:00:25
569000 -- (-473.483) (-473.533) (-474.369) [-472.914] * [-473.106] (-477.586) (-477.115) (-476.995) -- 0:00:25
569500 -- [-474.489] (-473.543) (-476.620) (-475.735) * (-475.823) (-474.289) (-473.649) [-475.060] -- 0:00:25
570000 -- [-473.624] (-477.523) (-476.747) (-475.096) * (-473.832) [-475.099] (-472.115) (-476.113) -- 0:00:25
Average standard deviation of split frequencies: 0.008536
570500 -- (-472.591) (-473.871) (-473.193) [-474.497] * (-472.841) (-474.773) (-473.922) [-472.763] -- 0:00:25
571000 -- (-475.143) (-476.920) [-474.424] (-477.924) * (-474.810) [-478.024] (-475.081) (-475.086) -- 0:00:25
571500 -- [-473.588] (-473.061) (-475.479) (-474.173) * (-477.932) (-475.622) (-478.165) [-473.797] -- 0:00:25
572000 -- [-475.536] (-474.639) (-473.963) (-472.623) * (-475.874) (-477.920) [-473.715] (-474.913) -- 0:00:25
572500 -- (-474.374) [-474.638] (-472.747) (-472.363) * (-474.295) (-473.298) (-477.717) [-475.460] -- 0:00:25
573000 -- (-473.969) (-473.210) (-472.756) [-474.862] * [-472.361] (-477.029) (-478.146) (-480.459) -- 0:00:25
573500 -- [-473.635] (-475.399) (-473.402) (-473.948) * [-473.506] (-473.739) (-475.883) (-480.021) -- 0:00:25
574000 -- (-474.325) (-474.676) (-472.467) [-475.010] * [-473.691] (-473.846) (-477.728) (-476.448) -- 0:00:25
574500 -- (-473.926) [-476.382] (-476.374) (-473.464) * (-473.513) [-476.817] (-475.560) (-476.692) -- 0:00:25
575000 -- (-475.218) (-478.257) (-473.805) [-474.152] * (-476.240) (-475.933) (-472.816) [-478.990] -- 0:00:25
Average standard deviation of split frequencies: 0.009112
575500 -- [-472.777] (-475.524) (-475.235) (-482.943) * (-477.039) [-474.168] (-476.625) (-476.761) -- 0:00:25
576000 -- (-472.896) (-478.288) [-473.935] (-474.084) * [-476.531] (-475.029) (-475.675) (-473.084) -- 0:00:25
576500 -- (-477.690) (-475.885) [-472.972] (-477.984) * (-474.574) [-474.331] (-474.172) (-475.336) -- 0:00:24
577000 -- (-479.760) [-477.197] (-472.973) (-474.695) * (-474.677) (-475.072) (-474.255) [-478.063] -- 0:00:24
577500 -- [-474.141] (-475.196) (-475.048) (-475.930) * (-472.968) [-474.813] (-473.583) (-481.462) -- 0:00:24
578000 -- [-474.741] (-474.674) (-473.909) (-473.422) * (-473.135) (-480.215) (-473.357) [-478.885] -- 0:00:24
578500 -- (-479.381) [-473.152] (-474.086) (-475.877) * (-473.032) (-474.806) [-472.814] (-474.985) -- 0:00:24
579000 -- [-475.174] (-473.918) (-473.868) (-474.347) * (-476.078) [-475.819] (-479.531) (-474.698) -- 0:00:24
579500 -- (-475.496) [-472.888] (-474.010) (-473.508) * (-476.336) [-473.250] (-476.824) (-478.909) -- 0:00:24
580000 -- (-476.768) [-476.180] (-474.315) (-474.836) * (-474.382) (-474.640) (-475.032) [-472.744] -- 0:00:24
Average standard deviation of split frequencies: 0.008335
580500 -- (-472.674) (-475.480) [-474.681] (-473.936) * (-476.564) [-473.545] (-473.403) (-472.742) -- 0:00:24
581000 -- (-472.537) (-478.067) (-475.505) [-473.978] * (-476.748) (-473.501) [-475.467] (-478.308) -- 0:00:24
581500 -- (-476.194) [-476.863] (-476.151) (-473.121) * [-478.266] (-473.618) (-476.828) (-474.464) -- 0:00:24
582000 -- (-474.049) (-474.230) (-474.031) [-473.572] * [-473.233] (-473.499) (-473.895) (-476.463) -- 0:00:24
582500 -- (-478.974) (-476.407) [-473.725] (-475.357) * (-474.720) (-477.227) (-472.264) [-477.727] -- 0:00:24
583000 -- [-474.018] (-477.608) (-475.989) (-473.602) * (-477.498) (-475.526) [-473.490] (-474.624) -- 0:00:24
583500 -- (-474.229) (-473.014) [-476.476] (-475.647) * (-475.974) (-474.227) [-474.528] (-472.896) -- 0:00:24
584000 -- (-476.133) (-474.143) (-476.295) [-473.185] * (-472.928) [-473.185] (-474.138) (-474.034) -- 0:00:24
584500 -- (-475.504) (-476.034) [-472.902] (-481.803) * (-475.520) (-473.510) [-472.194] (-476.034) -- 0:00:24
585000 -- (-478.750) [-474.307] (-474.073) (-474.291) * (-474.892) (-475.600) [-475.072] (-475.476) -- 0:00:24
Average standard deviation of split frequencies: 0.008742
585500 -- (-473.011) (-473.093) [-475.069] (-473.008) * [-474.821] (-473.973) (-474.289) (-475.948) -- 0:00:24
586000 -- (-473.349) [-473.088] (-472.944) (-474.233) * [-474.184] (-474.273) (-473.295) (-478.167) -- 0:00:24
586500 -- (-473.897) (-474.202) (-472.352) [-473.757] * (-473.367) (-474.051) (-473.106) [-474.202] -- 0:00:24
587000 -- (-473.216) (-477.831) (-473.284) [-477.361] * [-473.709] (-474.418) (-473.227) (-472.356) -- 0:00:24
587500 -- (-473.766) (-474.311) [-473.935] (-476.359) * (-473.102) [-473.115] (-476.270) (-472.510) -- 0:00:24
588000 -- [-474.553] (-477.535) (-478.637) (-480.189) * (-478.786) (-475.578) (-475.956) [-472.818] -- 0:00:24
588500 -- (-480.372) (-475.562) (-474.685) [-473.183] * [-472.372] (-476.448) (-478.005) (-476.521) -- 0:00:24
589000 -- (-479.425) (-474.459) [-473.314] (-474.687) * [-473.861] (-472.949) (-475.763) (-476.561) -- 0:00:24
589500 -- (-485.817) (-475.587) [-473.259] (-476.026) * (-474.712) (-475.396) [-473.004] (-475.399) -- 0:00:24
590000 -- [-472.634] (-474.302) (-473.471) (-476.734) * (-476.541) (-475.106) [-475.456] (-474.112) -- 0:00:24
Average standard deviation of split frequencies: 0.008087
590500 -- [-472.970] (-474.612) (-472.652) (-475.006) * [-479.161] (-474.280) (-473.714) (-475.687) -- 0:00:24
591000 -- (-477.778) [-475.235] (-480.173) (-476.774) * [-473.039] (-474.843) (-475.293) (-474.736) -- 0:00:24
591500 -- (-473.773) (-473.923) (-481.566) [-474.634] * (-473.578) (-475.441) [-476.173] (-481.651) -- 0:00:24
592000 -- (-472.929) [-473.140] (-477.383) (-473.184) * (-473.754) (-474.196) [-472.684] (-473.803) -- 0:00:24
592500 -- [-474.900] (-478.234) (-473.033) (-474.154) * (-475.227) (-476.047) (-474.566) [-472.893] -- 0:00:24
593000 -- (-473.094) (-476.382) [-474.557] (-474.262) * (-475.732) (-472.998) (-476.485) [-474.060] -- 0:00:24
593500 -- (-473.213) [-476.278] (-472.863) (-475.743) * (-474.462) (-473.248) (-474.176) [-475.139] -- 0:00:23
594000 -- (-473.064) (-476.179) (-473.539) [-474.975] * (-475.430) (-475.493) [-474.125] (-475.152) -- 0:00:23
594500 -- [-472.249] (-475.183) (-473.333) (-477.380) * [-475.392] (-475.209) (-474.789) (-477.723) -- 0:00:23
595000 -- (-477.014) (-478.234) (-473.540) [-476.039] * (-477.063) (-473.174) [-473.728] (-476.737) -- 0:00:23
Average standard deviation of split frequencies: 0.008279
595500 -- (-479.570) (-475.591) (-472.813) [-472.636] * [-472.757] (-475.861) (-475.503) (-474.094) -- 0:00:23
596000 -- (-478.764) (-476.574) [-472.481] (-473.100) * (-473.460) (-475.459) [-475.516] (-473.153) -- 0:00:23
596500 -- (-473.440) (-473.217) [-473.278] (-473.323) * (-474.592) (-474.079) (-472.443) [-476.326] -- 0:00:23
597000 -- (-474.762) [-474.243] (-473.589) (-476.823) * [-472.653] (-473.182) (-477.328) (-478.406) -- 0:00:23
597500 -- (-474.384) (-472.749) (-472.689) [-473.696] * (-474.008) [-473.172] (-472.785) (-473.168) -- 0:00:23
598000 -- [-472.824] (-472.864) (-474.940) (-472.563) * [-473.575] (-473.180) (-473.143) (-473.330) -- 0:00:23
598500 -- (-472.794) (-475.770) [-474.992] (-473.637) * [-474.143] (-477.388) (-473.817) (-476.199) -- 0:00:23
599000 -- (-474.239) (-472.234) [-473.122] (-476.383) * (-475.949) [-473.972] (-474.639) (-474.141) -- 0:00:23
599500 -- (-473.209) (-477.116) [-477.154] (-474.067) * [-474.056] (-472.341) (-476.837) (-474.875) -- 0:00:23
600000 -- (-480.697) (-475.573) [-477.199] (-473.957) * (-473.249) (-472.723) [-474.774] (-475.505) -- 0:00:23
Average standard deviation of split frequencies: 0.008319
600500 -- (-476.947) (-473.036) [-473.363] (-473.585) * (-472.590) [-476.217] (-476.002) (-476.006) -- 0:00:23
601000 -- (-474.197) [-473.170] (-474.831) (-473.533) * (-476.737) (-477.648) (-474.053) [-475.997] -- 0:00:23
601500 -- (-477.737) (-472.884) [-475.374] (-475.720) * (-473.417) (-478.896) (-476.430) [-474.223] -- 0:00:23
602000 -- [-476.497] (-477.297) (-473.411) (-478.040) * (-472.801) (-478.473) (-473.996) [-473.722] -- 0:00:23
602500 -- (-478.902) (-478.999) [-473.558] (-477.433) * (-474.077) [-476.859] (-475.395) (-475.432) -- 0:00:23
603000 -- (-474.414) (-475.726) [-474.098] (-476.298) * (-475.153) (-475.725) [-473.326] (-476.655) -- 0:00:23
603500 -- (-474.248) [-473.023] (-480.319) (-474.944) * (-474.241) (-473.826) [-473.443] (-475.565) -- 0:00:23
604000 -- [-474.353] (-477.808) (-479.679) (-476.247) * (-473.492) [-472.821] (-475.380) (-474.879) -- 0:00:23
604500 -- [-475.148] (-475.303) (-477.765) (-477.739) * (-473.908) (-474.654) [-476.962] (-476.227) -- 0:00:23
605000 -- (-473.283) (-475.553) [-475.547] (-476.625) * (-475.518) (-473.790) [-473.207] (-472.599) -- 0:00:23
Average standard deviation of split frequencies: 0.008217
605500 -- [-475.508] (-474.278) (-483.958) (-474.422) * (-476.412) [-477.214] (-474.317) (-475.112) -- 0:00:23
606000 -- [-474.734] (-475.809) (-473.012) (-473.415) * (-476.226) (-475.022) [-474.175] (-474.102) -- 0:00:23
606500 -- (-473.612) (-472.805) [-477.113] (-475.703) * (-482.151) (-475.057) (-477.218) [-474.981] -- 0:00:23
607000 -- [-476.011] (-472.712) (-479.951) (-477.665) * [-475.747] (-474.493) (-475.570) (-478.114) -- 0:00:23
607500 -- [-474.402] (-474.227) (-475.722) (-476.050) * (-473.950) (-472.835) (-474.993) [-475.909] -- 0:00:23
608000 -- (-474.030) (-473.705) (-474.629) [-473.341] * [-473.400] (-473.605) (-476.762) (-478.030) -- 0:00:23
608500 -- [-473.416] (-473.876) (-473.916) (-474.770) * [-472.912] (-473.972) (-472.847) (-481.040) -- 0:00:23
609000 -- (-476.028) (-473.440) [-472.755] (-474.799) * (-472.214) (-477.501) (-475.111) [-476.866] -- 0:00:23
609500 -- (-478.459) (-474.847) (-472.802) [-476.894] * (-474.518) [-473.008] (-481.353) (-474.275) -- 0:00:23
610000 -- (-473.268) [-478.161] (-474.304) (-476.535) * (-475.304) (-472.943) (-478.307) [-472.899] -- 0:00:23
Average standard deviation of split frequencies: 0.008974
610500 -- (-475.165) (-474.569) (-473.420) [-476.694] * (-473.017) (-473.876) [-474.129] (-473.663) -- 0:00:22
611000 -- [-474.628] (-479.746) (-472.801) (-473.014) * (-474.243) (-476.273) [-473.357] (-473.562) -- 0:00:22
611500 -- (-474.038) (-479.334) (-473.230) [-473.464] * (-479.246) (-476.054) (-472.460) [-474.363] -- 0:00:22
612000 -- (-479.655) (-478.004) (-472.871) [-473.491] * (-476.284) (-476.399) [-472.311] (-476.779) -- 0:00:22
612500 -- (-480.301) [-475.008] (-473.115) (-474.720) * (-473.449) (-474.605) (-478.890) [-474.176] -- 0:00:22
613000 -- [-478.466] (-478.960) (-474.140) (-473.265) * (-475.026) (-475.102) [-473.842] (-477.172) -- 0:00:22
613500 -- [-473.179] (-481.368) (-475.101) (-473.634) * (-473.274) [-474.186] (-472.878) (-473.767) -- 0:00:22
614000 -- (-474.779) [-473.606] (-476.944) (-474.838) * [-472.780] (-472.623) (-472.654) (-480.730) -- 0:00:22
614500 -- [-473.289] (-473.681) (-477.581) (-474.146) * (-472.636) (-473.616) [-472.801] (-476.049) -- 0:00:22
615000 -- (-473.960) (-473.001) [-473.208] (-474.570) * (-473.073) (-473.114) (-480.435) [-476.670] -- 0:00:22
Average standard deviation of split frequencies: 0.009642
615500 -- [-473.157] (-473.723) (-475.957) (-472.876) * [-473.906] (-475.076) (-474.065) (-475.400) -- 0:00:22
616000 -- (-474.480) (-475.240) (-474.175) [-472.929] * (-477.265) [-474.592] (-474.694) (-475.728) -- 0:00:22
616500 -- [-472.507] (-478.766) (-479.473) (-474.278) * (-473.251) (-477.134) (-477.619) [-474.739] -- 0:00:22
617000 -- (-476.450) (-472.844) (-474.571) [-472.693] * (-476.506) (-476.706) (-474.829) [-472.805] -- 0:00:22
617500 -- (-475.624) (-474.696) (-475.359) [-472.159] * (-477.889) (-475.142) (-473.360) [-473.446] -- 0:00:22
618000 -- (-473.341) (-473.483) [-475.366] (-474.647) * [-474.374] (-473.643) (-473.898) (-475.561) -- 0:00:22
618500 -- [-473.225] (-473.415) (-476.385) (-473.996) * (-477.181) (-476.844) (-475.708) [-472.518] -- 0:00:22
619000 -- (-473.131) (-473.147) (-474.729) [-475.835] * (-474.876) (-475.325) (-472.939) [-474.870] -- 0:00:22
619500 -- (-473.484) (-475.134) [-475.809] (-477.303) * (-473.939) [-473.939] (-473.944) (-476.577) -- 0:00:22
620000 -- (-476.131) (-476.061) (-474.137) [-473.177] * (-474.520) (-474.430) [-472.365] (-474.714) -- 0:00:22
Average standard deviation of split frequencies: 0.009215
620500 -- (-472.964) (-476.148) (-473.481) [-475.594] * (-477.838) (-474.846) [-474.068] (-474.016) -- 0:00:22
621000 -- (-472.886) [-472.946] (-476.531) (-475.783) * [-474.474] (-475.704) (-472.672) (-475.057) -- 0:00:22
621500 -- [-473.434] (-474.061) (-476.339) (-473.819) * [-473.871] (-473.634) (-472.361) (-476.517) -- 0:00:22
622000 -- [-472.731] (-474.979) (-475.130) (-475.900) * (-475.969) (-474.776) [-475.274] (-475.626) -- 0:00:22
622500 -- (-472.567) [-474.501] (-483.092) (-475.336) * [-473.600] (-474.085) (-472.438) (-474.413) -- 0:00:22
623000 -- (-478.103) (-473.450) (-474.049) [-475.353] * [-473.036] (-475.400) (-472.851) (-476.756) -- 0:00:22
623500 -- (-474.384) [-474.584] (-475.057) (-474.807) * (-473.470) (-476.314) (-473.960) [-474.094] -- 0:00:22
624000 -- [-476.986] (-472.695) (-476.596) (-476.010) * (-475.082) (-478.581) [-472.649] (-473.452) -- 0:00:22
624500 -- (-474.135) [-473.965] (-475.109) (-475.426) * [-472.268] (-473.811) (-473.857) (-473.597) -- 0:00:22
625000 -- [-473.434] (-477.610) (-478.705) (-475.854) * [-475.480] (-477.396) (-477.685) (-472.823) -- 0:00:22
Average standard deviation of split frequencies: 0.008886
625500 -- (-475.370) (-474.652) (-475.853) [-476.604] * (-473.419) (-473.944) (-482.036) [-474.064] -- 0:00:22
626000 -- (-473.705) (-474.270) [-476.456] (-473.475) * [-474.472] (-474.498) (-474.274) (-472.568) -- 0:00:22
626500 -- (-474.384) (-475.404) [-476.151] (-473.620) * (-475.009) (-474.191) [-472.615] (-475.479) -- 0:00:22
627000 -- (-472.450) (-472.777) (-476.166) [-474.323] * (-476.166) (-474.750) (-472.687) [-473.239] -- 0:00:22
627500 -- (-474.324) (-473.304) (-472.719) [-474.173] * (-473.754) [-473.773] (-473.577) (-474.463) -- 0:00:21
628000 -- (-475.460) [-472.145] (-472.923) (-473.650) * (-480.976) (-476.108) [-474.964] (-476.097) -- 0:00:21
628500 -- [-476.119] (-472.821) (-476.953) (-473.715) * (-474.956) (-475.399) [-473.932] (-472.880) -- 0:00:21
629000 -- (-474.725) (-474.591) (-474.099) [-473.675] * (-473.548) [-477.709] (-474.870) (-474.715) -- 0:00:21
629500 -- (-477.362) (-475.424) (-473.782) [-475.117] * (-476.299) (-475.411) (-483.432) [-474.313] -- 0:00:21
630000 -- [-474.339] (-477.754) (-474.216) (-474.090) * (-478.364) (-476.531) [-472.140] (-475.073) -- 0:00:21
Average standard deviation of split frequencies: 0.008720
630500 -- [-474.361] (-473.601) (-473.752) (-472.884) * (-475.679) (-475.917) [-474.493] (-473.618) -- 0:00:21
631000 -- [-479.835] (-479.451) (-473.369) (-474.425) * (-474.574) (-474.268) [-479.201] (-474.206) -- 0:00:21
631500 -- [-472.752] (-474.893) (-474.549) (-475.360) * [-472.152] (-473.696) (-475.203) (-475.770) -- 0:00:21
632000 -- [-472.435] (-473.091) (-474.429) (-473.909) * (-472.590) [-473.722] (-476.452) (-476.036) -- 0:00:21
632500 -- (-473.086) (-473.473) [-474.876] (-475.713) * [-473.230] (-474.462) (-475.689) (-475.716) -- 0:00:21
633000 -- (-472.729) [-475.053] (-473.987) (-472.832) * [-475.767] (-472.825) (-477.646) (-474.144) -- 0:00:21
633500 -- (-477.080) (-474.519) (-474.713) [-473.713] * (-472.637) [-476.778] (-473.378) (-475.126) -- 0:00:21
634000 -- [-477.672] (-473.052) (-474.143) (-474.243) * (-475.703) (-473.762) (-472.835) [-472.740] -- 0:00:21
634500 -- (-475.586) (-474.318) (-475.011) [-476.514] * (-472.320) (-474.484) (-473.314) [-475.346] -- 0:00:21
635000 -- (-474.299) (-476.099) (-476.627) [-473.089] * (-476.781) (-473.732) (-476.216) [-472.615] -- 0:00:21
Average standard deviation of split frequencies: 0.008647
635500 -- (-477.174) (-475.101) [-473.598] (-473.146) * (-473.708) (-474.849) (-472.297) [-478.749] -- 0:00:21
636000 -- [-474.201] (-476.285) (-477.128) (-473.409) * (-473.216) (-476.044) [-473.777] (-474.802) -- 0:00:21
636500 -- (-474.804) (-473.294) (-475.947) [-476.728] * [-474.009] (-477.621) (-474.040) (-473.973) -- 0:00:21
637000 -- (-474.708) (-474.482) (-474.449) [-473.505] * (-477.304) [-472.713] (-474.300) (-473.791) -- 0:00:21
637500 -- (-474.955) [-474.298] (-474.694) (-473.964) * (-476.351) (-472.597) [-473.778] (-473.047) -- 0:00:21
638000 -- (-474.386) [-473.202] (-474.951) (-474.250) * (-472.965) (-472.373) (-474.668) [-472.887] -- 0:00:21
638500 -- (-474.490) (-472.918) [-473.236] (-478.170) * (-474.729) (-474.882) (-476.695) [-473.795] -- 0:00:21
639000 -- [-478.268] (-478.427) (-473.983) (-477.899) * (-475.121) [-475.277] (-473.151) (-473.235) -- 0:00:21
639500 -- [-478.977] (-474.297) (-472.750) (-477.457) * (-476.322) (-477.217) [-473.522] (-475.951) -- 0:00:21
640000 -- (-473.157) (-474.014) (-473.441) [-475.142] * (-475.664) (-475.538) (-474.783) [-473.652] -- 0:00:21
Average standard deviation of split frequencies: 0.008781
640500 -- [-473.311] (-472.913) (-473.600) (-474.647) * (-475.219) (-476.204) [-474.268] (-476.328) -- 0:00:21
641000 -- (-474.190) (-473.440) [-476.328] (-473.661) * (-477.787) (-474.462) [-473.190] (-475.534) -- 0:00:21
641500 -- (-476.837) [-473.112] (-476.012) (-475.052) * (-475.220) (-472.405) [-474.270] (-476.932) -- 0:00:21
642000 -- (-480.186) (-476.299) [-474.828] (-474.478) * [-473.640] (-473.072) (-476.033) (-474.617) -- 0:00:21
642500 -- [-473.469] (-475.089) (-472.802) (-479.723) * (-473.943) (-474.179) (-476.928) [-476.123] -- 0:00:21
643000 -- (-473.919) (-474.429) (-474.303) [-473.046] * (-476.018) [-475.282] (-476.101) (-476.500) -- 0:00:21
643500 -- (-475.686) (-475.247) (-474.129) [-473.925] * (-474.948) (-484.535) [-474.311] (-473.810) -- 0:00:21
644000 -- (-473.165) (-472.640) [-476.071] (-474.001) * (-474.846) [-478.428] (-473.245) (-473.675) -- 0:00:21
644500 -- (-472.463) [-474.124] (-476.296) (-473.117) * (-472.254) (-479.207) [-477.432] (-481.731) -- 0:00:20
645000 -- (-477.937) (-477.333) [-476.509] (-478.487) * [-476.351] (-474.633) (-472.470) (-477.193) -- 0:00:20
Average standard deviation of split frequencies: 0.007784
645500 -- [-474.199] (-476.498) (-475.351) (-473.298) * [-474.355] (-475.128) (-475.334) (-476.238) -- 0:00:20
646000 -- (-475.696) (-472.791) [-477.877] (-472.918) * (-474.606) [-477.173] (-475.309) (-474.147) -- 0:00:20
646500 -- (-477.013) [-472.674] (-475.834) (-474.007) * (-474.080) (-478.145) (-483.594) [-474.532] -- 0:00:20
647000 -- [-473.570] (-473.821) (-473.551) (-475.837) * (-473.677) [-472.285] (-480.429) (-474.579) -- 0:00:20
647500 -- (-472.954) [-474.115] (-472.854) (-476.002) * [-473.209] (-472.479) (-472.976) (-476.014) -- 0:00:20
648000 -- (-475.861) [-474.421] (-477.027) (-475.120) * (-473.911) (-474.356) [-472.948] (-473.537) -- 0:00:20
648500 -- (-473.341) (-477.162) (-474.507) [-474.654] * (-475.548) [-474.109] (-477.442) (-475.733) -- 0:00:20
649000 -- [-473.023] (-479.200) (-477.036) (-474.568) * (-474.613) [-473.339] (-475.941) (-474.504) -- 0:00:20
649500 -- (-477.606) (-474.172) (-475.787) [-476.972] * (-472.898) (-473.612) (-474.463) [-476.214] -- 0:00:20
650000 -- (-472.577) (-475.651) (-474.342) [-476.527] * (-472.826) (-476.729) (-473.500) [-474.710] -- 0:00:20
Average standard deviation of split frequencies: 0.007969
650500 -- [-473.768] (-474.344) (-472.963) (-473.753) * (-472.711) [-473.414] (-475.630) (-473.471) -- 0:00:20
651000 -- [-475.334] (-472.913) (-476.427) (-474.596) * [-474.654] (-473.254) (-477.727) (-474.687) -- 0:00:20
651500 -- [-472.230] (-474.027) (-473.696) (-474.455) * (-472.710) [-476.397] (-477.301) (-473.787) -- 0:00:20
652000 -- [-472.772] (-475.153) (-477.049) (-474.187) * [-476.751] (-473.655) (-474.429) (-474.353) -- 0:00:20
652500 -- (-474.077) (-474.540) (-474.754) [-474.323] * (-476.159) (-473.227) (-473.420) [-473.410] -- 0:00:20
653000 -- (-476.820) (-473.573) (-474.806) [-473.657] * (-475.036) (-476.489) (-472.585) [-472.993] -- 0:00:20
653500 -- (-477.534) [-473.970] (-478.522) (-475.263) * (-479.885) (-477.768) (-474.600) [-474.095] -- 0:00:20
654000 -- (-475.255) (-474.119) (-476.669) [-474.323] * (-475.401) (-477.327) (-475.853) [-474.889] -- 0:00:20
654500 -- (-474.242) (-473.625) (-473.679) [-476.073] * [-473.393] (-479.364) (-472.974) (-473.193) -- 0:00:20
655000 -- [-473.731] (-473.050) (-473.615) (-480.767) * (-475.003) (-474.926) (-474.306) [-473.703] -- 0:00:20
Average standard deviation of split frequencies: 0.007569
655500 -- (-474.636) [-476.538] (-475.121) (-474.118) * (-474.458) [-474.315] (-474.315) (-474.379) -- 0:00:20
656000 -- [-473.298] (-475.267) (-477.617) (-475.121) * (-474.729) (-475.181) [-475.954] (-476.023) -- 0:00:20
656500 -- (-473.797) (-473.288) [-476.688] (-473.889) * (-476.989) (-475.670) (-474.369) [-477.672] -- 0:00:20
657000 -- (-473.191) (-479.636) (-473.443) [-475.246] * (-476.095) (-476.208) (-474.490) [-474.943] -- 0:00:20
657500 -- (-474.386) (-479.518) [-476.444] (-475.856) * (-474.376) [-475.538] (-473.700) (-475.147) -- 0:00:20
658000 -- (-472.660) [-474.935] (-478.871) (-476.032) * (-473.480) [-478.876] (-477.769) (-474.653) -- 0:00:20
658500 -- (-474.867) [-473.535] (-476.742) (-477.043) * [-473.613] (-474.299) (-476.813) (-475.268) -- 0:00:20
659000 -- (-473.985) (-473.746) (-473.613) [-473.286] * (-477.970) (-477.366) [-474.483] (-478.015) -- 0:00:20
659500 -- (-473.233) (-472.697) [-476.915] (-472.943) * [-475.298] (-476.675) (-482.212) (-472.549) -- 0:00:20
660000 -- [-474.844] (-474.294) (-473.019) (-476.844) * (-475.644) [-478.041] (-476.881) (-477.821) -- 0:00:20
Average standard deviation of split frequencies: 0.008229
660500 -- (-475.564) (-473.814) [-478.960] (-476.690) * [-475.047] (-480.772) (-473.195) (-475.359) -- 0:00:20
661000 -- (-473.417) [-472.449] (-477.259) (-474.160) * (-474.955) [-475.335] (-473.499) (-474.447) -- 0:00:20
661500 -- [-473.541] (-477.905) (-477.780) (-475.443) * (-475.429) (-475.198) [-475.263] (-475.817) -- 0:00:19
662000 -- (-473.376) (-477.093) [-476.044] (-476.419) * (-475.178) [-475.243] (-477.129) (-474.135) -- 0:00:19
662500 -- (-474.019) [-475.971] (-475.700) (-477.285) * (-477.687) (-472.374) [-477.485] (-475.175) -- 0:00:19
663000 -- (-475.400) (-477.117) [-473.170] (-476.620) * (-474.913) (-472.711) [-474.688] (-475.972) -- 0:00:19
663500 -- [-473.467] (-479.361) (-473.810) (-475.256) * [-474.337] (-472.716) (-472.568) (-480.822) -- 0:00:19
664000 -- (-474.220) (-475.957) [-474.620] (-475.598) * (-472.941) (-477.045) [-472.601] (-477.845) -- 0:00:19
664500 -- (-474.151) (-477.399) [-473.223] (-475.439) * (-473.366) [-474.086] (-473.823) (-472.640) -- 0:00:19
665000 -- [-473.499] (-474.153) (-473.109) (-473.770) * (-475.122) [-476.697] (-476.773) (-473.607) -- 0:00:19
Average standard deviation of split frequencies: 0.008211
665500 -- (-474.251) (-474.562) [-475.061] (-475.554) * (-472.947) (-475.846) (-473.528) [-474.117] -- 0:00:19
666000 -- (-473.902) [-474.014] (-475.694) (-476.960) * (-479.402) [-472.534] (-477.050) (-475.029) -- 0:00:19
666500 -- [-476.309] (-473.874) (-476.278) (-473.860) * (-474.170) (-473.092) (-473.455) [-475.056] -- 0:00:19
667000 -- [-476.061] (-473.835) (-476.212) (-472.761) * [-474.708] (-473.174) (-473.889) (-476.541) -- 0:00:19
667500 -- [-474.582] (-479.026) (-474.211) (-472.674) * [-475.665] (-476.545) (-474.214) (-474.107) -- 0:00:19
668000 -- [-474.425] (-474.538) (-473.102) (-477.882) * (-474.033) (-477.196) [-473.473] (-475.035) -- 0:00:19
668500 -- (-474.929) (-475.117) [-473.668] (-475.537) * [-473.247] (-478.660) (-478.087) (-473.383) -- 0:00:19
669000 -- (-472.611) [-475.657] (-473.916) (-473.989) * (-473.353) (-472.737) (-475.045) [-475.186] -- 0:00:19
669500 -- [-472.617] (-473.619) (-473.401) (-473.333) * (-474.240) [-472.975] (-477.783) (-472.679) -- 0:00:19
670000 -- [-473.619] (-472.892) (-476.516) (-477.216) * [-473.452] (-472.984) (-476.415) (-474.289) -- 0:00:19
Average standard deviation of split frequencies: 0.008528
670500 -- (-477.914) (-474.612) [-473.196] (-476.678) * (-473.925) (-473.660) [-473.476] (-475.133) -- 0:00:19
671000 -- (-475.031) (-474.439) [-473.766] (-473.742) * (-473.440) (-477.311) [-475.516] (-474.830) -- 0:00:19
671500 -- (-474.329) [-475.755] (-473.972) (-474.306) * (-479.438) (-474.334) [-473.303] (-475.411) -- 0:00:19
672000 -- (-475.597) (-473.601) [-477.488] (-474.876) * (-474.179) [-474.958] (-474.259) (-474.072) -- 0:00:19
672500 -- [-473.131] (-477.415) (-474.151) (-474.286) * (-473.887) (-473.096) (-477.600) [-473.748] -- 0:00:19
673000 -- (-475.989) (-473.234) [-474.449] (-475.267) * (-473.008) (-474.723) (-474.964) [-474.372] -- 0:00:19
673500 -- (-472.588) (-473.635) [-473.362] (-474.982) * (-473.339) (-474.252) [-475.903] (-474.573) -- 0:00:19
674000 -- [-473.691] (-473.865) (-478.448) (-473.472) * (-473.496) (-479.792) [-473.783] (-474.575) -- 0:00:19
674500 -- (-473.219) [-476.080] (-472.674) (-476.238) * [-474.097] (-475.735) (-478.718) (-475.816) -- 0:00:19
675000 -- (-478.833) [-473.373] (-474.132) (-474.257) * (-474.225) [-474.747] (-477.008) (-474.358) -- 0:00:19
Average standard deviation of split frequencies: 0.008508
675500 -- [-472.560] (-474.512) (-473.877) (-474.788) * (-472.464) (-474.045) [-472.482] (-473.690) -- 0:00:19
676000 -- (-474.844) (-474.077) [-475.356] (-475.565) * (-472.846) (-474.705) [-472.484] (-477.354) -- 0:00:19
676500 -- (-474.257) (-474.434) (-472.588) [-473.921] * (-474.330) (-472.502) (-472.221) [-473.584] -- 0:00:19
677000 -- (-476.407) (-477.094) [-474.430] (-477.267) * (-476.946) [-473.687] (-475.080) (-475.514) -- 0:00:19
677500 -- (-475.317) (-474.439) [-473.951] (-475.309) * (-481.027) [-474.144] (-475.809) (-475.179) -- 0:00:19
678000 -- (-479.426) (-474.953) [-476.610] (-474.169) * [-479.119] (-473.478) (-476.475) (-475.381) -- 0:00:18
678500 -- (-475.548) (-476.013) [-477.723] (-473.547) * [-476.145] (-479.678) (-477.148) (-474.888) -- 0:00:18
679000 -- (-474.216) (-474.220) (-473.845) [-473.334] * [-473.850] (-472.836) (-477.597) (-473.497) -- 0:00:18
679500 -- (-475.202) (-473.986) [-475.086] (-473.751) * (-474.723) (-476.266) (-477.686) [-478.015] -- 0:00:18
680000 -- (-477.043) (-478.075) (-472.718) [-473.065] * (-475.369) (-473.835) [-477.028] (-477.690) -- 0:00:18
Average standard deviation of split frequencies: 0.008634
680500 -- [-473.429] (-475.163) (-473.942) (-473.451) * (-474.661) [-473.659] (-478.610) (-475.774) -- 0:00:18
681000 -- [-472.944] (-474.929) (-476.649) (-475.384) * (-474.924) [-475.940] (-473.733) (-474.578) -- 0:00:18
681500 -- (-474.413) [-474.959] (-475.990) (-474.353) * (-475.415) (-473.643) [-473.548] (-473.261) -- 0:00:18
682000 -- (-474.310) [-475.809] (-473.288) (-474.334) * (-475.590) (-475.296) [-473.843] (-476.821) -- 0:00:18
682500 -- (-474.691) (-477.197) [-473.817] (-478.243) * (-475.142) (-476.403) (-475.334) [-475.446] -- 0:00:18
683000 -- [-473.350] (-479.947) (-474.386) (-475.317) * (-472.359) (-477.593) (-475.880) [-475.905] -- 0:00:18
683500 -- [-473.520] (-478.226) (-473.371) (-474.033) * (-474.640) (-474.267) [-474.288] (-474.251) -- 0:00:18
684000 -- (-478.159) (-474.701) [-472.590] (-474.033) * [-473.981] (-475.214) (-474.070) (-476.159) -- 0:00:18
684500 -- (-473.078) [-473.904] (-474.141) (-473.843) * (-480.410) [-474.074] (-472.320) (-473.094) -- 0:00:18
685000 -- (-472.663) (-473.339) (-474.213) [-472.973] * (-474.094) (-476.355) [-472.622] (-472.704) -- 0:00:18
Average standard deviation of split frequencies: 0.009254
685500 -- (-473.703) (-475.789) [-473.531] (-473.355) * (-474.813) (-473.844) (-472.962) [-473.033] -- 0:00:18
686000 -- (-473.904) (-473.984) [-476.174] (-474.268) * (-473.630) (-474.571) [-472.896] (-474.484) -- 0:00:18
686500 -- (-473.548) [-473.805] (-476.071) (-473.387) * (-473.820) [-475.526] (-478.604) (-473.973) -- 0:00:18
687000 -- (-474.345) (-474.789) (-474.725) [-472.339] * (-475.969) (-475.605) (-473.152) [-472.750] -- 0:00:18
687500 -- (-472.977) (-476.382) (-472.479) [-475.692] * (-478.249) (-472.680) [-473.194] (-474.232) -- 0:00:18
688000 -- (-472.416) [-474.308] (-474.916) (-476.555) * (-475.671) (-475.072) [-473.955] (-474.059) -- 0:00:18
688500 -- (-473.043) (-480.379) (-475.456) [-476.840] * (-475.377) (-475.674) [-472.890] (-474.946) -- 0:00:18
689000 -- (-472.550) (-477.041) (-473.202) [-473.896] * (-478.718) [-476.819] (-474.313) (-473.919) -- 0:00:18
689500 -- [-472.838] (-475.794) (-472.768) (-476.100) * (-477.726) (-475.513) (-473.687) [-474.793] -- 0:00:18
690000 -- (-475.196) [-472.713] (-474.478) (-473.184) * (-476.456) (-473.145) [-472.853] (-472.412) -- 0:00:18
Average standard deviation of split frequencies: 0.009191
690500 -- (-476.486) [-477.508] (-473.360) (-474.788) * (-476.837) (-474.956) [-472.927] (-476.443) -- 0:00:18
691000 -- (-476.232) (-476.011) [-472.471] (-475.560) * (-476.019) (-474.433) (-474.647) [-476.016] -- 0:00:18
691500 -- (-475.770) [-475.276] (-474.907) (-476.094) * (-475.375) (-475.594) (-474.988) [-473.256] -- 0:00:18
692000 -- [-475.096] (-475.421) (-473.534) (-478.712) * (-473.852) [-473.277] (-473.955) (-479.087) -- 0:00:18
692500 -- (-473.323) [-475.017] (-476.304) (-478.174) * (-479.398) (-474.281) (-473.237) [-472.634] -- 0:00:18
693000 -- (-473.141) (-474.906) (-475.239) [-484.139] * (-472.867) [-475.822] (-476.104) (-474.678) -- 0:00:18
693500 -- (-472.365) (-476.462) [-474.028] (-473.031) * (-473.599) (-477.655) (-473.122) [-473.926] -- 0:00:18
694000 -- (-474.463) (-477.660) (-474.380) [-473.354] * [-473.700] (-476.271) (-474.888) (-472.719) -- 0:00:18
694500 -- [-472.908] (-474.124) (-473.141) (-476.388) * (-477.218) (-473.318) (-474.540) [-477.169] -- 0:00:18
695000 -- [-473.158] (-477.920) (-472.552) (-474.625) * (-474.021) (-473.102) [-473.337] (-474.440) -- 0:00:17
Average standard deviation of split frequencies: 0.009347
695500 -- (-474.854) [-474.536] (-473.694) (-474.789) * (-475.465) (-474.175) [-474.620] (-476.044) -- 0:00:17
696000 -- [-474.128] (-476.334) (-477.055) (-475.529) * (-473.282) [-477.874] (-477.768) (-475.592) -- 0:00:17
696500 -- (-478.539) (-476.737) (-474.848) [-473.999] * (-474.050) [-472.553] (-477.883) (-472.296) -- 0:00:17
697000 -- (-487.370) (-480.624) (-474.139) [-473.844] * (-474.759) (-474.359) (-477.020) [-472.679] -- 0:00:17
697500 -- (-476.225) (-476.094) [-472.810] (-473.116) * (-473.487) (-472.827) [-474.876] (-473.358) -- 0:00:17
698000 -- (-484.006) (-476.252) [-472.201] (-472.938) * (-476.281) (-474.319) [-472.664] (-474.835) -- 0:00:17
698500 -- (-474.708) (-477.873) [-473.478] (-472.940) * [-474.033] (-473.259) (-475.064) (-476.387) -- 0:00:17
699000 -- [-472.426] (-475.505) (-476.855) (-476.091) * (-478.398) (-475.503) (-478.109) [-473.359] -- 0:00:17
699500 -- (-474.604) (-475.347) [-473.917] (-475.219) * (-474.311) [-474.528] (-476.044) (-474.947) -- 0:00:17
700000 -- (-473.405) (-473.557) [-476.628] (-476.209) * (-474.853) (-477.443) [-473.553] (-474.413) -- 0:00:17
Average standard deviation of split frequencies: 0.009599
700500 -- (-472.735) (-473.902) [-473.077] (-473.251) * (-473.032) (-476.418) [-473.941] (-474.934) -- 0:00:17
701000 -- (-478.181) (-473.257) [-473.200] (-472.885) * (-474.293) (-477.210) (-474.395) [-473.844] -- 0:00:17
701500 -- (-479.229) [-473.205] (-473.710) (-475.012) * (-474.566) (-475.493) [-473.965] (-473.758) -- 0:00:17
702000 -- (-478.315) (-473.982) [-474.323] (-472.765) * (-478.229) (-477.707) [-473.163] (-474.697) -- 0:00:17
702500 -- (-477.598) (-474.370) [-474.155] (-475.036) * (-474.130) (-474.381) (-474.727) [-473.669] -- 0:00:17
703000 -- (-473.614) (-472.834) [-474.075] (-477.116) * (-474.171) (-474.549) (-477.254) [-472.320] -- 0:00:17
703500 -- (-472.487) [-474.481] (-474.794) (-477.355) * [-472.323] (-476.010) (-474.546) (-473.242) -- 0:00:17
704000 -- (-474.019) (-475.655) (-472.735) [-477.188] * (-474.023) (-474.778) (-477.429) [-472.654] -- 0:00:17
704500 -- (-473.620) [-474.278] (-473.481) (-472.876) * (-478.703) [-475.641] (-478.233) (-481.284) -- 0:00:17
705000 -- (-474.089) (-474.060) [-474.058] (-477.812) * (-474.177) (-474.642) [-473.934] (-473.969) -- 0:00:17
Average standard deviation of split frequencies: 0.009571
705500 -- [-473.162] (-473.692) (-473.269) (-474.917) * (-479.367) (-474.219) [-472.670] (-472.908) -- 0:00:17
706000 -- (-476.063) [-476.648] (-474.258) (-472.073) * (-480.043) [-475.223] (-476.641) (-473.181) -- 0:00:17
706500 -- (-474.310) (-476.730) [-476.590] (-477.512) * (-478.750) [-474.100] (-481.172) (-473.547) -- 0:00:17
707000 -- [-473.853] (-475.221) (-473.415) (-475.525) * [-477.006] (-473.709) (-473.269) (-473.011) -- 0:00:17
707500 -- (-474.053) (-479.327) [-474.877] (-473.623) * [-475.823] (-474.482) (-473.566) (-476.581) -- 0:00:17
708000 -- (-474.757) (-474.051) [-474.596] (-477.578) * (-476.538) (-473.275) (-475.384) [-475.670] -- 0:00:17
708500 -- (-474.752) (-478.132) [-475.892] (-475.373) * (-476.544) (-474.175) [-476.060] (-476.313) -- 0:00:17
709000 -- (-474.770) (-474.462) [-474.753] (-476.813) * (-473.475) (-473.029) (-475.388) [-473.426] -- 0:00:17
709500 -- (-474.613) (-474.555) (-478.302) [-472.874] * [-474.635] (-474.256) (-473.663) (-476.280) -- 0:00:17
710000 -- (-477.223) [-472.804] (-476.601) (-474.105) * [-475.009] (-475.977) (-475.748) (-474.902) -- 0:00:17
Average standard deviation of split frequencies: 0.009110
710500 -- (-475.043) (-473.676) [-472.659] (-475.914) * (-473.533) [-476.414] (-473.048) (-474.472) -- 0:00:17
711000 -- (-472.798) [-476.216] (-476.741) (-475.324) * (-472.567) (-475.182) [-475.903] (-473.584) -- 0:00:17
711500 -- (-473.031) [-472.931] (-475.032) (-474.201) * (-477.782) [-477.403] (-474.127) (-472.545) -- 0:00:17
712000 -- (-473.060) (-473.625) (-475.525) [-475.400] * (-476.234) [-473.190] (-473.355) (-474.284) -- 0:00:16
712500 -- (-479.313) [-472.825] (-474.242) (-472.935) * (-472.487) [-474.184] (-472.927) (-473.953) -- 0:00:16
713000 -- (-474.437) (-474.169) [-473.345] (-475.488) * (-477.345) (-473.059) [-472.993] (-475.427) -- 0:00:16
713500 -- (-472.555) (-474.429) [-479.174] (-475.640) * (-476.995) (-474.319) (-474.283) [-476.960] -- 0:00:16
714000 -- (-473.472) (-473.876) [-473.179] (-473.000) * (-473.714) (-476.362) [-473.382] (-476.245) -- 0:00:16
714500 -- (-473.205) [-474.469] (-472.844) (-475.555) * (-476.039) [-473.270] (-474.366) (-475.299) -- 0:00:16
715000 -- (-472.594) (-475.539) (-472.615) [-475.059] * (-474.746) [-474.921] (-474.122) (-475.581) -- 0:00:16
Average standard deviation of split frequencies: 0.009744
715500 -- (-473.402) [-474.728] (-473.250) (-473.536) * (-473.815) (-475.262) (-479.616) [-474.395] -- 0:00:16
716000 -- [-472.916] (-476.554) (-474.225) (-475.426) * [-473.174] (-476.665) (-473.370) (-475.606) -- 0:00:16
716500 -- (-475.218) [-477.639] (-480.844) (-475.594) * (-473.861) [-474.088] (-475.530) (-473.244) -- 0:00:16
717000 -- (-473.835) (-475.519) (-474.397) [-473.956] * (-472.444) [-472.449] (-478.924) (-476.247) -- 0:00:16
717500 -- (-478.231) (-477.663) [-475.408] (-473.512) * (-473.763) [-472.304] (-472.886) (-479.913) -- 0:00:16
718000 -- (-478.140) (-474.004) [-476.062] (-473.712) * [-474.280] (-473.454) (-474.056) (-476.445) -- 0:00:16
718500 -- (-475.714) (-474.176) [-477.409] (-479.410) * [-473.326] (-473.954) (-474.832) (-475.382) -- 0:00:16
719000 -- (-476.498) (-474.191) (-474.452) [-475.231] * (-474.030) (-476.440) [-476.838] (-478.747) -- 0:00:16
719500 -- (-473.103) (-474.966) [-473.158] (-475.098) * (-477.623) (-476.565) [-474.574] (-476.577) -- 0:00:16
720000 -- [-473.909] (-474.264) (-477.091) (-475.877) * (-474.990) [-474.374] (-475.974) (-475.346) -- 0:00:16
Average standard deviation of split frequencies: 0.009812
720500 -- (-474.180) [-472.974] (-478.900) (-478.941) * [-476.060] (-473.013) (-473.788) (-478.288) -- 0:00:16
721000 -- [-473.975] (-474.141) (-476.120) (-475.298) * (-472.903) (-473.809) (-473.101) [-473.405] -- 0:00:16
721500 -- [-473.107] (-475.673) (-476.431) (-479.510) * (-473.443) (-474.978) (-474.601) [-473.475] -- 0:00:16
722000 -- (-475.913) (-473.821) (-473.716) [-475.664] * (-474.573) (-479.410) (-476.862) [-474.106] -- 0:00:16
722500 -- (-475.205) (-474.245) [-474.396] (-474.176) * (-474.362) (-474.229) (-473.404) [-473.750] -- 0:00:16
723000 -- (-473.476) (-475.561) (-474.010) [-472.913] * (-484.627) [-473.575] (-474.947) (-479.674) -- 0:00:16
723500 -- (-474.126) [-475.403] (-473.908) (-476.902) * [-476.545] (-472.536) (-478.394) (-481.967) -- 0:00:16
724000 -- (-472.969) (-475.065) (-477.377) [-473.921] * (-475.390) (-475.448) (-475.264) [-474.506] -- 0:00:16
724500 -- (-476.887) (-474.224) [-472.905] (-476.522) * (-476.055) [-474.773] (-475.933) (-478.428) -- 0:00:16
725000 -- (-478.029) (-474.808) (-476.680) [-475.583] * (-473.212) (-475.327) [-475.755] (-478.890) -- 0:00:16
Average standard deviation of split frequencies: 0.010129
725500 -- (-475.216) (-475.254) [-476.041] (-475.298) * (-474.945) (-478.139) [-475.087] (-474.928) -- 0:00:16
726000 -- (-473.414) (-474.398) (-475.030) [-476.441] * [-476.190] (-478.027) (-473.393) (-473.797) -- 0:00:16
726500 -- (-475.873) [-474.469] (-476.193) (-475.535) * (-476.448) (-479.436) [-473.237] (-475.534) -- 0:00:16
727000 -- (-474.907) (-479.490) [-474.944] (-474.902) * (-474.137) (-473.149) [-474.697] (-474.196) -- 0:00:16
727500 -- (-474.306) (-478.651) (-472.578) [-474.395] * [-476.010] (-476.748) (-475.352) (-474.167) -- 0:00:16
728000 -- (-474.144) (-475.785) [-473.240] (-473.280) * (-477.069) [-473.660] (-474.774) (-474.313) -- 0:00:16
728500 -- (-479.427) [-474.600] (-473.956) (-472.834) * (-476.820) [-475.467] (-476.963) (-472.610) -- 0:00:16
729000 -- [-474.404] (-476.416) (-478.657) (-474.390) * (-472.616) (-473.286) (-482.993) [-473.729] -- 0:00:15
729500 -- (-472.853) [-472.840] (-476.083) (-474.962) * (-476.573) [-472.739] (-477.765) (-474.482) -- 0:00:15
730000 -- (-473.203) (-472.287) (-475.119) [-477.793] * (-473.012) (-478.068) [-475.712] (-473.818) -- 0:00:15
Average standard deviation of split frequencies: 0.009764
730500 -- (-473.286) (-476.066) (-477.070) [-474.467] * (-472.645) (-480.762) (-474.197) [-472.702] -- 0:00:15
731000 -- (-474.382) (-474.572) [-472.947] (-475.688) * [-474.008] (-472.237) (-474.708) (-474.612) -- 0:00:15
731500 -- (-473.034) (-479.184) [-475.657] (-474.076) * [-473.090] (-474.349) (-473.854) (-473.293) -- 0:00:15
732000 -- (-473.965) [-474.052] (-473.272) (-474.149) * [-474.685] (-476.756) (-474.487) (-473.906) -- 0:00:15
732500 -- [-474.446] (-473.083) (-474.684) (-477.937) * (-475.563) (-474.151) (-478.271) [-475.067] -- 0:00:15
733000 -- (-474.414) (-473.071) (-472.345) [-474.027] * (-472.934) [-473.423] (-477.087) (-478.342) -- 0:00:15
733500 -- (-476.789) (-475.203) (-472.446) [-474.920] * (-472.570) [-474.288] (-477.654) (-473.446) -- 0:00:15
734000 -- (-479.154) (-474.402) (-473.298) [-474.548] * (-473.546) (-475.242) (-476.253) [-472.883] -- 0:00:15
734500 -- (-474.890) [-474.000] (-475.695) (-476.754) * [-473.788] (-477.088) (-478.672) (-475.553) -- 0:00:15
735000 -- [-476.163] (-473.998) (-472.581) (-473.942) * [-473.771] (-474.940) (-475.123) (-476.624) -- 0:00:15
Average standard deviation of split frequencies: 0.009864
735500 -- (-478.208) (-476.702) [-475.065] (-477.145) * [-475.088] (-479.313) (-474.141) (-474.779) -- 0:00:15
736000 -- [-473.707] (-477.408) (-472.704) (-478.711) * [-475.649] (-475.541) (-474.848) (-478.315) -- 0:00:15
736500 -- (-473.169) [-474.622] (-472.929) (-474.358) * (-475.493) [-473.358] (-477.138) (-474.265) -- 0:00:15
737000 -- (-473.231) (-476.092) (-473.630) [-474.103] * (-476.678) (-472.420) [-474.287] (-473.630) -- 0:00:15
737500 -- (-474.111) [-473.033] (-473.831) (-474.502) * (-472.378) (-474.045) (-473.597) [-473.703] -- 0:00:15
738000 -- (-474.286) [-475.344] (-472.114) (-473.535) * (-475.684) [-473.785] (-473.977) (-472.486) -- 0:00:15
738500 -- (-474.420) [-473.049] (-477.362) (-473.493) * (-476.233) [-479.012] (-472.917) (-475.828) -- 0:00:15
739000 -- (-473.308) (-473.038) (-476.885) [-473.678] * (-475.014) (-478.011) [-474.792] (-479.380) -- 0:00:15
739500 -- (-475.734) (-472.606) (-474.241) [-472.449] * [-473.296] (-475.678) (-477.403) (-473.148) -- 0:00:15
740000 -- (-474.216) (-473.193) (-474.336) [-472.965] * [-474.954] (-475.190) (-473.566) (-474.538) -- 0:00:15
Average standard deviation of split frequencies: 0.009420
740500 -- (-473.398) (-474.814) (-476.531) [-473.217] * [-475.386] (-476.977) (-475.613) (-476.797) -- 0:00:15
741000 -- [-472.787] (-473.029) (-477.728) (-474.151) * (-475.909) [-477.931] (-475.106) (-475.046) -- 0:00:15
741500 -- [-472.760] (-475.457) (-474.468) (-473.800) * (-474.059) [-473.075] (-474.907) (-475.326) -- 0:00:15
742000 -- (-474.106) (-477.720) [-474.245] (-473.564) * (-473.319) [-473.091] (-474.836) (-474.938) -- 0:00:15
742500 -- (-475.507) (-474.048) [-474.127] (-474.870) * (-474.258) (-473.478) [-475.067] (-475.958) -- 0:00:15
743000 -- (-478.701) (-476.392) [-472.830] (-473.189) * (-474.708) (-473.337) [-474.215] (-473.732) -- 0:00:15
743500 -- (-473.850) (-474.566) (-474.238) [-473.614] * (-476.271) (-474.532) (-475.245) [-472.479] -- 0:00:15
744000 -- (-473.494) (-480.166) [-473.858] (-473.157) * (-474.545) (-478.038) (-473.953) [-473.202] -- 0:00:15
744500 -- (-476.193) (-475.378) [-478.154] (-474.742) * (-475.417) (-476.455) (-473.755) [-473.833] -- 0:00:15
745000 -- (-477.304) (-473.619) (-474.343) [-475.131] * (-475.474) (-475.468) [-474.642] (-475.338) -- 0:00:15
Average standard deviation of split frequencies: 0.009647
745500 -- [-476.485] (-474.476) (-477.878) (-472.959) * (-475.822) [-474.193] (-475.469) (-474.749) -- 0:00:15
746000 -- (-475.493) (-477.136) (-473.710) [-473.498] * (-472.982) [-473.969] (-474.055) (-474.388) -- 0:00:14
746500 -- (-474.937) (-477.751) [-472.748] (-473.788) * (-476.881) (-475.216) (-473.765) [-473.062] -- 0:00:14
747000 -- [-478.420] (-482.592) (-473.812) (-472.954) * (-475.416) (-474.253) [-473.202] (-473.577) -- 0:00:14
747500 -- (-474.684) (-473.556) [-475.838] (-476.014) * (-474.514) (-474.767) (-473.149) [-473.676] -- 0:00:14
748000 -- (-476.875) (-472.944) [-473.226] (-472.210) * (-475.178) (-475.962) [-476.887] (-477.778) -- 0:00:14
748500 -- (-475.155) (-473.145) [-473.070] (-473.967) * (-474.978) (-474.659) (-473.342) [-478.034] -- 0:00:14
749000 -- [-473.602] (-475.798) (-473.719) (-474.865) * (-474.817) (-476.221) [-474.128] (-475.511) -- 0:00:14
749500 -- [-477.282] (-473.455) (-473.774) (-474.694) * (-476.027) (-473.985) (-476.246) [-477.470] -- 0:00:14
750000 -- [-473.221] (-478.021) (-474.353) (-475.535) * (-475.734) (-475.223) (-476.790) [-473.662] -- 0:00:14
Average standard deviation of split frequencies: 0.009169
750500 -- (-473.770) (-473.503) [-473.015] (-477.449) * (-474.663) (-473.244) (-473.523) [-475.128] -- 0:00:14
751000 -- [-472.672] (-473.088) (-475.911) (-476.208) * (-472.671) [-472.846] (-475.129) (-473.424) -- 0:00:14
751500 -- (-473.226) (-476.910) (-476.029) [-478.286] * (-474.228) (-473.707) [-474.354] (-477.630) -- 0:00:14
752000 -- (-473.416) [-477.744] (-480.722) (-472.895) * (-473.134) (-477.286) [-473.470] (-474.106) -- 0:00:14
752500 -- (-472.435) (-473.483) [-473.645] (-474.523) * (-472.987) [-475.749] (-473.936) (-479.641) -- 0:00:14
753000 -- [-474.717] (-473.117) (-473.123) (-472.823) * (-473.953) [-474.746] (-475.311) (-477.882) -- 0:00:14
753500 -- [-475.689] (-473.708) (-477.194) (-472.374) * [-473.976] (-474.065) (-472.865) (-476.372) -- 0:00:14
754000 -- [-474.192] (-476.733) (-472.829) (-474.694) * (-472.741) (-473.524) (-474.624) [-473.582] -- 0:00:14
754500 -- (-477.484) (-474.949) (-473.980) [-478.550] * (-473.496) [-474.313] (-474.028) (-474.155) -- 0:00:14
755000 -- (-476.280) [-473.631] (-478.943) (-477.539) * (-478.859) (-476.832) [-476.136] (-474.959) -- 0:00:14
Average standard deviation of split frequencies: 0.008896
755500 -- [-477.231] (-474.567) (-473.027) (-476.353) * (-478.169) (-476.912) [-473.325] (-473.608) -- 0:00:14
756000 -- (-474.489) [-473.455] (-472.654) (-476.282) * (-474.644) (-473.367) [-474.377] (-473.890) -- 0:00:14
756500 -- (-474.022) (-473.749) (-478.748) [-472.452] * (-472.659) [-477.583] (-477.629) (-472.547) -- 0:00:14
757000 -- (-476.081) (-474.715) (-474.549) [-472.552] * (-473.170) (-474.024) (-474.442) [-474.092] -- 0:00:14
757500 -- (-476.901) (-477.690) (-475.639) [-477.382] * (-475.178) (-474.024) (-476.782) [-476.634] -- 0:00:14
758000 -- (-475.023) [-475.605] (-473.415) (-475.735) * (-473.266) [-473.473] (-475.856) (-474.393) -- 0:00:14
758500 -- (-475.638) [-475.614] (-476.676) (-476.941) * (-473.263) (-473.932) [-474.293] (-473.293) -- 0:00:14
759000 -- [-475.063] (-474.376) (-474.249) (-475.555) * (-474.131) (-477.492) (-475.652) [-474.446] -- 0:00:14
759500 -- (-473.983) (-474.155) (-472.518) [-474.762] * (-473.122) [-475.336] (-475.715) (-475.343) -- 0:00:14
760000 -- (-475.892) (-476.734) (-473.794) [-474.524] * [-476.357] (-477.401) (-473.980) (-473.858) -- 0:00:14
Average standard deviation of split frequencies: 0.009172
760500 -- (-479.753) [-474.995] (-474.313) (-473.004) * (-481.844) (-476.162) [-474.045] (-475.777) -- 0:00:14
761000 -- (-473.991) (-476.190) (-478.730) [-473.450] * (-474.657) (-475.332) [-473.703] (-474.299) -- 0:00:14
761500 -- [-472.880] (-477.520) (-476.110) (-474.900) * [-473.378] (-473.270) (-474.056) (-475.271) -- 0:00:14
762000 -- [-473.284] (-475.327) (-474.659) (-473.533) * (-473.190) (-472.437) [-475.750] (-475.495) -- 0:00:14
762500 -- (-473.467) (-475.477) [-473.395] (-473.746) * [-474.982] (-473.545) (-476.094) (-474.217) -- 0:00:14
763000 -- (-473.262) (-474.506) [-476.499] (-474.080) * (-473.278) [-473.086] (-475.890) (-474.223) -- 0:00:13
763500 -- (-472.857) (-479.053) [-474.846] (-478.051) * [-476.331] (-472.924) (-473.526) (-472.327) -- 0:00:13
764000 -- (-473.702) (-476.151) [-474.248] (-476.956) * (-472.187) [-474.680] (-475.478) (-474.398) -- 0:00:13
764500 -- (-473.168) (-475.560) [-473.191] (-475.585) * (-473.722) (-473.444) (-473.624) [-474.344] -- 0:00:13
765000 -- (-472.483) (-476.159) (-473.923) [-477.571] * (-473.752) (-472.782) (-476.443) [-473.519] -- 0:00:13
Average standard deviation of split frequencies: 0.009231
765500 -- (-473.282) (-474.040) [-474.874] (-473.080) * (-474.718) (-473.377) (-475.157) [-473.618] -- 0:00:13
766000 -- (-472.660) (-475.506) (-473.418) [-472.848] * (-472.815) (-475.171) (-476.345) [-473.248] -- 0:00:13
766500 -- (-473.246) (-475.051) [-472.911] (-472.906) * (-473.901) (-475.620) (-474.541) [-472.678] -- 0:00:13
767000 -- [-472.460] (-473.803) (-476.391) (-478.637) * [-475.103] (-473.410) (-473.300) (-472.870) -- 0:00:13
767500 -- (-473.881) [-483.245] (-474.611) (-475.294) * [-475.583] (-475.395) (-475.348) (-475.893) -- 0:00:13
768000 -- (-477.009) (-475.342) [-475.152] (-475.924) * [-474.767] (-472.684) (-474.752) (-475.989) -- 0:00:13
768500 -- [-474.297] (-475.268) (-477.170) (-474.958) * [-474.953] (-474.428) (-473.253) (-478.168) -- 0:00:13
769000 -- [-473.758] (-473.179) (-476.005) (-478.215) * (-473.878) [-473.939] (-472.677) (-474.405) -- 0:00:13
769500 -- [-472.976] (-473.080) (-475.181) (-477.754) * (-474.170) [-474.473] (-473.477) (-473.734) -- 0:00:13
770000 -- (-475.801) (-473.996) [-474.417] (-474.971) * (-475.559) (-475.579) (-475.168) [-476.198] -- 0:00:13
Average standard deviation of split frequencies: 0.009216
770500 -- (-473.791) [-475.357] (-476.323) (-473.986) * [-473.958] (-473.497) (-479.540) (-474.857) -- 0:00:13
771000 -- (-474.201) [-472.614] (-474.178) (-473.064) * (-474.824) (-473.871) [-472.338] (-474.816) -- 0:00:13
771500 -- (-475.873) (-476.665) [-473.320] (-475.492) * [-473.250] (-477.159) (-475.894) (-473.315) -- 0:00:13
772000 -- [-477.705] (-476.172) (-472.880) (-474.340) * [-473.668] (-473.667) (-477.293) (-477.207) -- 0:00:13
772500 -- (-474.769) (-475.521) (-474.450) [-475.752] * [-473.196] (-474.162) (-474.015) (-476.893) -- 0:00:13
773000 -- (-474.478) (-473.734) [-472.418] 