--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:09:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/hns/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -494.78 -498.19
2 -494.74 -498.17
--------------------------------------
TOTAL -494.76 -498.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889218 0.087391 0.367448 1.487694 0.857250 1296.29 1310.85 1.000
r(A<->C){all} 0.161086 0.019627 0.000031 0.444831 0.117743 126.44 175.91 1.009
r(A<->G){all} 0.169192 0.021735 0.000036 0.473826 0.130860 158.82 200.84 1.000
r(A<->T){all} 0.156645 0.018750 0.000042 0.439001 0.117971 193.91 264.16 1.006
r(C<->G){all} 0.171245 0.020922 0.000009 0.457601 0.134262 67.68 130.50 1.000
r(C<->T){all} 0.168779 0.021605 0.000028 0.473602 0.130351 192.97 286.21 1.001
r(G<->T){all} 0.173054 0.020170 0.000216 0.454459 0.138462 207.69 233.47 1.000
pi(A){all} 0.272595 0.000524 0.229999 0.318082 0.273091 1318.38 1364.60 1.000
pi(C){all} 0.310472 0.000589 0.262863 0.357785 0.310329 1180.32 1243.22 1.000
pi(G){all} 0.259478 0.000527 0.214918 0.304800 0.259293 1048.84 1112.37 1.000
pi(T){all} 0.157454 0.000355 0.119373 0.192416 0.156944 1143.22 1322.11 1.000
alpha{1,2} 0.414527 0.230214 0.000241 1.381482 0.242333 1245.02 1294.78 1.000
alpha{3} 0.451641 0.233510 0.000209 1.444267 0.296687 1266.98 1360.12 1.000
pinvar{all} 0.995570 0.000027 0.985767 0.999999 0.997270 1349.19 1425.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -474.260139
Model 2: PositiveSelection -474.260107
Model 0: one-ratio -474.260096
Model 7: beta -474.260174
Model 8: beta&w>1 -474.260096
Model 0 vs 1 8.600000001024455E-5
Model 2 vs 1 6.399999995210237E-5
Model 8 vs 7 1.560000000608852E-4
>C1
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C2
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C3
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C4
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C5
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C6
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=121
C1 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C2 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C3 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C4 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C5 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C6 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
**************************************************
C1 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C2 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C3 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C4 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C5 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C6 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
**************************************************
C1 LVIALAIGLLALLLIHQLRRR
C2 LVIALAIGLLALLLIHQLRRR
C3 LVIALAIGLLALLLIHQLRRR
C4 LVIALAIGLLALLLIHQLRRR
C5 LVIALAIGLLALLLIHQLRRR
C6 LVIALAIGLLALLLIHQLRRR
*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3630]--->[3630]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.459 Mb, Max= 30.649 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C2 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C3 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C4 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C5 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C6 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
**************************************************
C1 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C2 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C3 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C4 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C5 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C6 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
**************************************************
C1 LVIALAIGLLALLLIHQLRRR
C2 LVIALAIGLLALLLIHQLRRR
C3 LVIALAIGLLALLLIHQLRRR
C4 LVIALAIGLLALLLIHQLRRR
C5 LVIALAIGLLALLLIHQLRRR
C6 LVIALAIGLLALLLIHQLRRR
*********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C2 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C3 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C4 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C5 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C6 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
**************************************************
C1 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C2 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C3 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C4 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C5 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C6 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
**************************************************
C1 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C2 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C3 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C4 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C5 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C6 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
**************************************************
C1 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C2 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C3 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C4 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C5 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C6 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
**************************************************
C1 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C2 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C3 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C4 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C5 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C6 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
**************************************************
C1 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C2 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C3 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C4 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C5 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C6 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
**************************************************
C1 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C2 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C3 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C4 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C5 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C6 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
**************************************************
C1 ACTGCGACGTCGC
C2 ACTGCGACGTCGC
C3 ACTGCGACGTCGC
C4 ACTGCGACGTCGC
C5 ACTGCGACGTCGC
C6 ACTGCGACGTCGC
*************
>C1
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C2
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C3
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C4
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C5
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C6
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C1
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C2
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C3
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C4
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C5
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C6
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792079
Setting output file names to "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 823643415
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0784610423
Seed = 1378701065
Swapseed = 1579792079
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -812.411407 -- -24.965149
Chain 2 -- -812.411407 -- -24.965149
Chain 3 -- -812.411361 -- -24.965149
Chain 4 -- -812.411361 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -812.411361 -- -24.965149
Chain 2 -- -812.411407 -- -24.965149
Chain 3 -- -812.411407 -- -24.965149
Chain 4 -- -812.411407 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-812.411] (-812.411) (-812.411) (-812.411) * [-812.411] (-812.411) (-812.411) (-812.411)
500 -- (-505.342) [-511.110] (-507.299) (-508.923) * (-510.249) (-503.605) (-504.072) [-506.067] -- 0:00:00
1000 -- [-505.762] (-506.410) (-504.440) (-515.438) * (-507.689) (-504.611) [-499.370] (-502.561) -- 0:00:00
1500 -- (-505.006) [-506.611] (-504.855) (-504.890) * (-506.631) [-505.584] (-508.499) (-503.673) -- 0:00:00
2000 -- (-501.323) (-503.393) (-505.121) [-500.371] * (-504.649) (-505.735) [-502.709] (-507.959) -- 0:00:00
2500 -- (-512.695) (-509.282) [-503.514] (-503.371) * (-515.722) (-502.035) (-511.633) [-504.621] -- 0:00:00
3000 -- (-506.526) [-503.315] (-502.306) (-504.687) * (-504.641) [-505.348] (-505.142) (-509.936) -- 0:00:00
3500 -- (-504.603) (-503.357) (-504.082) [-508.148] * [-506.285] (-509.000) (-497.271) (-509.471) -- 0:00:00
4000 -- (-510.841) (-504.128) (-504.278) [-503.991] * (-506.736) (-508.776) [-501.580] (-515.601) -- 0:00:00
4500 -- (-503.478) (-504.948) (-519.013) [-500.941] * (-509.373) [-505.126] (-501.174) (-509.361) -- 0:00:00
5000 -- (-506.943) (-508.571) [-509.899] (-506.202) * (-496.940) (-505.328) [-504.110] (-504.811) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- (-514.823) [-508.997] (-515.542) (-507.309) * (-500.495) (-498.950) (-512.624) [-506.058] -- 0:00:00
6000 -- (-506.690) [-502.291] (-510.019) (-503.029) * [-507.392] (-508.950) (-502.643) (-511.771) -- 0:00:00
6500 -- (-503.366) [-499.985] (-519.608) (-500.072) * (-498.354) (-504.326) [-495.406] (-503.489) -- 0:00:00
7000 -- [-501.876] (-503.550) (-512.722) (-511.450) * (-510.475) [-499.475] (-495.245) (-510.103) -- 0:00:00
7500 -- (-503.331) (-505.498) [-496.658] (-508.366) * (-499.916) [-505.803] (-497.671) (-509.334) -- 0:00:00
8000 -- (-508.747) (-513.538) (-495.390) [-506.878] * (-506.256) [-504.729] (-496.375) (-511.794) -- 0:00:00
8500 -- (-503.477) [-506.014] (-494.142) (-510.113) * (-504.255) [-500.859] (-495.275) (-507.513) -- 0:00:00
9000 -- (-503.871) [-506.528] (-496.406) (-505.410) * (-501.839) [-503.977] (-494.924) (-508.711) -- 0:00:00
9500 -- (-506.550) (-507.692) [-494.324] (-504.205) * [-500.803] (-501.516) (-498.492) (-510.612) -- 0:00:00
10000 -- (-508.394) (-514.274) [-493.544] (-501.821) * (-507.575) [-503.135] (-493.851) (-513.068) -- 0:00:00
Average standard deviation of split frequencies: 0.067344
10500 -- (-510.762) [-501.686] (-494.935) (-501.592) * (-498.129) (-515.337) (-496.795) [-504.208] -- 0:00:00
11000 -- [-501.366] (-507.868) (-495.856) (-516.009) * (-506.263) (-509.199) [-495.111] (-502.722) -- 0:00:00
11500 -- (-504.975) (-503.219) [-495.227] (-513.096) * [-501.743] (-500.975) (-493.378) (-505.045) -- 0:00:00
12000 -- (-506.175) (-509.255) [-494.517] (-516.429) * (-503.739) (-496.598) [-494.811] (-512.427) -- 0:00:00
12500 -- [-497.655] (-500.388) (-497.612) (-508.522) * (-511.723) [-503.190] (-495.882) (-509.118) -- 0:01:19
13000 -- [-497.223] (-506.786) (-495.025) (-504.964) * (-499.661) (-501.080) [-497.147] (-506.342) -- 0:01:15
13500 -- [-495.166] (-511.794) (-495.756) (-506.211) * (-505.318) [-501.571] (-495.301) (-507.919) -- 0:01:13
14000 -- (-494.819) (-500.726) (-495.480) [-500.009] * (-510.726) (-499.416) (-498.910) [-500.903] -- 0:01:10
14500 -- (-494.498) (-500.957) (-494.139) [-505.652] * (-511.169) [-507.438] (-494.830) (-503.954) -- 0:01:07
15000 -- (-495.462) (-504.360) (-494.949) [-504.033] * (-512.130) (-506.078) [-497.385] (-506.728) -- 0:01:05
Average standard deviation of split frequencies: 0.061604
15500 -- (-494.794) (-501.458) [-495.308] (-513.839) * (-503.562) (-502.902) (-498.979) [-502.758] -- 0:01:03
16000 -- (-493.635) (-509.681) [-495.106] (-504.690) * (-504.226) (-504.754) (-499.735) [-503.885] -- 0:01:01
16500 -- (-494.720) [-503.649] (-500.312) (-507.045) * [-497.604] (-508.741) (-496.040) (-504.936) -- 0:00:59
17000 -- (-496.253) (-507.605) (-498.126) [-504.344] * (-494.335) [-498.868] (-494.975) (-509.503) -- 0:00:57
17500 -- [-494.860] (-502.641) (-495.139) (-499.330) * (-496.161) (-501.405) [-496.955] (-502.478) -- 0:00:56
18000 -- (-500.017) (-500.227) [-496.017] (-501.885) * (-494.558) [-500.372] (-497.836) (-508.429) -- 0:00:54
18500 -- (-495.392) (-502.558) (-493.744) [-505.726] * (-494.982) [-500.976] (-501.600) (-502.134) -- 0:00:53
19000 -- (-499.261) [-499.218] (-493.777) (-504.558) * (-496.252) (-501.592) [-494.561] (-504.981) -- 0:00:51
19500 -- [-493.571] (-502.189) (-494.929) (-501.686) * (-496.838) [-501.154] (-494.511) (-503.844) -- 0:00:50
20000 -- (-494.079) (-505.585) [-494.010] (-510.340) * (-496.171) [-500.967] (-495.587) (-503.233) -- 0:00:49
Average standard deviation of split frequencies: 0.064404
20500 -- (-502.592) (-506.562) [-494.434] (-500.165) * (-493.357) (-501.494) [-494.693] (-506.365) -- 0:00:47
21000 -- (-495.567) [-500.462] (-495.716) (-500.471) * (-495.019) [-507.187] (-497.176) (-517.446) -- 0:00:46
21500 -- (-495.083) [-504.696] (-495.859) (-503.750) * (-496.306) [-503.731] (-494.619) (-510.780) -- 0:00:45
22000 -- (-494.663) (-500.722) (-494.574) [-499.772] * (-496.810) (-500.768) [-495.433] (-495.161) -- 0:00:44
22500 -- (-494.001) (-502.156) (-498.427) [-507.466] * (-497.719) (-506.995) (-496.365) [-495.600] -- 0:00:43
23000 -- (-496.074) (-505.681) (-497.938) [-504.592] * (-494.668) (-505.443) (-495.144) [-496.805] -- 0:00:42
23500 -- (-496.228) (-502.791) (-494.204) [-504.245] * [-493.923] (-509.561) (-497.958) (-498.195) -- 0:00:41
24000 -- (-499.813) [-501.256] (-498.447) (-510.514) * [-495.046] (-506.849) (-495.539) (-496.611) -- 0:00:40
24500 -- (-502.676) [-506.142] (-495.071) (-507.607) * [-493.634] (-503.378) (-497.711) (-497.715) -- 0:00:39
25000 -- (-494.197) (-501.349) [-494.163] (-501.191) * [-494.407] (-505.552) (-493.448) (-494.115) -- 0:00:39
Average standard deviation of split frequencies: 0.052580
25500 -- (-493.667) [-507.199] (-495.912) (-508.169) * [-493.859] (-501.120) (-494.749) (-495.451) -- 0:00:38
26000 -- [-494.392] (-514.243) (-496.659) (-494.473) * (-493.924) (-505.807) (-494.330) [-496.671] -- 0:00:37
26500 -- [-497.166] (-505.221) (-495.390) (-495.694) * [-496.430] (-506.736) (-494.474) (-496.331) -- 0:00:36
27000 -- (-504.365) (-512.958) (-498.583) [-494.882] * (-494.876) [-499.849] (-494.672) (-493.340) -- 0:00:36
27500 -- (-496.178) (-499.604) [-493.547] (-493.976) * (-494.549) (-501.928) [-494.061] (-494.435) -- 0:01:10
28000 -- (-496.720) (-512.458) (-496.048) [-494.067] * [-497.197] (-512.428) (-501.096) (-496.546) -- 0:01:09
28500 -- (-494.524) (-508.865) (-497.500) [-494.256] * [-496.110] (-511.198) (-498.445) (-494.914) -- 0:01:08
29000 -- [-494.119] (-510.236) (-496.329) (-494.496) * (-494.600) [-503.146] (-498.056) (-495.884) -- 0:01:06
29500 -- (-494.539) (-506.925) (-496.792) [-498.891] * [-496.968] (-502.480) (-496.275) (-496.432) -- 0:01:05
30000 -- [-495.239] (-509.081) (-495.653) (-497.973) * (-496.926) (-511.276) [-496.060] (-496.208) -- 0:01:04
Average standard deviation of split frequencies: 0.049190
30500 -- [-493.423] (-510.385) (-495.488) (-499.753) * (-499.713) (-507.079) [-495.105] (-493.702) -- 0:01:03
31000 -- (-494.180) [-506.768] (-496.909) (-499.597) * (-494.697) [-510.262] (-494.447) (-494.894) -- 0:01:02
31500 -- (-493.800) [-510.333] (-493.633) (-496.369) * (-496.515) [-506.595] (-494.040) (-498.154) -- 0:01:01
32000 -- [-493.762] (-508.432) (-497.472) (-497.322) * [-494.159] (-500.178) (-494.069) (-500.576) -- 0:01:00
32500 -- [-498.239] (-503.699) (-500.785) (-497.099) * [-494.198] (-508.793) (-496.870) (-495.634) -- 0:00:59
33000 -- (-497.555) (-500.143) (-501.204) [-497.097] * [-494.173] (-509.546) (-499.198) (-494.306) -- 0:00:58
33500 -- (-495.282) (-510.777) (-496.316) [-498.493] * (-496.078) (-503.730) (-494.045) [-497.326] -- 0:00:57
34000 -- (-494.377) (-516.621) [-494.501] (-494.364) * (-494.200) (-504.528) [-494.850] (-498.346) -- 0:00:56
34500 -- (-495.311) (-510.667) (-498.565) [-497.975] * (-497.517) (-537.315) (-494.947) [-498.631] -- 0:00:55
35000 -- (-493.986) (-512.165) (-497.017) [-498.032] * (-495.890) (-516.936) [-494.843] (-501.223) -- 0:00:55
Average standard deviation of split frequencies: 0.040593
35500 -- (-494.079) [-506.154] (-498.159) (-496.420) * [-495.973] (-509.272) (-498.706) (-495.822) -- 0:00:54
36000 -- (-494.287) (-500.632) [-497.294] (-496.430) * (-497.596) [-502.275] (-498.009) (-495.841) -- 0:00:53
36500 -- (-494.945) (-512.246) (-496.656) [-494.754] * [-494.682] (-495.970) (-497.473) (-494.199) -- 0:00:52
37000 -- (-494.062) (-502.186) [-495.438] (-494.863) * (-494.218) [-495.312] (-495.089) (-494.557) -- 0:00:52
37500 -- (-495.546) (-504.546) (-497.829) [-499.760] * (-494.248) [-495.426] (-497.073) (-497.754) -- 0:00:51
38000 -- [-494.234] (-501.558) (-496.305) (-494.212) * (-495.499) [-495.757] (-496.312) (-494.744) -- 0:00:50
38500 -- (-500.679) [-500.450] (-497.600) (-494.690) * [-494.048] (-493.317) (-496.817) (-493.622) -- 0:00:49
39000 -- (-503.603) (-508.222) [-494.009] (-496.235) * (-498.178) (-498.088) [-493.804] (-495.513) -- 0:00:49
39500 -- [-496.052] (-511.276) (-496.418) (-497.038) * [-493.254] (-496.708) (-494.157) (-502.126) -- 0:00:48
40000 -- [-495.662] (-499.228) (-501.945) (-499.955) * [-496.254] (-494.031) (-495.880) (-496.977) -- 0:00:48
Average standard deviation of split frequencies: 0.037216
40500 -- (-494.834) [-500.727] (-495.166) (-498.089) * [-495.848] (-494.612) (-495.368) (-493.881) -- 0:00:47
41000 -- (-494.006) (-510.512) (-496.347) [-499.183] * [-494.185] (-496.197) (-494.229) (-497.354) -- 0:00:46
41500 -- (-494.762) [-503.610] (-494.611) (-494.381) * (-493.682) [-494.347] (-497.502) (-494.806) -- 0:01:09
42000 -- (-493.869) (-511.032) [-495.471] (-494.403) * (-494.647) [-494.741] (-494.943) (-499.847) -- 0:01:08
42500 -- (-494.197) (-510.265) (-496.128) [-494.066] * (-497.099) (-495.174) [-495.313] (-498.574) -- 0:01:07
43000 -- (-493.924) [-507.806] (-494.032) (-493.585) * [-493.698] (-495.572) (-496.392) (-494.329) -- 0:01:06
43500 -- (-499.478) [-500.464] (-494.912) (-496.093) * [-498.984] (-496.311) (-493.827) (-495.944) -- 0:01:05
44000 -- (-498.064) (-504.782) (-496.277) [-495.230] * (-495.075) (-495.793) [-494.888] (-497.106) -- 0:01:05
44500 -- (-495.374) (-499.296) (-494.170) [-494.177] * (-495.651) [-496.039] (-494.209) (-493.934) -- 0:01:04
45000 -- (-495.513) (-506.154) (-494.215) [-494.445] * [-499.935] (-499.364) (-496.096) (-496.269) -- 0:01:03
Average standard deviation of split frequencies: 0.034470
45500 -- (-496.563) (-505.454) (-495.220) [-495.944] * [-500.850] (-497.174) (-495.783) (-497.982) -- 0:01:02
46000 -- (-497.348) (-508.087) [-493.377] (-496.261) * (-500.788) [-493.384] (-497.746) (-495.420) -- 0:01:02
46500 -- (-497.734) (-506.296) [-495.075] (-497.088) * (-495.839) (-493.563) (-498.807) [-494.303] -- 0:01:01
47000 -- [-495.177] (-509.671) (-494.691) (-498.296) * [-495.876] (-494.211) (-496.454) (-495.447) -- 0:01:00
47500 -- (-494.780) (-501.478) (-496.269) [-494.734] * (-496.254) (-496.212) (-494.748) [-498.779] -- 0:01:00
48000 -- (-497.330) (-505.959) (-494.345) [-493.719] * (-502.366) (-494.110) [-498.803] (-494.025) -- 0:00:59
48500 -- [-494.192] (-504.403) (-497.591) (-494.203) * (-496.902) (-493.416) [-497.638] (-497.801) -- 0:00:58
49000 -- (-497.100) (-501.423) [-498.397] (-495.965) * (-496.579) (-494.055) (-493.317) [-493.471] -- 0:00:58
49500 -- (-495.759) [-509.561] (-495.523) (-493.687) * (-496.157) (-501.535) [-494.584] (-495.769) -- 0:00:57
50000 -- (-496.338) (-503.719) (-496.724) [-494.111] * (-496.569) [-496.352] (-496.435) (-495.964) -- 0:00:57
Average standard deviation of split frequencies: 0.030238
50500 -- (-497.182) (-507.904) [-498.426] (-496.220) * (-496.006) (-503.004) (-498.131) [-496.167] -- 0:00:56
51000 -- (-496.157) [-503.661] (-494.856) (-495.031) * (-499.178) (-502.153) (-495.317) [-493.409] -- 0:00:55
51500 -- [-494.892] (-511.181) (-495.703) (-494.523) * (-496.626) (-499.933) (-499.040) [-493.555] -- 0:00:55
52000 -- (-498.775) [-504.070] (-495.808) (-495.163) * [-493.857] (-494.691) (-496.757) (-495.924) -- 0:00:54
52500 -- (-497.676) (-503.762) (-494.543) [-497.941] * (-496.009) [-494.469] (-498.851) (-497.288) -- 0:00:54
53000 -- (-494.165) (-509.762) [-494.209] (-495.024) * [-495.369] (-495.273) (-498.709) (-494.463) -- 0:00:53
53500 -- [-496.593] (-503.121) (-494.833) (-495.177) * (-495.111) (-495.015) [-495.998] (-497.846) -- 0:00:53
54000 -- [-494.874] (-515.328) (-493.971) (-496.317) * [-494.356] (-495.705) (-494.321) (-496.782) -- 0:00:52
54500 -- (-495.608) (-495.010) (-498.895) [-495.112] * (-496.998) (-496.113) [-493.376] (-494.427) -- 0:00:52
55000 -- [-497.340] (-494.121) (-496.006) (-495.072) * (-494.639) (-500.438) [-496.326] (-496.530) -- 0:00:51
Average standard deviation of split frequencies: 0.027779
55500 -- (-497.386) (-495.034) (-495.022) [-494.387] * (-497.645) [-495.928] (-494.375) (-497.006) -- 0:00:51
56000 -- (-495.561) (-497.223) (-496.221) [-493.892] * (-495.936) (-494.395) [-494.182] (-500.371) -- 0:01:07
56500 -- (-497.268) (-497.131) [-495.482] (-495.166) * [-496.031] (-494.237) (-494.167) (-499.026) -- 0:01:06
57000 -- (-495.225) (-496.107) (-496.629) [-494.073] * (-495.849) (-493.188) (-493.827) [-494.753] -- 0:01:06
57500 -- (-497.210) [-494.431] (-497.105) (-496.493) * (-496.793) (-496.414) (-498.261) [-494.823] -- 0:01:05
58000 -- (-498.340) (-495.181) (-497.179) [-495.353] * (-497.519) [-494.598] (-496.004) (-495.141) -- 0:01:04
58500 -- [-496.752] (-496.206) (-493.930) (-495.312) * (-496.515) [-494.635] (-495.644) (-496.451) -- 0:01:04
59000 -- (-494.297) (-496.873) (-498.619) [-494.354] * (-497.780) (-493.278) [-496.377] (-498.162) -- 0:01:03
59500 -- (-493.831) (-493.808) (-499.628) [-493.883] * [-500.228] (-493.702) (-494.966) (-494.872) -- 0:01:03
60000 -- (-494.344) [-495.714] (-494.554) (-498.118) * [-497.411] (-495.674) (-496.175) (-498.200) -- 0:01:02
Average standard deviation of split frequencies: 0.028219
60500 -- [-494.520] (-495.563) (-494.049) (-496.516) * [-494.568] (-494.087) (-496.177) (-494.337) -- 0:01:02
61000 -- [-493.738] (-498.085) (-493.512) (-496.675) * (-494.180) (-495.798) [-495.299] (-495.250) -- 0:01:01
61500 -- (-495.709) [-496.944] (-494.890) (-494.393) * (-497.231) (-494.418) [-496.713] (-494.264) -- 0:01:01
62000 -- (-495.838) (-496.129) (-494.171) [-495.897] * (-495.805) (-496.336) [-494.153] (-493.375) -- 0:01:00
62500 -- (-494.146) (-496.340) (-495.046) [-494.361] * (-499.288) (-496.012) [-493.430] (-494.460) -- 0:01:00
63000 -- [-493.960] (-495.500) (-495.462) (-493.301) * (-499.926) [-495.693] (-493.916) (-495.487) -- 0:00:59
63500 -- (-494.031) (-495.449) (-496.158) [-493.478] * (-493.793) (-494.183) (-498.384) [-498.857] -- 0:00:58
64000 -- [-493.999] (-494.897) (-496.672) (-493.510) * [-494.353] (-495.347) (-494.885) (-498.307) -- 0:00:58
64500 -- (-495.110) (-497.957) [-495.595] (-494.206) * [-494.506] (-496.388) (-496.713) (-494.513) -- 0:00:58
65000 -- (-496.847) (-494.783) (-499.566) [-494.991] * (-495.655) (-495.921) [-495.798] (-495.575) -- 0:00:57
Average standard deviation of split frequencies: 0.027890
65500 -- [-494.147] (-497.337) (-499.698) (-497.062) * [-497.823] (-493.670) (-496.478) (-494.949) -- 0:00:57
66000 -- (-495.919) (-494.213) [-494.602] (-494.574) * (-499.983) [-494.963] (-498.372) (-498.102) -- 0:00:56
66500 -- (-495.849) (-493.817) [-494.394] (-498.310) * (-497.568) [-495.730] (-498.089) (-495.163) -- 0:00:56
67000 -- [-493.658] (-493.103) (-494.060) (-495.157) * [-496.571] (-494.936) (-494.772) (-496.660) -- 0:00:55
67500 -- (-502.343) (-497.053) (-495.493) [-499.624] * (-495.983) [-496.479] (-496.472) (-496.298) -- 0:00:55
68000 -- (-499.868) (-494.714) [-495.024] (-500.736) * (-496.410) [-494.210] (-493.948) (-494.978) -- 0:00:54
68500 -- (-504.871) (-494.202) (-496.543) [-495.001] * [-495.619] (-494.341) (-493.262) (-494.705) -- 0:00:54
69000 -- (-494.238) [-494.754] (-497.225) (-495.648) * (-495.565) (-494.251) [-493.524] (-494.740) -- 0:00:53
69500 -- (-495.154) (-497.674) [-495.336] (-499.374) * (-496.430) [-496.730] (-493.272) (-496.726) -- 0:00:53
70000 -- (-496.279) (-496.760) (-496.835) [-498.157] * (-499.402) (-494.366) [-496.192] (-495.221) -- 0:00:53
Average standard deviation of split frequencies: 0.025683
70500 -- (-498.265) (-501.039) (-494.867) [-495.217] * (-496.854) [-495.630] (-495.631) (-494.512) -- 0:00:52
71000 -- (-496.632) [-499.376] (-496.697) (-496.265) * (-499.046) (-494.684) (-495.188) [-494.524] -- 0:01:05
71500 -- (-497.693) [-498.290] (-494.755) (-496.081) * (-501.760) (-494.278) (-498.317) [-495.134] -- 0:01:04
72000 -- (-499.984) [-495.271] (-494.231) (-499.242) * (-495.098) [-496.542] (-496.072) (-498.547) -- 0:01:04
72500 -- (-499.486) (-494.293) (-499.906) [-498.610] * (-494.893) (-499.831) [-497.604] (-497.765) -- 0:01:03
73000 -- (-495.387) [-494.407] (-501.019) (-497.061) * (-495.434) (-500.049) [-498.218] (-497.760) -- 0:01:03
73500 -- [-494.757] (-496.580) (-497.118) (-494.925) * (-494.447) (-496.514) [-495.859] (-495.417) -- 0:01:03
74000 -- (-494.873) (-496.787) [-496.150] (-497.587) * (-493.905) (-497.721) (-498.812) [-495.247] -- 0:01:02
74500 -- (-495.133) [-494.623] (-496.871) (-496.186) * (-497.787) [-496.318] (-496.055) (-494.667) -- 0:01:02
75000 -- [-494.964] (-495.632) (-493.938) (-494.315) * (-496.540) (-494.331) (-501.100) [-495.291] -- 0:01:01
Average standard deviation of split frequencies: 0.023178
75500 -- [-496.967] (-498.901) (-493.448) (-493.695) * (-493.426) (-494.710) (-500.997) [-498.517] -- 0:01:01
76000 -- (-493.831) (-495.105) [-497.004] (-494.037) * [-496.409] (-494.288) (-496.234) (-495.059) -- 0:01:00
76500 -- [-494.255] (-493.950) (-494.555) (-500.702) * (-496.612) (-495.021) [-499.169] (-494.869) -- 0:01:00
77000 -- (-493.977) (-494.621) [-497.027] (-494.550) * (-496.822) (-493.785) (-497.491) [-497.694] -- 0:00:59
77500 -- (-496.448) [-494.073] (-494.613) (-498.524) * (-496.944) (-493.617) [-496.638] (-498.610) -- 0:00:59
78000 -- [-493.659] (-494.082) (-494.248) (-496.971) * (-496.172) (-493.473) [-494.463] (-496.523) -- 0:00:59
78500 -- (-497.220) (-494.689) (-494.007) [-495.033] * (-496.443) (-495.419) (-494.649) [-497.658] -- 0:00:58
79000 -- (-497.809) [-494.265] (-495.367) (-497.162) * (-497.078) (-495.418) [-494.420] (-498.311) -- 0:00:58
79500 -- [-497.755] (-493.731) (-495.049) (-494.778) * [-494.289] (-494.016) (-496.877) (-498.070) -- 0:00:57
80000 -- [-496.919] (-493.686) (-495.037) (-495.842) * (-497.179) (-496.651) [-495.778] (-495.882) -- 0:00:57
Average standard deviation of split frequencies: 0.026947
80500 -- (-497.328) [-495.529] (-494.166) (-493.994) * [-495.832] (-495.330) (-498.239) (-493.243) -- 0:00:57
81000 -- [-496.630] (-494.515) (-496.354) (-495.984) * [-496.390] (-494.650) (-498.566) (-496.080) -- 0:00:56
81500 -- (-495.320) [-494.720] (-497.494) (-493.911) * [-495.592] (-494.550) (-497.118) (-497.134) -- 0:00:56
82000 -- (-497.010) [-493.194] (-496.778) (-495.128) * [-502.665] (-493.983) (-496.808) (-497.727) -- 0:00:55
82500 -- (-494.049) [-493.752] (-494.671) (-495.919) * [-499.075] (-494.483) (-494.251) (-498.659) -- 0:00:55
83000 -- [-494.772] (-493.756) (-493.577) (-497.861) * [-496.587] (-493.994) (-496.475) (-494.076) -- 0:00:55
83500 -- (-494.774) (-497.196) [-494.710] (-493.563) * (-496.614) [-494.585] (-496.518) (-494.551) -- 0:00:54
84000 -- (-496.370) (-496.095) [-494.153] (-493.421) * (-498.500) (-494.482) (-499.695) [-497.202] -- 0:00:54
84500 -- (-498.347) (-497.377) (-496.774) [-494.923] * [-497.687] (-500.022) (-496.407) (-497.111) -- 0:00:54
85000 -- (-495.902) (-495.052) [-494.305] (-494.686) * (-496.670) [-498.914] (-496.056) (-496.740) -- 0:00:53
Average standard deviation of split frequencies: 0.024275
85500 -- [-495.156] (-495.374) (-494.166) (-494.356) * (-496.530) (-496.367) (-495.072) [-495.271] -- 0:01:04
86000 -- [-495.927] (-493.708) (-495.449) (-493.768) * [-495.796] (-494.739) (-495.922) (-493.840) -- 0:01:03
86500 -- (-493.985) [-494.143] (-496.592) (-494.543) * (-494.400) (-493.787) [-494.282] (-494.195) -- 0:01:03
87000 -- (-495.293) (-493.860) [-494.117] (-493.476) * [-494.617] (-494.338) (-494.429) (-497.045) -- 0:01:02
87500 -- (-500.260) [-493.504] (-494.062) (-499.033) * [-496.097] (-495.794) (-495.232) (-497.832) -- 0:01:02
88000 -- (-494.240) [-497.388] (-495.325) (-501.224) * (-495.654) (-496.216) [-494.371] (-497.077) -- 0:01:02
88500 -- [-493.692] (-496.345) (-494.682) (-501.862) * (-495.070) (-497.131) (-495.758) [-497.492] -- 0:01:01
89000 -- (-495.724) [-494.240] (-493.753) (-496.950) * (-494.539) (-499.168) (-496.257) [-496.899] -- 0:01:01
89500 -- (-494.700) (-494.396) (-493.728) [-496.443] * [-495.832] (-503.686) (-494.419) (-494.656) -- 0:01:01
90000 -- (-494.624) [-495.869] (-495.738) (-496.690) * (-495.390) (-494.481) [-498.531] (-495.138) -- 0:01:00
Average standard deviation of split frequencies: 0.019703
90500 -- (-497.833) (-494.645) (-495.326) [-495.972] * (-495.288) (-495.279) [-493.460] (-497.217) -- 0:01:00
91000 -- [-499.400] (-494.373) (-494.192) (-496.883) * (-495.436) (-496.129) [-495.257] (-496.201) -- 0:00:59
91500 -- [-495.863] (-494.734) (-494.834) (-499.033) * (-495.374) (-496.708) [-495.100] (-498.332) -- 0:00:59
92000 -- [-495.779] (-498.172) (-493.681) (-496.877) * (-495.250) (-498.707) [-494.319] (-496.800) -- 0:00:59
92500 -- (-495.738) [-494.974] (-497.496) (-495.647) * (-497.462) [-496.657] (-494.126) (-498.688) -- 0:00:58
93000 -- (-495.926) [-497.208] (-498.091) (-496.631) * (-503.170) (-496.779) [-495.332] (-497.417) -- 0:00:58
93500 -- [-495.304] (-495.183) (-496.566) (-495.165) * (-494.133) [-495.736] (-495.083) (-496.919) -- 0:00:58
94000 -- (-497.578) [-495.069] (-495.117) (-494.599) * (-497.899) [-497.235] (-495.262) (-496.967) -- 0:00:57
94500 -- (-494.978) (-495.463) [-494.699] (-495.509) * (-495.915) [-496.969] (-500.700) (-494.405) -- 0:00:57
95000 -- (-497.225) [-495.453] (-494.458) (-493.533) * [-496.368] (-494.019) (-500.137) (-494.475) -- 0:00:57
Average standard deviation of split frequencies: 0.017732
95500 -- [-494.839] (-497.440) (-497.220) (-494.370) * (-497.677) (-496.773) (-496.960) [-494.153] -- 0:00:56
96000 -- (-495.608) [-495.519] (-494.656) (-496.993) * (-494.737) (-498.285) (-494.208) [-495.597] -- 0:00:56
96500 -- (-498.443) [-493.857] (-495.457) (-497.191) * [-502.824] (-495.576) (-495.746) (-495.450) -- 0:00:56
97000 -- [-494.017] (-495.019) (-495.008) (-498.532) * (-502.487) [-494.821] (-494.105) (-496.640) -- 0:00:55
97500 -- (-493.145) (-494.461) [-495.594] (-494.512) * (-498.727) (-495.545) (-495.337) [-497.003] -- 0:00:55
98000 -- (-494.402) (-495.273) [-495.586] (-494.373) * (-495.831) (-499.135) (-493.827) [-494.467] -- 0:00:55
98500 -- (-494.721) [-495.469] (-497.021) (-495.651) * [-494.781] (-497.249) (-498.233) (-496.020) -- 0:00:54
99000 -- (-493.981) (-494.999) [-496.219] (-495.263) * [-495.904] (-497.243) (-496.824) (-494.520) -- 0:00:54
99500 -- (-496.045) (-496.610) (-495.874) [-496.690] * (-493.879) [-497.025] (-499.836) (-496.093) -- 0:00:54
100000 -- [-495.692] (-493.933) (-496.615) (-494.866) * [-495.697] (-495.160) (-498.568) (-496.274) -- 0:01:02
Average standard deviation of split frequencies: 0.016267
100500 -- (-494.843) (-495.721) (-494.792) [-495.628] * (-496.337) (-494.978) [-496.500] (-493.967) -- 0:01:02
101000 -- [-494.892] (-494.974) (-495.211) (-495.388) * (-497.312) [-497.103] (-494.254) (-494.860) -- 0:01:02
101500 -- [-498.579] (-501.132) (-496.757) (-495.304) * (-495.987) [-497.590] (-493.376) (-494.463) -- 0:01:01
102000 -- (-494.909) (-500.372) (-499.469) [-494.833] * (-494.062) (-496.427) (-496.534) [-494.533] -- 0:01:01
102500 -- [-495.106] (-500.563) (-502.515) (-500.941) * [-494.388] (-494.460) (-498.613) (-496.138) -- 0:01:01
103000 -- [-494.849] (-494.938) (-496.877) (-499.442) * (-495.739) (-497.988) [-495.393] (-493.845) -- 0:01:00
103500 -- (-495.438) [-493.801] (-496.110) (-496.934) * (-494.285) (-496.632) [-499.804] (-494.962) -- 0:01:00
104000 -- (-495.441) (-494.582) (-495.237) [-494.891] * [-498.612] (-496.112) (-498.153) (-493.584) -- 0:01:00
104500 -- (-493.917) (-494.373) (-493.314) [-495.270] * [-494.272] (-494.986) (-499.705) (-494.128) -- 0:00:59
105000 -- [-496.274] (-496.358) (-496.818) (-498.296) * [-495.419] (-497.947) (-496.370) (-495.877) -- 0:00:59
Average standard deviation of split frequencies: 0.015036
105500 -- (-494.380) [-495.401] (-494.022) (-495.164) * (-494.043) [-496.658] (-494.761) (-496.555) -- 0:00:59
106000 -- (-494.743) (-495.730) (-494.222) [-494.698] * [-493.931] (-496.171) (-494.003) (-493.998) -- 0:00:59
106500 -- (-497.723) [-495.649] (-495.378) (-498.686) * [-493.544] (-495.732) (-496.275) (-494.559) -- 0:00:58
107000 -- (-497.599) (-495.494) (-495.969) [-498.929] * (-494.223) [-494.185] (-496.266) (-495.130) -- 0:00:58
107500 -- (-498.493) (-494.707) [-495.045] (-499.051) * (-495.416) (-494.624) (-494.344) [-497.103] -- 0:00:58
108000 -- [-494.807] (-494.513) (-494.303) (-498.571) * (-494.419) (-493.855) (-494.034) [-495.388] -- 0:00:57
108500 -- (-496.318) (-494.703) (-493.742) [-497.308] * (-493.466) (-493.304) [-493.793] (-495.085) -- 0:00:57
109000 -- (-496.391) [-494.453] (-495.844) (-495.259) * [-494.599] (-493.392) (-495.956) (-493.631) -- 0:00:57
109500 -- (-495.210) (-497.388) (-494.754) [-493.628] * [-494.204] (-494.975) (-494.180) (-499.241) -- 0:00:56
110000 -- (-495.468) (-496.366) [-495.830] (-495.768) * (-493.597) (-494.443) [-496.316] (-501.638) -- 0:00:56
Average standard deviation of split frequencies: 0.017678
110500 -- (-499.114) (-494.707) (-494.598) [-494.658] * (-494.820) (-497.733) [-499.398] (-497.060) -- 0:00:56
111000 -- (-493.501) (-496.140) (-493.658) [-495.901] * (-494.319) (-495.676) (-502.490) [-496.687] -- 0:00:56
111500 -- (-495.046) (-494.936) [-498.150] (-495.088) * (-493.970) [-495.488] (-494.097) (-498.887) -- 0:00:55
112000 -- (-494.125) (-495.327) (-495.703) [-496.178] * (-493.903) (-496.443) (-495.612) [-494.307] -- 0:00:55
112500 -- (-495.008) [-494.341] (-493.994) (-496.481) * [-494.519] (-496.708) (-495.000) (-493.515) -- 0:00:55
113000 -- (-495.439) (-495.048) [-494.633] (-498.296) * [-496.326] (-495.290) (-493.697) (-495.271) -- 0:00:54
113500 -- (-494.625) [-499.378] (-495.151) (-494.126) * (-495.895) (-494.574) (-493.369) [-493.303] -- 0:00:54
114000 -- [-494.318] (-496.929) (-496.871) (-494.021) * (-494.154) [-494.522] (-495.591) (-496.089) -- 0:01:02
114500 -- (-493.930) (-494.804) (-500.334) [-494.570] * (-494.065) (-494.225) [-497.567] (-496.911) -- 0:01:01
115000 -- (-495.133) (-493.779) [-493.753] (-494.919) * (-496.210) (-494.249) (-500.284) [-497.737] -- 0:01:01
Average standard deviation of split frequencies: 0.017690
115500 -- (-494.947) (-495.039) (-500.564) [-497.161] * (-499.167) [-494.581] (-496.459) (-497.098) -- 0:01:01
116000 -- (-498.401) (-498.119) [-495.966] (-495.980) * (-496.112) [-498.221] (-496.756) (-495.088) -- 0:01:00
116500 -- (-494.596) (-493.829) (-494.317) [-495.833] * (-497.974) (-494.528) [-494.851] (-497.565) -- 0:01:00
117000 -- (-497.379) (-495.836) (-497.677) [-498.670] * (-498.141) [-494.346] (-494.271) (-499.197) -- 0:01:00
117500 -- (-495.616) (-494.930) (-498.066) [-494.587] * (-498.259) (-497.169) [-497.745] (-493.289) -- 0:01:00
118000 -- (-497.332) [-496.652] (-495.450) (-493.803) * (-497.681) (-495.422) (-496.823) [-493.148] -- 0:00:59
118500 -- (-494.732) [-495.123] (-496.437) (-493.790) * [-497.146] (-494.733) (-496.577) (-494.024) -- 0:00:59
119000 -- (-494.244) (-496.807) (-496.998) [-493.439] * (-495.521) (-494.006) (-499.191) [-495.508] -- 0:00:59
119500 -- (-502.479) (-496.120) (-494.478) [-495.519] * (-497.730) (-494.675) [-495.005] (-496.181) -- 0:00:58
120000 -- (-497.531) (-494.992) (-493.479) [-497.423] * (-497.736) (-496.152) [-494.252] (-495.309) -- 0:00:58
Average standard deviation of split frequencies: 0.016929
120500 -- (-495.520) (-498.142) [-498.753] (-495.505) * (-497.313) [-499.985] (-499.158) (-496.644) -- 0:00:58
121000 -- [-497.247] (-499.230) (-496.768) (-494.328) * [-496.709] (-498.727) (-495.449) (-496.138) -- 0:00:58
121500 -- (-496.923) [-497.652] (-494.379) (-493.827) * (-501.619) (-496.442) [-496.098] (-494.553) -- 0:00:57
122000 -- (-496.404) (-494.091) [-494.336] (-496.840) * (-498.026) [-494.338] (-494.427) (-494.390) -- 0:00:57
122500 -- (-498.407) (-503.066) [-495.107] (-497.505) * (-496.056) (-494.485) (-493.372) [-493.969] -- 0:00:57
123000 -- (-496.538) [-494.849] (-493.821) (-495.893) * [-494.080] (-494.607) (-494.074) (-493.354) -- 0:00:57
123500 -- (-498.382) [-493.120] (-497.124) (-494.733) * (-494.482) (-494.956) (-495.642) [-494.823] -- 0:00:56
124000 -- (-500.474) (-495.371) [-494.697] (-494.525) * (-495.742) (-496.439) [-494.613] (-495.823) -- 0:00:56
124500 -- [-495.982] (-494.259) (-493.847) (-494.408) * (-500.366) (-494.963) (-495.381) [-494.812] -- 0:00:56
125000 -- (-495.263) (-496.713) (-494.823) [-494.842] * [-496.635] (-494.910) (-494.299) (-494.740) -- 0:00:56
Average standard deviation of split frequencies: 0.017667
125500 -- (-495.273) [-494.911] (-500.933) (-495.681) * (-495.687) (-495.689) [-494.003] (-495.411) -- 0:00:55
126000 -- (-495.856) [-494.380] (-497.342) (-496.443) * (-495.923) [-493.864] (-494.537) (-495.563) -- 0:00:55
126500 -- (-497.607) (-494.712) (-497.369) [-494.753] * (-498.161) (-494.805) [-494.547] (-494.112) -- 0:00:55
127000 -- (-497.867) (-495.324) [-494.118] (-494.072) * (-494.190) (-496.102) (-495.490) [-494.953] -- 0:00:54
127500 -- (-494.745) (-494.102) [-494.800] (-495.247) * (-494.757) (-497.430) [-496.880] (-494.929) -- 0:00:54
128000 -- (-495.795) (-495.092) [-494.967] (-494.915) * (-494.170) (-495.419) (-495.420) [-494.661] -- 0:00:54
128500 -- (-499.024) (-495.125) (-493.393) [-493.795] * [-495.623] (-497.089) (-495.499) (-497.963) -- 0:01:01
129000 -- (-499.899) (-494.558) [-494.964] (-495.881) * (-496.275) (-499.688) (-494.959) [-495.885] -- 0:01:00
129500 -- (-496.714) (-495.824) (-498.697) [-495.921] * (-497.976) (-494.554) [-494.662] (-495.682) -- 0:01:00
130000 -- [-495.567] (-497.270) (-497.449) (-494.050) * (-497.449) [-493.651] (-493.891) (-494.031) -- 0:01:00
Average standard deviation of split frequencies: 0.016235
130500 -- [-493.952] (-494.342) (-498.482) (-494.084) * [-494.401] (-498.378) (-495.155) (-496.822) -- 0:00:59
131000 -- (-494.644) (-495.374) [-495.485] (-493.279) * (-493.846) (-499.377) [-493.927] (-498.566) -- 0:00:59
131500 -- (-493.660) (-499.268) (-497.057) [-496.252] * (-498.840) (-497.131) (-500.512) [-497.804] -- 0:00:59
132000 -- [-496.519] (-496.618) (-495.473) (-499.169) * (-498.006) (-494.254) (-495.366) [-496.294] -- 0:00:59
132500 -- (-497.346) (-499.048) (-498.569) [-497.179] * (-497.255) [-495.752] (-496.149) (-496.141) -- 0:00:58
133000 -- [-493.402] (-496.482) (-496.666) (-499.074) * (-495.249) (-495.599) (-495.612) [-493.982] -- 0:00:58
133500 -- [-494.095] (-495.128) (-493.905) (-496.999) * [-495.674] (-496.501) (-497.982) (-495.293) -- 0:00:58
134000 -- (-494.348) (-494.736) [-493.698] (-496.366) * (-498.790) (-496.714) [-494.079] (-496.248) -- 0:00:58
134500 -- [-497.323] (-495.750) (-496.325) (-497.222) * (-497.420) (-498.545) [-494.004] (-497.591) -- 0:00:57
135000 -- [-493.587] (-494.767) (-496.081) (-497.003) * (-495.896) (-501.637) [-494.516] (-494.638) -- 0:00:57
Average standard deviation of split frequencies: 0.014273
135500 -- (-494.056) (-494.645) (-494.897) [-497.328] * (-494.204) (-493.584) [-493.258] (-495.156) -- 0:00:57
136000 -- (-495.391) (-495.854) [-494.713] (-497.204) * (-495.402) [-494.902] (-497.202) (-493.468) -- 0:00:57
136500 -- (-494.832) [-499.392] (-498.077) (-495.381) * (-496.811) (-495.202) [-495.423] (-496.588) -- 0:00:56
137000 -- (-497.482) (-498.454) (-497.639) [-493.412] * [-495.223] (-494.911) (-494.494) (-495.431) -- 0:00:56
137500 -- (-494.761) (-495.942) [-500.036] (-497.456) * [-495.052] (-495.821) (-496.276) (-493.737) -- 0:00:56
138000 -- [-497.168] (-493.981) (-503.193) (-495.580) * (-496.591) [-493.764] (-493.224) (-497.698) -- 0:00:56
138500 -- (-495.582) (-494.589) (-497.141) [-494.929] * (-497.572) (-494.306) [-495.223] (-496.651) -- 0:00:55
139000 -- (-498.808) [-494.680] (-496.471) (-496.978) * (-498.259) (-493.808) (-496.672) [-497.433] -- 0:00:55
139500 -- (-499.614) (-494.556) [-494.312] (-502.726) * [-495.664] (-495.029) (-496.798) (-497.366) -- 0:00:55
140000 -- (-494.575) (-494.596) (-495.287) [-495.079] * (-497.573) [-497.142] (-495.118) (-495.763) -- 0:00:55
Average standard deviation of split frequencies: 0.014033
140500 -- (-495.243) [-493.621] (-496.618) (-495.110) * (-495.912) (-495.423) (-495.976) [-495.460] -- 0:00:55
141000 -- [-494.833] (-494.509) (-499.624) (-494.123) * (-495.539) [-494.208] (-495.993) (-498.587) -- 0:00:54
141500 -- (-496.299) (-496.823) [-496.814] (-498.402) * [-498.011] (-497.382) (-495.197) (-498.746) -- 0:00:54
142000 -- [-496.878] (-496.047) (-494.963) (-499.680) * [-496.282] (-497.629) (-497.358) (-497.815) -- 0:00:54
142500 -- (-494.616) (-497.392) [-495.001] (-497.821) * [-493.646] (-496.029) (-497.010) (-497.195) -- 0:01:00
143000 -- (-495.383) [-494.091] (-494.445) (-500.362) * (-494.480) (-496.188) [-496.005] (-497.601) -- 0:00:59
143500 -- [-494.900] (-494.540) (-497.748) (-494.612) * (-495.840) (-494.637) [-499.251] (-496.073) -- 0:00:59
144000 -- (-493.986) [-494.442] (-498.163) (-495.781) * [-494.199] (-500.272) (-497.987) (-495.006) -- 0:00:59
144500 -- (-498.564) [-495.622] (-495.488) (-494.018) * (-496.282) (-494.143) (-497.250) [-494.327] -- 0:00:59
145000 -- (-497.550) (-495.292) (-493.921) [-498.796] * (-494.028) (-494.432) [-494.636] (-494.346) -- 0:00:58
Average standard deviation of split frequencies: 0.013295
145500 -- [-494.380] (-495.876) (-496.021) (-496.959) * (-496.922) (-496.819) (-495.049) [-495.573] -- 0:00:58
146000 -- [-495.084] (-493.588) (-495.794) (-495.509) * (-496.264) [-495.770] (-496.179) (-495.802) -- 0:00:58
146500 -- (-496.288) (-493.972) [-497.164] (-494.730) * [-497.203] (-495.723) (-494.600) (-496.010) -- 0:00:58
147000 -- [-494.710] (-496.022) (-496.808) (-495.920) * (-495.216) [-498.435] (-494.172) (-499.193) -- 0:00:58
147500 -- (-493.783) [-496.863] (-502.674) (-493.263) * (-495.223) [-494.458] (-497.690) (-497.776) -- 0:00:57
148000 -- (-503.449) [-496.680] (-495.996) (-495.912) * (-497.765) (-497.690) [-497.172] (-497.685) -- 0:00:57
148500 -- [-499.380] (-496.941) (-495.794) (-493.830) * (-496.020) (-496.783) (-495.822) [-494.552] -- 0:00:57
149000 -- (-496.913) (-494.148) [-494.115] (-499.676) * (-495.574) (-497.906) [-495.272] (-502.564) -- 0:00:57
149500 -- [-495.690] (-501.440) (-495.652) (-495.206) * (-498.663) [-495.747] (-493.599) (-496.516) -- 0:00:56
150000 -- (-497.133) (-498.151) (-495.097) [-495.532] * [-496.423] (-498.081) (-495.876) (-496.419) -- 0:00:56
Average standard deviation of split frequencies: 0.014172
150500 -- [-495.518] (-493.411) (-494.896) (-497.661) * (-495.423) (-496.479) [-494.533] (-496.726) -- 0:00:56
151000 -- (-497.200) (-493.513) [-493.797] (-497.235) * (-498.351) (-494.709) (-494.548) [-494.459] -- 0:00:56
151500 -- (-494.492) (-496.463) [-495.030] (-496.266) * (-496.345) (-494.912) (-495.450) [-493.862] -- 0:00:56
152000 -- (-498.711) (-495.854) [-494.636] (-495.686) * [-493.630] (-500.817) (-496.114) (-493.764) -- 0:00:55
152500 -- (-494.501) (-494.235) [-495.163] (-495.520) * [-495.202] (-495.729) (-494.799) (-493.699) -- 0:00:55
153000 -- (-497.426) [-495.902] (-496.223) (-494.736) * (-494.016) (-496.190) (-496.856) [-497.170] -- 0:00:55
153500 -- [-494.210] (-496.847) (-494.634) (-495.034) * (-500.327) [-495.455] (-494.518) (-495.407) -- 0:00:55
154000 -- [-493.487] (-496.999) (-496.667) (-496.673) * [-496.397] (-495.082) (-495.549) (-496.100) -- 0:00:54
154500 -- (-496.415) (-495.649) [-496.086] (-495.682) * (-501.576) (-495.207) (-497.107) [-494.333] -- 0:00:54
155000 -- (-495.440) (-497.322) [-496.941] (-495.873) * [-497.584] (-500.333) (-497.434) (-495.140) -- 0:00:54
Average standard deviation of split frequencies: 0.015676
155500 -- (-499.729) (-495.891) [-496.196] (-497.244) * (-496.752) [-494.771] (-495.873) (-495.864) -- 0:00:54
156000 -- (-498.303) [-494.871] (-494.658) (-496.569) * [-496.159] (-494.707) (-494.773) (-495.475) -- 0:00:54
156500 -- (-495.688) [-494.599] (-494.125) (-497.350) * (-497.080) (-495.965) [-495.604] (-495.405) -- 0:00:53
157000 -- [-494.080] (-494.589) (-494.886) (-493.996) * (-495.418) [-494.576] (-494.027) (-495.898) -- 0:00:53
157500 -- (-495.301) [-494.714] (-495.577) (-494.162) * (-494.187) [-494.428] (-494.843) (-497.993) -- 0:00:53
158000 -- (-495.582) (-496.885) (-495.447) [-498.904] * [-495.377] (-495.213) (-493.657) (-497.855) -- 0:00:53
158500 -- (-495.796) [-494.795] (-497.598) (-497.163) * (-495.102) (-495.298) (-493.934) [-495.492] -- 0:00:58
159000 -- (-493.630) (-494.748) (-495.962) [-494.773] * (-494.972) (-493.716) (-495.951) [-495.639] -- 0:00:58
159500 -- (-494.132) (-494.033) [-493.909] (-495.584) * [-495.831] (-494.888) (-494.826) (-498.895) -- 0:00:57
160000 -- (-497.458) (-493.884) (-496.053) [-493.463] * [-493.435] (-495.675) (-494.915) (-498.441) -- 0:00:57
Average standard deviation of split frequencies: 0.015954
160500 -- (-498.197) (-495.461) (-497.047) [-495.160] * (-498.246) (-495.067) [-497.485] (-499.187) -- 0:00:57
161000 -- (-501.020) [-495.363] (-497.282) (-497.053) * (-498.840) (-494.431) (-494.420) [-497.140] -- 0:00:57
161500 -- [-497.578] (-498.680) (-496.192) (-496.036) * (-497.128) (-496.294) (-495.383) [-499.457] -- 0:00:57
162000 -- [-494.804] (-496.544) (-493.936) (-497.596) * (-495.339) [-494.861] (-494.103) (-493.490) -- 0:00:56
162500 -- (-496.772) (-494.600) (-498.878) [-495.965] * (-497.653) [-493.702] (-495.269) (-493.657) -- 0:00:56
163000 -- [-494.549] (-497.879) (-497.195) (-498.215) * [-498.063] (-496.867) (-496.985) (-494.655) -- 0:00:56
163500 -- [-493.744] (-497.052) (-497.691) (-501.359) * (-495.896) [-495.285] (-494.432) (-495.026) -- 0:00:56
164000 -- (-496.977) (-493.898) [-500.563] (-498.367) * [-494.137] (-496.780) (-496.485) (-494.050) -- 0:00:56
164500 -- [-494.038] (-494.823) (-496.160) (-494.900) * (-494.433) (-497.186) (-494.630) [-498.466] -- 0:00:55
165000 -- [-496.338] (-498.538) (-495.673) (-495.883) * (-494.897) (-495.723) (-496.846) [-494.100] -- 0:00:55
Average standard deviation of split frequencies: 0.015086
165500 -- (-494.032) (-498.682) [-495.322] (-497.755) * [-494.697] (-494.773) (-494.880) (-494.971) -- 0:00:55
166000 -- (-494.323) [-494.061] (-495.951) (-499.779) * (-495.261) (-495.551) (-495.874) [-496.015] -- 0:00:55
166500 -- (-498.074) [-494.245] (-495.192) (-502.675) * (-497.898) (-494.990) [-497.642] (-495.855) -- 0:00:55
167000 -- (-493.918) [-495.983] (-495.717) (-495.913) * (-495.086) (-497.061) [-494.756] (-495.094) -- 0:00:54
167500 -- (-496.214) [-497.158] (-493.722) (-498.990) * (-496.234) (-495.552) [-496.753] (-493.814) -- 0:00:54
168000 -- (-501.913) (-497.506) [-493.369] (-494.145) * (-495.305) (-496.446) (-494.616) [-494.003] -- 0:00:54
168500 -- [-494.869] (-504.804) (-496.897) (-495.855) * (-497.370) (-495.156) [-494.843] (-493.544) -- 0:00:54
169000 -- (-493.477) (-497.561) [-497.137] (-495.591) * (-496.273) [-494.001] (-496.108) (-494.851) -- 0:00:54
169500 -- [-496.159] (-496.100) (-494.805) (-497.697) * (-497.178) (-495.608) [-496.160] (-496.454) -- 0:00:53
170000 -- (-501.145) (-494.904) (-494.003) [-498.188] * [-498.275] (-496.585) (-497.223) (-493.895) -- 0:00:53
Average standard deviation of split frequencies: 0.015192
170500 -- [-496.962] (-494.808) (-494.298) (-499.145) * [-496.829] (-502.023) (-495.675) (-495.325) -- 0:00:53
171000 -- (-498.319) [-494.840] (-494.727) (-497.612) * (-497.564) (-498.035) [-494.189] (-496.599) -- 0:00:53
171500 -- (-496.305) (-493.337) (-494.310) [-499.704] * (-496.015) (-494.452) (-497.459) [-493.516] -- 0:00:53
172000 -- (-493.468) (-498.470) [-495.848] (-495.677) * [-494.785] (-495.762) (-505.988) (-495.408) -- 0:00:52
172500 -- [-494.515] (-494.977) (-495.624) (-495.851) * (-493.853) (-494.512) [-496.252] (-494.834) -- 0:00:52
173000 -- (-495.093) (-495.244) [-495.979] (-494.868) * (-497.607) [-494.398] (-494.696) (-495.363) -- 0:00:52
173500 -- (-494.399) (-496.735) (-493.783) [-497.948] * (-496.658) (-494.649) [-496.095] (-493.934) -- 0:00:52
174000 -- (-494.948) [-493.840] (-496.778) (-502.817) * (-498.329) (-497.407) [-495.531] (-494.369) -- 0:00:52
174500 -- (-496.746) [-494.354] (-495.824) (-505.812) * (-495.776) [-495.227] (-496.686) (-504.412) -- 0:00:52
175000 -- (-494.120) (-494.477) (-494.630) [-493.994] * (-495.424) (-494.884) (-496.361) [-496.149] -- 0:00:51
Average standard deviation of split frequencies: 0.015401
175500 -- (-494.518) (-498.380) (-496.332) [-493.736] * (-493.750) [-495.073] (-496.278) (-497.409) -- 0:00:56
176000 -- (-494.765) [-494.702] (-494.820) (-497.139) * (-493.995) (-495.598) (-496.261) [-498.506] -- 0:00:56
176500 -- (-495.160) (-495.678) [-494.484] (-508.579) * [-493.826] (-496.565) (-494.532) (-493.821) -- 0:00:55
177000 -- (-495.666) [-498.248] (-493.760) (-497.922) * (-494.704) [-493.547] (-498.937) (-493.283) -- 0:00:55
177500 -- (-496.764) [-499.209] (-494.132) (-497.662) * (-493.342) (-495.850) [-494.320] (-495.766) -- 0:00:55
178000 -- (-496.040) (-498.999) (-497.857) [-494.372] * (-494.936) [-495.489] (-493.921) (-496.531) -- 0:00:55
178500 -- (-498.022) [-496.366] (-496.991) (-494.303) * (-495.010) (-495.191) (-496.056) [-494.961] -- 0:00:55
179000 -- (-497.283) (-496.541) (-497.534) [-495.467] * (-496.487) [-496.259] (-495.259) (-495.561) -- 0:00:55
179500 -- (-498.836) (-495.107) (-497.058) [-494.448] * (-499.222) (-494.476) (-494.486) [-495.065] -- 0:00:54
180000 -- (-499.469) (-495.150) (-497.383) [-494.997] * (-497.563) [-495.020] (-495.681) (-494.742) -- 0:00:54
Average standard deviation of split frequencies: 0.014025
180500 -- (-497.079) [-496.690] (-497.101) (-495.099) * [-497.779] (-496.437) (-493.954) (-496.501) -- 0:00:54
181000 -- (-495.900) (-498.245) (-494.546) [-495.982] * [-496.684] (-498.438) (-494.359) (-495.934) -- 0:00:54
181500 -- [-496.262] (-493.872) (-494.189) (-496.240) * [-493.908] (-496.889) (-497.640) (-495.899) -- 0:00:54
182000 -- [-495.269] (-494.271) (-494.702) (-498.723) * [-494.001] (-494.919) (-497.641) (-494.346) -- 0:00:53
182500 -- (-498.681) [-494.213] (-493.463) (-493.343) * (-493.914) [-496.470] (-497.145) (-497.057) -- 0:00:53
183000 -- (-495.084) [-496.840] (-493.413) (-498.094) * (-494.513) (-496.342) [-495.223] (-495.568) -- 0:00:53
183500 -- (-494.182) [-495.276] (-495.616) (-497.582) * (-497.333) (-496.337) [-497.780] (-493.235) -- 0:00:53
184000 -- (-495.283) [-493.773] (-500.231) (-495.308) * (-499.957) (-494.882) (-495.891) [-495.095] -- 0:00:53
184500 -- [-494.163] (-494.842) (-495.578) (-494.991) * (-495.563) [-494.836] (-494.962) (-496.298) -- 0:00:53
185000 -- (-496.887) (-495.083) (-494.951) [-493.609] * (-495.955) [-497.694] (-495.016) (-494.041) -- 0:00:52
Average standard deviation of split frequencies: 0.013269
185500 -- [-494.588] (-497.117) (-494.494) (-495.864) * (-497.727) (-496.090) [-500.021] (-495.044) -- 0:00:52
186000 -- [-497.137] (-498.126) (-495.959) (-494.302) * (-496.188) (-495.099) [-493.639] (-494.417) -- 0:00:52
186500 -- (-497.938) (-495.253) (-496.327) [-494.594] * (-495.881) (-493.867) [-494.306] (-494.163) -- 0:00:52
187000 -- [-500.847] (-494.417) (-495.519) (-493.146) * [-495.517] (-493.701) (-497.437) (-502.470) -- 0:00:52
187500 -- (-497.767) (-495.136) (-495.443) [-494.329] * (-496.903) (-497.810) [-498.987] (-498.433) -- 0:00:52
188000 -- (-495.413) (-494.327) (-495.107) [-494.355] * (-500.739) (-497.080) (-497.151) [-497.800] -- 0:00:51
188500 -- (-495.251) (-493.882) [-497.549] (-497.097) * [-493.523] (-498.101) (-499.081) (-497.183) -- 0:00:51
189000 -- (-494.841) (-493.640) [-496.718] (-496.822) * [-493.608] (-496.295) (-498.023) (-496.276) -- 0:00:51
189500 -- (-497.990) [-494.362] (-495.662) (-495.644) * [-495.934] (-495.759) (-497.439) (-493.596) -- 0:00:51
190000 -- (-497.953) [-494.770] (-496.474) (-494.412) * (-494.666) (-496.242) (-495.417) [-495.081] -- 0:00:55
Average standard deviation of split frequencies: 0.012653
190500 -- (-495.657) (-493.794) [-494.660] (-494.756) * (-496.920) (-496.224) (-495.031) [-493.397] -- 0:00:55
191000 -- (-496.045) (-496.094) (-494.750) [-498.205] * (-499.746) (-495.613) (-500.197) [-497.011] -- 0:00:55
191500 -- (-498.370) (-494.703) (-494.020) [-496.337] * [-496.014] (-495.742) (-494.443) (-495.699) -- 0:00:54
192000 -- [-496.506] (-496.127) (-493.220) (-498.461) * [-495.091] (-496.009) (-497.375) (-497.473) -- 0:00:54
192500 -- (-494.228) (-495.780) (-495.605) [-493.572] * (-494.129) [-494.597] (-495.882) (-496.258) -- 0:00:54
193000 -- [-499.168] (-495.850) (-495.633) (-494.119) * (-494.783) (-500.434) (-495.496) [-496.222] -- 0:00:54
193500 -- [-496.847] (-497.935) (-495.874) (-495.508) * (-495.673) [-494.710] (-498.251) (-495.478) -- 0:00:54
194000 -- [-498.163] (-496.597) (-498.595) (-494.722) * (-496.576) [-495.871] (-499.053) (-497.796) -- 0:00:54
194500 -- [-495.300] (-495.318) (-500.190) (-497.878) * [-495.194] (-498.638) (-500.725) (-496.731) -- 0:00:53
195000 -- (-493.325) (-494.210) (-497.519) [-494.916] * (-497.438) [-496.447] (-500.858) (-493.965) -- 0:00:53
Average standard deviation of split frequencies: 0.011625
195500 -- (-495.074) (-495.292) (-496.950) [-495.657] * (-496.436) [-499.991] (-502.019) (-493.979) -- 0:00:53
196000 -- (-497.270) (-495.399) (-499.403) [-495.711] * [-495.350] (-505.638) (-493.555) (-496.784) -- 0:00:53
196500 -- (-496.686) (-495.248) (-495.522) [-495.237] * (-495.087) (-494.429) (-495.494) [-494.477] -- 0:00:53
197000 -- (-494.684) (-495.405) [-493.881] (-495.840) * (-497.136) (-497.018) (-494.024) [-494.060] -- 0:00:52
197500 -- (-495.572) (-495.353) (-495.575) [-495.773] * (-499.066) (-495.390) (-496.990) [-494.871] -- 0:00:52
198000 -- (-496.942) [-495.900] (-493.911) (-494.123) * [-496.462] (-495.366) (-497.032) (-498.141) -- 0:00:52
198500 -- (-495.465) (-495.273) [-494.831] (-501.452) * (-496.301) (-496.127) (-493.794) [-496.796] -- 0:00:52
199000 -- (-493.613) (-498.943) [-497.342] (-500.727) * (-495.267) (-503.145) (-501.373) [-498.009] -- 0:00:52
199500 -- [-493.905] (-494.794) (-497.291) (-497.416) * (-495.533) [-496.438] (-496.901) (-496.372) -- 0:00:52
200000 -- (-493.465) (-496.952) (-494.654) [-494.685] * (-496.171) (-495.962) [-495.451] (-497.518) -- 0:00:51
Average standard deviation of split frequencies: 0.012333
200500 -- [-495.473] (-496.283) (-494.565) (-496.323) * (-496.334) [-495.385] (-495.004) (-497.439) -- 0:00:51
201000 -- (-495.020) (-496.420) (-494.351) [-494.264] * (-496.350) (-493.921) [-495.628] (-496.363) -- 0:00:51
201500 -- (-494.395) (-495.824) [-493.614] (-499.254) * (-499.604) [-495.700] (-495.056) (-496.386) -- 0:00:51
202000 -- (-497.924) (-497.530) (-496.262) [-495.924] * (-497.501) (-494.892) [-496.402] (-495.027) -- 0:00:51
202500 -- (-494.251) [-499.399] (-495.277) (-496.281) * (-503.168) (-497.387) [-495.317] (-496.105) -- 0:00:51
203000 -- (-493.515) [-496.213] (-495.183) (-497.781) * (-496.336) (-497.428) (-493.632) [-494.654] -- 0:00:51
203500 -- (-493.338) (-495.885) (-493.623) [-497.919] * [-495.553] (-495.796) (-495.115) (-494.895) -- 0:00:50
204000 -- [-493.515] (-496.786) (-495.118) (-495.787) * [-495.541] (-500.013) (-495.849) (-494.246) -- 0:00:50
204500 -- (-494.550) (-497.180) (-495.716) [-496.037] * (-494.491) (-496.297) [-495.318] (-496.222) -- 0:00:50
205000 -- [-494.133] (-495.328) (-493.269) (-497.272) * [-494.023] (-493.868) (-498.439) (-496.752) -- 0:00:50
Average standard deviation of split frequencies: 0.012586
205500 -- (-494.709) [-498.970] (-493.217) (-494.974) * (-500.096) (-495.185) [-500.339] (-496.409) -- 0:00:50
206000 -- (-493.998) (-495.816) (-493.201) [-493.636] * (-497.891) (-494.573) [-497.103] (-494.220) -- 0:00:50
206500 -- (-497.940) (-494.655) (-493.124) [-495.731] * (-495.599) [-496.881] (-494.588) (-493.185) -- 0:00:49
207000 -- (-495.264) [-494.167] (-493.470) (-499.292) * [-495.801] (-496.864) (-493.920) (-495.187) -- 0:00:53
207500 -- (-497.216) (-497.586) [-496.196] (-496.532) * [-497.549] (-495.509) (-494.822) (-495.498) -- 0:00:53
208000 -- [-496.074] (-500.177) (-498.277) (-493.968) * (-495.223) [-493.991] (-494.761) (-494.339) -- 0:00:53
208500 -- (-496.993) (-495.085) [-494.104] (-494.174) * [-495.918] (-493.926) (-495.207) (-495.903) -- 0:00:53
209000 -- (-499.530) [-494.698] (-498.372) (-497.131) * [-496.568] (-493.617) (-498.270) (-496.576) -- 0:00:52
209500 -- (-497.093) (-498.036) (-500.138) [-495.558] * (-494.393) (-496.854) (-496.459) [-497.477] -- 0:00:52
210000 -- (-495.409) (-495.664) (-496.002) [-499.830] * (-497.396) (-494.109) [-495.925] (-493.777) -- 0:00:52
Average standard deviation of split frequencies: 0.013985
210500 -- [-495.195] (-494.941) (-497.347) (-497.315) * (-496.566) [-494.072] (-498.369) (-494.865) -- 0:00:52
211000 -- (-497.156) (-494.377) [-496.686] (-498.310) * (-500.808) (-497.037) (-495.485) [-495.401] -- 0:00:52
211500 -- (-494.519) (-498.712) (-499.976) [-497.093] * (-496.328) (-494.161) [-493.836] (-495.358) -- 0:00:52
212000 -- (-494.862) (-496.746) [-496.445] (-495.786) * (-496.080) (-495.429) (-493.737) [-499.321] -- 0:00:52
212500 -- (-495.820) [-494.202] (-495.044) (-496.410) * [-495.744] (-496.945) (-493.781) (-499.948) -- 0:00:51
213000 -- (-494.599) [-496.627] (-497.080) (-494.883) * (-499.752) (-494.841) (-493.939) [-495.781] -- 0:00:51
213500 -- (-498.584) [-494.365] (-499.788) (-495.843) * (-495.063) (-495.874) [-495.267] (-493.993) -- 0:00:51
214000 -- (-496.720) (-495.149) (-496.656) [-496.119] * (-496.846) (-494.931) (-498.748) [-496.062] -- 0:00:51
214500 -- (-494.003) (-496.312) [-494.523] (-495.277) * (-496.730) (-496.861) (-497.878) [-496.326] -- 0:00:51
215000 -- [-497.019] (-494.764) (-497.946) (-495.989) * (-501.060) (-497.058) (-493.740) [-495.688] -- 0:00:51
Average standard deviation of split frequencies: 0.013777
215500 -- (-494.807) [-495.805] (-494.591) (-494.626) * (-502.511) [-495.612] (-501.336) (-495.400) -- 0:00:50
216000 -- (-494.868) (-495.658) (-495.108) [-494.226] * (-495.223) [-496.092] (-498.705) (-493.670) -- 0:00:50
216500 -- (-494.433) (-495.684) [-495.835] (-493.331) * (-497.490) [-497.971] (-497.136) (-494.697) -- 0:00:50
217000 -- (-495.778) (-495.655) [-499.103] (-495.292) * [-502.444] (-495.121) (-493.863) (-494.409) -- 0:00:50
217500 -- (-499.232) (-500.270) (-498.912) [-495.883] * [-493.955] (-493.616) (-496.745) (-496.083) -- 0:00:50
218000 -- [-496.724] (-497.401) (-494.730) (-494.206) * (-495.087) (-494.546) [-495.372] (-494.334) -- 0:00:50
218500 -- (-501.907) (-495.765) [-496.625] (-495.034) * (-496.368) (-496.056) [-495.312] (-495.826) -- 0:00:50
219000 -- [-495.607] (-497.612) (-494.190) (-500.238) * [-495.089] (-494.925) (-493.567) (-495.051) -- 0:00:49
219500 -- (-499.713) [-496.159] (-496.830) (-497.183) * (-497.990) (-498.873) (-494.924) [-495.853] -- 0:00:49
220000 -- (-494.089) (-499.383) [-496.093] (-495.083) * (-496.450) (-496.152) (-497.768) [-495.314] -- 0:00:49
Average standard deviation of split frequencies: 0.014099
220500 -- (-494.087) (-498.767) (-497.830) [-497.106] * (-497.811) [-495.600] (-496.035) (-496.517) -- 0:00:49
221000 -- (-494.428) (-493.988) (-498.687) [-495.705] * [-494.918] (-497.408) (-495.097) (-496.069) -- 0:00:52
221500 -- (-495.032) (-498.487) [-494.529] (-502.404) * (-494.730) [-498.511] (-496.876) (-495.350) -- 0:00:52
222000 -- (-497.451) [-500.580] (-495.336) (-502.174) * (-494.997) (-498.045) [-498.104] (-498.298) -- 0:00:52
222500 -- [-494.198] (-501.268) (-494.551) (-495.060) * [-494.814] (-496.647) (-497.799) (-495.186) -- 0:00:52
223000 -- (-495.440) (-502.997) (-493.534) [-494.245] * (-494.946) (-495.037) [-495.932] (-497.644) -- 0:00:52
223500 -- [-493.665] (-498.294) (-495.437) (-495.505) * [-495.364] (-494.241) (-495.798) (-498.688) -- 0:00:52
224000 -- (-495.765) [-497.372] (-495.130) (-498.533) * (-495.470) [-497.562] (-495.030) (-497.525) -- 0:00:51
224500 -- [-495.823] (-498.033) (-496.448) (-494.108) * (-495.143) (-497.115) [-496.392] (-497.293) -- 0:00:51
225000 -- (-494.886) [-494.083] (-494.422) (-494.715) * (-495.381) (-494.102) [-495.460] (-497.610) -- 0:00:51
Average standard deviation of split frequencies: 0.015435
225500 -- (-498.605) (-493.374) [-493.957] (-495.465) * (-497.292) (-494.810) (-494.540) [-495.470] -- 0:00:51
226000 -- (-501.851) (-496.166) [-494.332] (-495.295) * (-502.140) (-498.259) [-495.568] (-493.964) -- 0:00:51
226500 -- (-495.184) [-494.340] (-496.527) (-496.002) * (-501.857) (-496.368) [-494.390] (-499.151) -- 0:00:51
227000 -- [-499.103] (-497.191) (-494.670) (-496.578) * (-499.763) [-499.154] (-494.371) (-495.255) -- 0:00:51
227500 -- (-494.834) (-497.939) [-497.836] (-495.154) * (-493.415) (-494.746) (-496.531) [-494.001] -- 0:00:50
228000 -- (-494.027) [-493.428] (-494.500) (-500.338) * (-495.086) [-496.754] (-501.864) (-496.765) -- 0:00:50
228500 -- (-494.547) (-498.040) [-495.079] (-495.754) * (-498.532) (-495.982) (-501.275) [-497.320] -- 0:00:50
229000 -- (-493.559) (-496.591) [-494.430] (-502.408) * (-495.985) (-497.071) [-495.173] (-496.507) -- 0:00:50
229500 -- [-494.916] (-498.743) (-498.160) (-501.090) * (-495.306) (-495.967) [-493.877] (-495.513) -- 0:00:50
230000 -- (-494.480) (-498.340) [-494.711] (-499.603) * (-497.050) [-493.324] (-493.372) (-495.264) -- 0:00:50
Average standard deviation of split frequencies: 0.015532
230500 -- [-493.507] (-494.259) (-494.342) (-495.848) * (-496.876) (-497.891) (-494.403) [-494.962] -- 0:00:50
231000 -- (-493.581) (-494.848) [-495.135] (-494.394) * (-496.096) (-499.098) [-494.770] (-497.744) -- 0:00:49
231500 -- (-499.439) (-495.435) [-493.905] (-495.526) * (-495.709) (-493.561) (-494.846) [-495.440] -- 0:00:49
232000 -- (-496.003) (-501.577) (-494.115) [-494.168] * (-497.531) [-494.823] (-498.090) (-494.248) -- 0:00:49
232500 -- (-500.457) [-493.919] (-494.476) (-494.431) * (-495.969) (-496.853) [-497.854] (-496.976) -- 0:00:49
233000 -- (-494.370) [-496.363] (-494.982) (-497.119) * [-495.058] (-496.493) (-496.176) (-496.078) -- 0:00:49
233500 -- (-495.516) [-500.018] (-494.770) (-496.553) * (-493.628) (-496.302) (-494.253) [-493.521] -- 0:00:49
234000 -- (-494.647) (-495.557) [-494.132] (-494.471) * (-495.257) (-495.059) [-494.126] (-502.662) -- 0:00:52
234500 -- (-496.766) (-494.528) [-494.254] (-494.251) * (-496.964) (-496.920) (-497.530) [-496.854] -- 0:00:52
235000 -- (-494.511) (-496.694) [-493.724] (-498.287) * (-496.006) (-498.044) [-495.113] (-496.873) -- 0:00:52
Average standard deviation of split frequencies: 0.015713
235500 -- [-493.488] (-496.146) (-494.122) (-495.985) * [-494.350] (-496.891) (-496.614) (-497.797) -- 0:00:51
236000 -- [-494.847] (-495.790) (-494.749) (-495.276) * (-494.910) (-493.907) [-497.485] (-495.858) -- 0:00:51
236500 -- [-497.657] (-495.438) (-496.605) (-495.698) * (-496.637) [-494.617] (-493.506) (-496.400) -- 0:00:51
237000 -- (-494.768) [-497.794] (-495.767) (-497.721) * (-497.036) [-495.146] (-496.266) (-496.004) -- 0:00:51
237500 -- (-496.447) (-496.538) (-494.860) [-496.671] * [-495.595] (-495.752) (-498.826) (-494.029) -- 0:00:51
238000 -- (-495.815) (-498.391) [-494.317] (-494.883) * [-499.013] (-495.459) (-495.643) (-497.283) -- 0:00:51
238500 -- (-496.191) (-494.538) (-494.295) [-494.346] * (-495.399) (-494.513) [-494.341] (-494.785) -- 0:00:51
239000 -- [-495.327] (-495.063) (-495.421) (-497.166) * [-494.084] (-493.430) (-494.113) (-499.224) -- 0:00:50
239500 -- (-496.041) [-495.823] (-495.494) (-497.052) * [-494.997] (-496.061) (-495.996) (-497.340) -- 0:00:50
240000 -- (-496.725) (-496.845) [-494.084] (-497.385) * (-495.362) (-496.525) (-494.232) [-497.917] -- 0:00:50
Average standard deviation of split frequencies: 0.015801
240500 -- (-497.591) [-494.465] (-496.371) (-495.119) * [-494.560] (-495.318) (-494.342) (-495.540) -- 0:00:50
241000 -- (-501.800) [-494.186] (-496.689) (-498.959) * (-497.091) (-500.824) (-495.871) [-494.533] -- 0:00:50
241500 -- (-498.256) [-495.547] (-495.900) (-495.039) * [-497.414] (-494.772) (-493.891) (-496.155) -- 0:00:50
242000 -- (-495.254) (-494.264) (-495.055) [-498.442] * (-499.526) (-496.103) (-496.449) [-494.058] -- 0:00:50
242500 -- (-493.329) (-496.013) (-493.955) [-498.616] * [-493.747] (-499.670) (-497.479) (-496.161) -- 0:00:49
243000 -- (-497.210) (-498.145) [-495.913] (-496.564) * (-495.964) (-498.233) [-494.583] (-498.676) -- 0:00:49
243500 -- [-495.580] (-495.695) (-494.371) (-494.634) * (-495.300) (-495.586) (-496.247) [-497.881] -- 0:00:49
244000 -- [-495.670] (-494.263) (-495.850) (-497.159) * (-499.131) (-495.840) (-498.456) [-496.391] -- 0:00:49
244500 -- [-494.954] (-493.245) (-496.111) (-494.843) * (-499.617) (-495.388) (-494.552) [-494.993] -- 0:00:49
245000 -- (-494.628) [-497.458] (-497.903) (-494.578) * (-496.994) [-495.481] (-494.716) (-494.559) -- 0:00:49
Average standard deviation of split frequencies: 0.016352
245500 -- [-494.017] (-494.828) (-497.203) (-497.417) * (-499.301) (-494.170) [-495.432] (-496.331) -- 0:00:49
246000 -- (-497.961) (-496.061) (-497.879) [-495.427] * (-497.254) (-497.639) (-494.213) [-494.450] -- 0:00:49
246500 -- [-497.584] (-495.233) (-497.439) (-494.725) * (-493.845) [-496.047] (-501.511) (-494.782) -- 0:00:48
247000 -- (-493.444) (-497.436) (-498.089) [-494.308] * (-494.635) (-498.910) (-497.588) [-494.834] -- 0:00:48
247500 -- [-500.047] (-496.264) (-494.186) (-495.305) * (-498.445) (-494.516) (-497.763) [-496.639] -- 0:00:51
248000 -- (-496.508) (-495.523) (-496.214) [-495.251] * (-498.268) [-494.901] (-493.966) (-495.711) -- 0:00:51
248500 -- (-494.557) (-500.020) (-494.096) [-495.861] * [-493.667] (-497.809) (-494.223) (-495.289) -- 0:00:51
249000 -- (-495.014) (-494.663) (-493.737) [-494.033] * (-495.414) (-497.508) (-494.526) [-497.885] -- 0:00:51
249500 -- [-495.071] (-496.716) (-493.845) (-496.233) * [-493.780] (-496.467) (-493.158) (-496.180) -- 0:00:51
250000 -- [-493.436] (-495.578) (-493.597) (-497.102) * (-496.462) [-495.356] (-494.065) (-498.032) -- 0:00:51
Average standard deviation of split frequencies: 0.015922
250500 -- [-495.395] (-498.191) (-494.396) (-497.984) * (-493.405) (-496.688) [-494.402] (-494.840) -- 0:00:50
251000 -- (-495.340) (-496.114) [-494.595] (-498.097) * (-493.653) [-495.786] (-495.080) (-494.021) -- 0:00:50
251500 -- (-497.786) (-497.750) (-494.454) [-495.542] * (-497.757) (-494.082) (-495.937) [-494.583] -- 0:00:50
252000 -- (-495.934) (-502.009) (-495.609) [-496.404] * (-495.190) (-494.444) (-496.058) [-494.730] -- 0:00:50
252500 -- [-493.740] (-501.038) (-495.810) (-495.355) * (-495.808) (-494.965) (-498.311) [-496.021] -- 0:00:50
253000 -- [-496.194] (-497.422) (-495.355) (-495.935) * [-495.773] (-495.248) (-494.819) (-496.256) -- 0:00:50
253500 -- (-499.884) (-497.267) (-496.068) [-494.131] * (-498.973) [-495.691] (-495.335) (-493.799) -- 0:00:50
254000 -- [-493.784] (-500.033) (-499.620) (-494.082) * (-498.661) (-499.238) [-494.446] (-493.839) -- 0:00:49
254500 -- (-493.210) (-495.291) [-495.272] (-496.602) * (-496.888) [-496.613] (-494.482) (-493.197) -- 0:00:49
255000 -- (-494.408) (-497.686) [-496.151] (-495.479) * [-494.233] (-495.256) (-493.840) (-499.425) -- 0:00:49
Average standard deviation of split frequencies: 0.016082
255500 -- (-497.445) (-494.897) (-494.647) [-496.367] * [-494.609] (-497.915) (-493.778) (-494.683) -- 0:00:49
256000 -- [-496.461] (-497.208) (-495.929) (-496.944) * [-493.692] (-496.387) (-494.073) (-495.851) -- 0:00:49
256500 -- (-494.031) (-493.615) [-495.280] (-497.008) * (-499.029) [-494.473] (-494.621) (-494.376) -- 0:00:49
257000 -- (-497.313) [-499.264] (-495.426) (-503.766) * [-496.668] (-497.364) (-494.951) (-497.012) -- 0:00:49
257500 -- (-493.591) [-496.169] (-497.340) (-498.845) * (-494.930) (-496.619) (-494.427) [-497.823] -- 0:00:49
258000 -- (-496.627) (-495.037) [-494.261] (-494.050) * (-493.515) [-497.183] (-496.806) (-495.199) -- 0:00:48
258500 -- [-493.845] (-495.258) (-495.674) (-496.022) * (-497.357) [-493.411] (-497.509) (-496.740) -- 0:00:48
259000 -- [-493.922] (-496.569) (-494.022) (-495.159) * (-495.865) [-498.576] (-494.833) (-497.495) -- 0:00:48
259500 -- (-493.497) (-502.898) (-495.011) [-495.757] * (-495.363) (-495.120) (-494.691) [-494.872] -- 0:00:48
260000 -- [-493.461] (-495.018) (-493.927) (-498.623) * (-498.186) [-495.117] (-494.394) (-496.736) -- 0:00:48
Average standard deviation of split frequencies: 0.017120
260500 -- (-494.652) (-494.958) (-494.751) [-499.808] * (-500.061) (-494.573) (-498.368) [-494.007] -- 0:00:48
261000 -- (-496.070) (-496.648) [-494.174] (-497.470) * (-496.270) (-495.021) [-494.971] (-494.790) -- 0:00:48
261500 -- (-499.075) (-500.339) (-496.411) [-494.227] * (-499.837) (-497.533) (-495.874) [-496.639] -- 0:00:48
262000 -- [-500.366] (-498.683) (-494.421) (-498.767) * (-507.176) [-494.191] (-495.549) (-499.405) -- 0:00:47
262500 -- (-497.028) (-500.688) (-497.957) [-497.287] * (-500.888) [-498.829] (-494.115) (-495.360) -- 0:00:47
263000 -- [-494.360] (-493.831) (-495.957) (-501.357) * (-497.791) (-498.401) (-498.425) [-495.266] -- 0:00:47
263500 -- (-496.026) (-494.898) [-493.672] (-500.170) * (-493.913) (-494.550) (-495.328) [-495.358] -- 0:00:47
264000 -- (-496.326) (-497.627) [-493.188] (-493.468) * (-494.984) (-494.528) (-496.452) [-495.642] -- 0:00:47
264500 -- (-500.182) (-496.579) (-494.724) [-494.289] * (-495.084) (-493.819) (-494.202) [-495.640] -- 0:00:50
265000 -- (-497.569) (-494.538) (-498.327) [-494.155] * [-494.770] (-495.381) (-494.379) (-496.841) -- 0:00:49
Average standard deviation of split frequencies: 0.019051
265500 -- (-497.566) (-495.807) (-493.785) [-498.541] * (-497.801) [-496.392] (-497.437) (-496.105) -- 0:00:49
266000 -- (-494.498) (-498.334) [-495.010] (-494.790) * (-498.217) (-495.668) (-494.762) [-493.790] -- 0:00:49
266500 -- [-495.254] (-496.609) (-500.667) (-496.988) * (-496.462) (-495.050) (-493.846) [-494.488] -- 0:00:49
267000 -- (-495.837) [-494.728] (-495.531) (-498.570) * [-494.595] (-494.206) (-495.424) (-494.786) -- 0:00:49
267500 -- (-498.367) (-499.712) [-495.687] (-499.375) * (-500.574) (-496.922) (-495.777) [-495.633] -- 0:00:49
268000 -- (-495.455) (-494.122) [-499.402] (-495.064) * [-495.613] (-494.636) (-501.153) (-495.237) -- 0:00:49
268500 -- (-499.827) [-495.567] (-497.538) (-493.939) * (-494.937) [-496.729] (-500.669) (-495.312) -- 0:00:49
269000 -- [-494.886] (-494.836) (-496.226) (-494.657) * (-495.295) [-496.164] (-495.725) (-495.787) -- 0:00:48
269500 -- (-495.289) (-498.843) [-494.188] (-494.558) * (-495.936) (-499.635) (-496.815) [-495.052] -- 0:00:48
270000 -- [-495.638] (-496.535) (-493.922) (-495.340) * [-495.742] (-494.812) (-498.072) (-495.123) -- 0:00:48
Average standard deviation of split frequencies: 0.019158
270500 -- (-495.063) [-493.806] (-494.188) (-493.623) * (-495.637) (-495.198) (-498.512) [-494.850] -- 0:00:48
271000 -- (-493.920) [-494.371] (-499.433) (-496.936) * (-494.043) (-494.728) [-495.148] (-495.966) -- 0:00:48
271500 -- (-497.996) [-494.878] (-500.302) (-495.264) * (-496.220) [-497.528] (-495.149) (-494.942) -- 0:00:48
272000 -- (-495.633) [-494.189] (-496.913) (-494.895) * [-497.938] (-493.975) (-494.226) (-495.503) -- 0:00:48
272500 -- (-493.371) (-495.420) [-495.341] (-496.093) * (-500.169) (-494.700) (-496.130) [-494.581] -- 0:00:48
273000 -- (-495.219) (-494.982) (-496.387) [-493.659] * (-495.367) (-500.382) (-499.079) [-494.591] -- 0:00:47
273500 -- [-494.063] (-494.843) (-501.288) (-496.000) * [-494.011] (-495.126) (-496.634) (-495.026) -- 0:00:47
274000 -- (-494.797) (-496.967) (-495.966) [-500.539] * (-496.573) (-495.425) [-495.452] (-495.786) -- 0:00:47
274500 -- (-497.254) [-497.034] (-496.383) (-500.506) * (-498.401) (-499.862) (-496.497) [-495.853] -- 0:00:47
275000 -- [-495.502] (-493.703) (-497.859) (-499.172) * [-495.402] (-495.945) (-497.143) (-499.781) -- 0:00:47
Average standard deviation of split frequencies: 0.018468
275500 -- (-494.006) (-494.186) (-499.389) [-494.286] * [-494.435] (-494.664) (-494.339) (-501.446) -- 0:00:47
276000 -- (-494.310) (-495.187) (-494.426) [-497.001] * [-495.238] (-495.627) (-493.253) (-503.994) -- 0:00:47
276500 -- [-493.592] (-493.724) (-494.830) (-494.633) * [-494.061] (-495.895) (-494.253) (-495.479) -- 0:00:47
277000 -- [-493.339] (-495.102) (-494.142) (-495.492) * [-496.615] (-495.352) (-503.555) (-496.937) -- 0:00:46
277500 -- (-496.521) (-497.092) (-493.856) [-500.904] * (-501.274) (-495.392) [-502.650] (-494.797) -- 0:00:46
278000 -- (-495.520) [-496.204] (-493.758) (-499.736) * (-496.101) [-493.903] (-495.193) (-495.385) -- 0:00:46
278500 -- (-493.568) [-497.814] (-493.806) (-495.030) * (-495.604) (-497.091) (-497.627) [-493.482] -- 0:00:46
279000 -- (-493.638) [-495.306] (-496.184) (-494.709) * [-497.004] (-496.263) (-494.380) (-493.704) -- 0:00:46
279500 -- (-495.796) [-499.699] (-493.923) (-497.643) * (-494.233) (-495.680) [-500.523] (-497.316) -- 0:00:46
280000 -- (-494.201) (-499.390) [-495.255] (-499.012) * (-496.775) (-496.099) (-494.065) [-498.350] -- 0:00:46
Average standard deviation of split frequencies: 0.018580
280500 -- (-496.479) (-494.031) [-495.030] (-494.215) * (-496.747) (-496.497) [-498.278] (-499.720) -- 0:00:46
281000 -- (-496.940) (-497.049) (-498.578) [-495.788] * (-495.545) [-494.596] (-494.673) (-500.671) -- 0:00:46
281500 -- (-497.741) [-493.662] (-497.485) (-495.461) * [-495.910] (-496.919) (-495.210) (-499.527) -- 0:00:48
282000 -- (-494.947) (-496.416) (-497.598) [-495.060] * (-493.846) (-495.667) (-498.614) [-493.806] -- 0:00:48
282500 -- (-496.335) (-498.268) (-496.539) [-493.454] * (-494.265) (-497.114) [-494.508] (-495.268) -- 0:00:48
283000 -- [-497.379] (-495.087) (-496.929) (-496.466) * (-494.035) (-498.055) [-494.690] (-493.419) -- 0:00:48
283500 -- (-497.907) (-496.415) (-495.838) [-496.834] * (-496.045) [-496.081] (-500.384) (-495.382) -- 0:00:48
284000 -- (-500.055) (-494.366) [-496.364] (-496.986) * (-496.078) (-495.216) (-495.704) [-496.443] -- 0:00:47
284500 -- (-493.547) (-495.130) [-494.942] (-495.901) * (-494.754) (-499.544) [-494.110] (-497.608) -- 0:00:47
285000 -- (-497.019) (-494.964) [-493.567] (-496.127) * [-497.835] (-496.168) (-495.294) (-494.918) -- 0:00:47
Average standard deviation of split frequencies: 0.018234
285500 -- [-494.250] (-497.096) (-495.475) (-493.402) * (-496.469) [-496.535] (-494.232) (-496.758) -- 0:00:47
286000 -- [-493.878] (-494.727) (-495.742) (-494.313) * (-495.842) (-496.996) (-496.246) [-497.894] -- 0:00:47
286500 -- (-494.611) (-493.894) [-494.443] (-497.164) * (-497.332) (-499.535) (-494.015) [-494.739] -- 0:00:47
287000 -- [-494.041] (-496.452) (-494.498) (-493.515) * (-496.333) [-499.773] (-500.811) (-495.631) -- 0:00:47
287500 -- (-494.404) (-494.946) (-499.166) [-495.194] * (-499.725) (-493.621) [-496.874] (-494.313) -- 0:00:47
288000 -- (-497.830) (-497.678) (-497.040) [-494.352] * (-493.513) (-494.099) (-494.092) [-495.222] -- 0:00:46
288500 -- (-497.834) (-494.951) (-494.744) [-494.277] * (-496.252) [-494.520] (-495.619) (-495.306) -- 0:00:46
289000 -- (-494.896) (-495.612) [-494.154] (-496.647) * (-497.045) (-495.798) [-498.074] (-501.956) -- 0:00:46
289500 -- (-493.594) (-494.646) [-495.281] (-497.024) * (-496.294) (-496.019) (-498.813) [-495.527] -- 0:00:46
290000 -- (-495.221) (-496.654) (-498.007) [-496.989] * [-495.701] (-498.295) (-494.978) (-494.634) -- 0:00:46
Average standard deviation of split frequencies: 0.017434
290500 -- (-493.568) (-494.049) [-495.973] (-496.967) * (-495.647) (-495.703) (-494.389) [-497.649] -- 0:00:46
291000 -- (-493.822) [-494.541] (-496.674) (-495.660) * (-495.405) (-494.733) [-495.026] (-496.546) -- 0:00:46
291500 -- (-496.166) (-498.235) [-494.711] (-497.596) * [-496.977] (-494.740) (-494.111) (-495.748) -- 0:00:46
292000 -- [-494.707] (-495.341) (-499.324) (-495.492) * (-495.865) [-493.844] (-495.006) (-498.505) -- 0:00:46
292500 -- (-495.410) (-494.426) [-496.911] (-495.862) * (-494.769) (-494.780) [-499.961] (-496.122) -- 0:00:45
293000 -- [-495.432] (-498.206) (-495.053) (-496.003) * (-494.534) (-498.575) [-494.541] (-496.092) -- 0:00:45
293500 -- (-495.746) (-495.293) [-495.521] (-495.892) * (-494.145) (-493.712) [-495.087] (-494.254) -- 0:00:45
294000 -- (-494.288) [-495.319] (-494.555) (-494.752) * (-493.843) [-493.935] (-494.760) (-496.660) -- 0:00:45
294500 -- (-494.203) (-497.813) (-500.673) [-494.097] * (-496.073) [-494.765] (-495.495) (-497.953) -- 0:00:45
295000 -- (-496.289) (-493.671) [-493.448] (-494.422) * (-495.145) (-496.401) [-496.177] (-497.969) -- 0:00:45
Average standard deviation of split frequencies: 0.016457
295500 -- (-498.915) (-494.886) (-493.588) [-496.829] * (-494.104) (-495.326) [-493.948] (-496.840) -- 0:00:45
296000 -- [-500.427] (-500.090) (-495.003) (-497.530) * (-499.365) (-500.268) [-495.498] (-497.234) -- 0:00:45
296500 -- (-494.636) [-494.167] (-494.619) (-495.474) * (-498.756) (-497.448) [-496.377] (-495.602) -- 0:00:45
297000 -- (-497.903) (-495.939) (-495.336) [-496.281] * (-497.800) [-499.843] (-493.907) (-493.521) -- 0:00:44
297500 -- (-494.106) (-494.190) [-494.944] (-499.047) * (-493.725) (-498.608) (-493.985) [-494.176] -- 0:00:44
298000 -- (-496.288) (-495.285) [-493.458] (-499.937) * (-503.602) [-499.242] (-494.435) (-497.410) -- 0:00:44
298500 -- (-493.427) [-494.507] (-493.487) (-495.130) * (-495.765) (-497.666) (-495.237) [-497.005] -- 0:00:47
299000 -- (-493.692) [-494.459] (-493.555) (-496.796) * (-494.585) (-495.857) (-493.842) [-495.136] -- 0:00:46
299500 -- (-501.293) [-494.993] (-494.993) (-496.455) * (-497.078) (-495.040) [-495.748] (-496.908) -- 0:00:46
300000 -- (-496.546) (-497.330) (-494.699) [-495.705] * (-494.218) [-494.390] (-499.653) (-495.125) -- 0:00:46
Average standard deviation of split frequencies: 0.016561
300500 -- (-500.701) (-497.658) [-494.247] (-494.037) * (-497.217) [-495.151] (-498.112) (-493.780) -- 0:00:46
301000 -- (-496.779) (-495.564) [-494.862] (-498.455) * (-497.766) [-496.029] (-496.400) (-493.985) -- 0:00:46
301500 -- (-494.208) (-494.613) (-497.843) [-497.085] * (-495.947) (-496.371) [-496.294] (-494.848) -- 0:00:46
302000 -- (-494.232) (-496.929) (-497.832) [-495.177] * [-496.459] (-496.950) (-499.537) (-495.392) -- 0:00:46
302500 -- (-496.965) [-495.662] (-498.014) (-495.395) * (-494.830) (-493.299) [-496.168] (-494.651) -- 0:00:46
303000 -- (-496.665) (-495.060) [-495.204] (-494.604) * (-498.033) (-494.659) [-493.553] (-497.030) -- 0:00:46
303500 -- [-499.430] (-496.903) (-494.419) (-494.948) * (-496.495) (-495.968) [-495.303] (-496.403) -- 0:00:45
304000 -- (-499.665) (-499.496) (-494.935) [-495.205] * (-494.141) (-495.940) (-494.334) [-494.182] -- 0:00:45
304500 -- [-497.274] (-499.147) (-494.597) (-496.918) * [-495.257] (-495.612) (-497.882) (-495.444) -- 0:00:45
305000 -- (-495.176) (-493.812) [-494.207] (-494.391) * (-495.592) (-495.954) [-494.927] (-497.478) -- 0:00:45
Average standard deviation of split frequencies: 0.016272
305500 -- (-495.018) (-494.514) (-496.141) [-496.296] * (-499.024) (-495.087) (-494.225) [-494.661] -- 0:00:45
306000 -- (-495.583) [-494.370] (-496.334) (-496.690) * (-494.838) [-499.327] (-496.308) (-495.756) -- 0:00:45
306500 -- (-496.056) (-494.595) [-493.851] (-495.161) * (-495.508) (-497.501) [-495.194] (-496.752) -- 0:00:45
307000 -- [-496.486] (-493.948) (-497.849) (-495.817) * (-494.679) (-496.743) (-498.063) [-497.841] -- 0:00:45
307500 -- (-495.194) (-495.707) (-498.149) [-495.379] * [-495.149] (-495.529) (-498.934) (-498.917) -- 0:00:45
308000 -- (-498.051) [-493.904] (-494.786) (-494.572) * [-493.719] (-493.734) (-495.022) (-497.001) -- 0:00:44
308500 -- (-494.940) (-495.155) [-502.654] (-495.775) * (-496.388) [-493.612] (-495.326) (-498.120) -- 0:00:44
309000 -- (-493.727) (-496.851) [-494.159] (-494.377) * (-494.489) [-494.705] (-494.864) (-497.946) -- 0:00:44
309500 -- (-494.664) [-496.065] (-495.723) (-501.295) * (-494.929) (-494.226) (-493.855) [-495.189] -- 0:00:44
310000 -- (-497.739) (-496.710) (-493.948) [-501.277] * (-493.920) [-496.182] (-493.895) (-496.251) -- 0:00:44
Average standard deviation of split frequencies: 0.016502
310500 -- [-494.838] (-496.687) (-494.377) (-495.602) * [-495.527] (-495.109) (-494.548) (-494.083) -- 0:00:44
311000 -- (-494.274) (-497.679) (-495.658) [-495.047] * (-498.353) [-495.909] (-493.692) (-494.347) -- 0:00:44
311500 -- [-495.106] (-495.390) (-499.398) (-496.687) * (-498.147) (-494.626) (-495.472) [-494.695] -- 0:00:44
312000 -- (-497.272) (-495.033) [-497.566] (-495.729) * (-494.440) (-494.447) (-496.283) [-495.218] -- 0:00:44
312500 -- [-497.045] (-494.801) (-496.080) (-493.736) * (-497.909) (-496.989) [-494.546] (-501.021) -- 0:00:44
313000 -- (-498.493) (-494.150) [-497.332] (-494.314) * (-500.342) (-494.075) [-494.854] (-495.001) -- 0:00:43
313500 -- [-495.427] (-496.095) (-496.360) (-494.318) * (-494.817) [-496.595] (-495.822) (-493.314) -- 0:00:45
314000 -- (-498.100) [-494.499] (-495.722) (-495.490) * (-494.403) (-495.429) (-496.514) [-495.670] -- 0:00:45
314500 -- [-496.196] (-493.798) (-495.839) (-494.983) * (-495.638) [-494.509] (-497.265) (-493.787) -- 0:00:45
315000 -- (-494.594) (-494.011) [-497.365] (-494.232) * (-494.982) (-495.448) (-498.998) [-495.262] -- 0:00:45
Average standard deviation of split frequencies: 0.015104
315500 -- [-495.212] (-495.307) (-495.207) (-494.363) * (-494.747) [-495.481] (-499.098) (-494.231) -- 0:00:45
316000 -- (-496.219) [-494.117] (-494.856) (-495.050) * [-493.920] (-497.290) (-498.192) (-498.436) -- 0:00:45
316500 -- [-495.334] (-493.830) (-495.215) (-497.184) * (-495.562) [-495.999] (-495.646) (-495.518) -- 0:00:45
317000 -- (-495.060) (-494.071) (-493.595) [-495.652] * (-495.463) [-496.383] (-494.655) (-495.807) -- 0:00:45
317500 -- [-493.839] (-497.979) (-494.247) (-494.910) * (-495.433) [-499.959] (-497.588) (-496.316) -- 0:00:45
318000 -- (-495.292) [-494.447] (-495.877) (-500.018) * (-493.935) (-495.742) [-495.691] (-494.368) -- 0:00:45
318500 -- (-495.415) (-495.122) [-496.976] (-495.536) * (-498.814) (-496.392) (-493.558) [-500.189] -- 0:00:44
319000 -- (-493.442) (-494.349) [-497.071] (-494.690) * (-495.298) (-497.192) [-497.818] (-495.031) -- 0:00:44
319500 -- (-494.998) [-493.296] (-494.815) (-494.832) * (-495.279) (-494.726) (-493.844) [-493.599] -- 0:00:44
320000 -- (-495.181) [-494.933] (-496.098) (-493.851) * (-495.539) [-495.001] (-495.790) (-494.506) -- 0:00:44
Average standard deviation of split frequencies: 0.014793
320500 -- (-497.902) (-496.547) (-500.465) [-495.028] * [-496.810] (-494.336) (-495.716) (-493.680) -- 0:00:44
321000 -- (-498.074) [-498.402] (-496.722) (-494.187) * (-495.467) (-494.877) (-494.336) [-495.056] -- 0:00:44
321500 -- [-495.578] (-495.430) (-497.174) (-496.681) * (-494.201) (-498.308) [-495.816] (-494.605) -- 0:00:44
322000 -- (-497.575) (-497.111) (-494.841) [-497.569] * (-497.966) (-496.726) [-495.341] (-498.245) -- 0:00:44
322500 -- (-497.341) (-494.292) (-496.334) [-496.173] * (-497.200) (-495.870) [-494.828] (-494.548) -- 0:00:44
323000 -- (-493.769) [-496.546] (-494.350) (-495.111) * (-494.015) [-495.563] (-494.576) (-494.441) -- 0:00:44
323500 -- (-495.677) [-494.895] (-494.355) (-494.777) * (-494.655) (-494.958) [-497.429] (-493.762) -- 0:00:43
324000 -- (-496.525) (-494.324) [-493.826] (-496.934) * (-494.844) (-496.870) [-495.016] (-495.454) -- 0:00:43
324500 -- [-495.732] (-494.993) (-496.384) (-498.467) * [-494.941] (-495.839) (-497.666) (-494.867) -- 0:00:43
325000 -- [-495.920] (-497.140) (-496.565) (-494.365) * [-497.889] (-494.147) (-496.509) (-493.618) -- 0:00:43
Average standard deviation of split frequencies: 0.015056
325500 -- (-496.679) [-494.318] (-499.144) (-494.579) * (-495.060) [-496.591] (-493.940) (-495.470) -- 0:00:43
326000 -- (-494.901) (-499.266) [-497.677] (-496.058) * [-494.444] (-497.633) (-493.968) (-496.659) -- 0:00:43
326500 -- [-495.044] (-498.478) (-504.654) (-497.880) * (-495.371) (-498.992) [-496.584] (-495.449) -- 0:00:43
327000 -- (-495.099) [-495.149] (-496.938) (-495.641) * (-493.849) (-497.556) (-494.321) [-494.959] -- 0:00:43
327500 -- (-495.132) (-494.675) (-498.964) [-495.952] * (-495.965) [-494.728] (-495.727) (-496.051) -- 0:00:43
328000 -- [-494.918] (-495.044) (-494.043) (-494.662) * [-495.509] (-494.029) (-494.736) (-495.386) -- 0:00:43
328500 -- [-497.772] (-495.155) (-494.464) (-494.785) * (-495.327) (-502.148) [-495.075] (-496.266) -- 0:00:42
329000 -- [-495.493] (-494.576) (-496.482) (-496.010) * (-494.956) (-497.769) [-498.136] (-495.555) -- 0:00:42
329500 -- (-496.667) (-494.588) (-496.316) [-494.568] * [-495.152] (-496.217) (-494.529) (-494.288) -- 0:00:42
330000 -- (-494.848) (-496.175) (-496.274) [-494.584] * [-495.574] (-496.762) (-497.726) (-493.595) -- 0:00:42
Average standard deviation of split frequencies: 0.013753
330500 -- (-493.770) (-498.565) [-493.934] (-498.921) * (-495.177) (-494.736) [-496.938] (-497.592) -- 0:00:44
331000 -- [-495.001] (-497.897) (-494.854) (-494.302) * (-495.271) (-495.385) (-497.115) [-495.788] -- 0:00:44
331500 -- (-495.923) [-496.294] (-498.798) (-494.681) * [-495.602] (-496.796) (-496.456) (-493.728) -- 0:00:44
332000 -- [-494.115] (-496.216) (-501.299) (-498.528) * (-497.182) (-494.688) [-495.110] (-495.975) -- 0:00:44
332500 -- [-495.355] (-498.671) (-500.407) (-500.616) * (-497.265) [-494.287] (-496.558) (-494.000) -- 0:00:44
333000 -- (-493.758) (-495.030) [-496.028] (-498.232) * (-498.745) [-495.140] (-498.206) (-494.099) -- 0:00:44
333500 -- (-495.399) (-493.424) (-493.958) [-496.471] * (-495.749) (-496.358) [-493.401] (-496.631) -- 0:00:43
334000 -- (-494.395) [-494.255] (-498.476) (-494.095) * (-496.432) (-493.999) [-494.145] (-496.529) -- 0:00:43
334500 -- (-494.244) (-495.160) (-496.447) [-493.295] * (-493.896) (-497.175) [-493.989] (-493.819) -- 0:00:43
335000 -- (-494.036) (-493.422) (-494.023) [-495.668] * (-496.048) (-493.841) (-493.694) [-494.526] -- 0:00:43
Average standard deviation of split frequencies: 0.013767
335500 -- (-493.906) (-493.397) [-494.020] (-495.563) * (-495.510) (-494.140) [-493.532] (-495.404) -- 0:00:43
336000 -- [-495.055] (-494.584) (-493.719) (-497.135) * (-495.589) [-495.302] (-496.869) (-493.899) -- 0:00:43
336500 -- [-495.254] (-493.735) (-493.826) (-494.328) * (-493.911) (-494.884) [-494.186] (-497.895) -- 0:00:43
337000 -- (-493.437) [-497.985] (-493.881) (-495.844) * [-497.083] (-497.494) (-495.173) (-494.104) -- 0:00:43
337500 -- (-496.660) (-494.965) [-498.180] (-494.414) * [-493.466] (-498.737) (-495.237) (-495.464) -- 0:00:43
338000 -- (-498.661) (-494.032) (-494.301) [-494.604] * (-493.858) (-496.429) (-497.046) [-494.255] -- 0:00:43
338500 -- (-495.360) (-497.194) (-496.893) [-496.674] * (-500.718) [-494.594] (-495.286) (-498.484) -- 0:00:42
339000 -- (-497.214) (-496.591) [-496.172] (-495.237) * (-493.339) (-497.168) (-495.626) [-499.352] -- 0:00:42
339500 -- (-499.125) (-495.698) (-493.929) [-494.761] * (-497.167) (-496.764) (-497.297) [-494.973] -- 0:00:42
340000 -- (-493.770) [-496.154] (-498.775) (-497.121) * (-496.849) [-494.370] (-493.817) (-493.782) -- 0:00:42
Average standard deviation of split frequencies: 0.012800
340500 -- (-495.398) (-495.511) [-496.473] (-495.116) * (-495.605) (-494.213) (-497.207) [-496.430] -- 0:00:42
341000 -- (-495.555) [-494.823] (-495.090) (-496.843) * (-494.498) [-496.067] (-493.980) (-498.092) -- 0:00:42
341500 -- (-494.408) (-501.163) [-495.957] (-495.278) * (-494.916) [-494.973] (-493.933) (-499.365) -- 0:00:42
342000 -- (-495.649) (-494.293) (-494.543) [-493.559] * (-495.086) (-493.267) [-496.245] (-497.042) -- 0:00:42
342500 -- (-496.542) (-495.527) [-495.877] (-497.032) * (-498.330) [-493.755] (-495.076) (-494.895) -- 0:00:42
343000 -- (-495.659) (-494.964) [-494.524] (-496.105) * (-497.745) (-494.529) [-493.889] (-493.371) -- 0:00:42
343500 -- (-495.789) (-493.458) [-496.609] (-496.610) * (-498.020) (-497.418) [-493.500] (-493.498) -- 0:00:42
344000 -- (-496.498) [-493.534] (-496.091) (-497.711) * (-495.911) (-496.008) (-496.578) [-494.337] -- 0:00:41
344500 -- (-495.867) (-494.362) [-500.946] (-500.216) * (-494.952) (-501.347) [-495.883] (-494.776) -- 0:00:41
345000 -- [-494.044] (-493.726) (-497.639) (-494.619) * [-494.311] (-496.675) (-495.827) (-497.113) -- 0:00:41
Average standard deviation of split frequencies: 0.011325
345500 -- (-493.546) (-493.820) [-494.825] (-496.180) * (-498.142) (-498.122) (-501.531) [-494.398] -- 0:00:41
346000 -- (-494.952) [-493.361] (-494.456) (-495.097) * (-496.475) [-495.168] (-497.552) (-494.992) -- 0:00:41
346500 -- [-494.465] (-500.241) (-494.691) (-494.187) * (-493.868) (-496.995) (-496.074) [-494.849] -- 0:00:41
347000 -- (-494.513) [-497.001] (-493.367) (-493.814) * [-494.527] (-503.330) (-495.116) (-499.243) -- 0:00:41
347500 -- (-495.351) (-494.153) (-495.685) [-496.784] * (-495.659) (-497.141) (-493.973) [-496.618] -- 0:00:41
348000 -- (-497.685) (-498.613) (-496.915) [-496.730] * (-499.430) (-495.108) [-498.804] (-496.495) -- 0:00:43
348500 -- (-494.771) [-496.648] (-497.716) (-494.462) * [-501.726] (-497.100) (-496.381) (-496.795) -- 0:00:42
349000 -- (-497.403) [-494.802] (-497.432) (-494.462) * (-495.924) [-497.293] (-499.839) (-496.421) -- 0:00:42
349500 -- [-496.021] (-494.785) (-499.915) (-494.077) * [-495.230] (-495.676) (-495.189) (-495.254) -- 0:00:42
350000 -- (-497.222) (-493.694) [-494.695] (-496.551) * [-494.982] (-495.256) (-495.493) (-497.600) -- 0:00:42
Average standard deviation of split frequencies: 0.011595
350500 -- [-496.360] (-494.182) (-498.030) (-496.412) * (-494.928) (-496.027) [-497.579] (-494.197) -- 0:00:42
351000 -- (-494.896) (-494.032) [-497.944] (-499.915) * (-495.482) (-494.904) (-495.479) [-497.484] -- 0:00:42
351500 -- (-493.659) (-498.547) [-496.653] (-495.597) * (-494.353) [-493.522] (-495.014) (-496.531) -- 0:00:42
352000 -- (-493.808) (-496.658) [-493.707] (-495.709) * (-497.763) [-494.832] (-496.249) (-497.204) -- 0:00:42
352500 -- (-498.419) (-500.398) [-495.454] (-497.596) * [-495.436] (-494.803) (-494.727) (-497.732) -- 0:00:42
353000 -- (-494.879) (-502.600) (-499.670) [-496.820] * (-495.206) [-493.660] (-494.999) (-495.770) -- 0:00:42
353500 -- (-495.039) [-498.490] (-497.812) (-496.781) * [-494.112] (-493.452) (-495.890) (-496.099) -- 0:00:42
354000 -- [-495.482] (-498.445) (-496.190) (-494.742) * (-495.983) (-493.208) [-498.518] (-495.786) -- 0:00:41
354500 -- (-497.481) [-494.097] (-496.733) (-496.966) * (-494.896) (-494.026) (-495.000) [-499.304] -- 0:00:41
355000 -- (-498.773) (-497.851) (-494.780) [-493.865] * [-495.268] (-494.997) (-495.992) (-493.800) -- 0:00:41
Average standard deviation of split frequencies: 0.012745
355500 -- (-500.638) (-498.301) (-495.319) [-496.612] * (-498.069) (-495.153) (-494.299) [-494.841] -- 0:00:41
356000 -- [-495.801] (-495.873) (-495.993) (-496.371) * (-496.911) (-494.736) [-493.851] (-495.691) -- 0:00:41
356500 -- (-495.472) (-500.498) [-497.776] (-494.359) * [-493.892] (-494.397) (-499.122) (-496.274) -- 0:00:41
357000 -- (-496.128) (-501.995) (-495.378) [-495.660] * (-495.366) [-494.376] (-494.696) (-495.975) -- 0:00:41
357500 -- [-495.458] (-496.322) (-494.365) (-496.223) * (-496.786) [-498.447] (-494.866) (-497.560) -- 0:00:41
358000 -- (-494.236) [-497.081] (-495.884) (-496.016) * [-494.139] (-495.949) (-494.130) (-494.327) -- 0:00:41
358500 -- (-496.491) (-498.208) [-497.042] (-495.763) * (-494.709) (-494.873) [-493.351] (-494.140) -- 0:00:41
359000 -- (-499.204) (-494.802) [-496.286] (-498.492) * (-495.630) (-493.542) (-494.189) [-498.183] -- 0:00:41
359500 -- (-495.117) (-494.402) (-497.256) [-498.045] * (-497.967) (-493.823) [-495.602] (-493.889) -- 0:00:40
360000 -- [-496.107] (-497.135) (-498.382) (-495.402) * (-494.946) (-494.887) [-495.762] (-495.539) -- 0:00:40
Average standard deviation of split frequencies: 0.012253
360500 -- (-494.859) (-493.575) (-496.359) [-494.844] * (-494.311) (-496.851) [-493.972] (-498.039) -- 0:00:40
361000 -- (-494.705) [-499.067] (-495.000) (-494.585) * (-495.463) (-497.685) [-493.762] (-494.027) -- 0:00:40
361500 -- (-494.014) [-494.120] (-498.232) (-495.099) * [-496.437] (-494.465) (-497.944) (-498.618) -- 0:00:40
362000 -- (-496.910) [-496.396] (-496.033) (-494.737) * [-498.645] (-494.673) (-497.283) (-496.635) -- 0:00:40
362500 -- [-495.685] (-497.471) (-495.309) (-496.903) * (-496.664) (-497.527) [-494.053] (-494.792) -- 0:00:40
363000 -- [-498.187] (-495.646) (-493.702) (-499.497) * (-494.164) [-495.663] (-495.642) (-496.714) -- 0:00:40
363500 -- (-495.293) [-495.342] (-494.963) (-495.914) * (-495.389) [-494.658] (-495.412) (-495.112) -- 0:00:40
364000 -- [-496.385] (-496.441) (-495.446) (-493.506) * [-494.722] (-494.217) (-494.931) (-496.118) -- 0:00:40
364500 -- (-494.381) (-497.851) (-495.497) [-493.882] * [-494.737] (-495.025) (-495.134) (-495.836) -- 0:00:40
365000 -- (-497.848) (-498.727) (-497.213) [-499.471] * (-494.533) (-495.670) [-497.460] (-495.980) -- 0:00:41
Average standard deviation of split frequencies: 0.011109
365500 -- [-495.735] (-495.408) (-496.268) (-497.338) * (-494.586) [-495.097] (-495.604) (-494.275) -- 0:00:41
366000 -- (-496.354) (-498.134) (-496.885) [-494.290] * [-497.648] (-495.121) (-498.584) (-496.575) -- 0:00:41
366500 -- (-495.728) (-499.159) (-496.645) [-494.298] * (-495.620) (-494.147) (-494.425) [-494.915] -- 0:00:41
367000 -- (-496.173) [-496.611] (-500.503) (-495.212) * [-494.193] (-497.193) (-495.420) (-495.546) -- 0:00:41
367500 -- [-494.382] (-493.787) (-494.888) (-495.148) * (-495.596) (-497.474) [-495.383] (-495.050) -- 0:00:41
368000 -- (-498.439) (-494.655) [-495.966] (-497.370) * (-496.611) (-497.072) (-498.549) [-496.424] -- 0:00:41
368500 -- (-500.599) [-493.377] (-495.832) (-498.434) * [-495.210] (-494.342) (-495.776) (-496.076) -- 0:00:41
369000 -- (-495.380) (-493.808) [-493.978] (-496.446) * (-494.469) (-495.965) [-496.128] (-494.482) -- 0:00:41
369500 -- (-496.656) (-496.155) [-493.550] (-494.038) * (-496.257) (-494.367) (-498.362) [-494.782] -- 0:00:40
370000 -- [-495.184] (-493.938) (-495.755) (-495.061) * (-496.556) (-494.879) [-497.442] (-495.537) -- 0:00:40
Average standard deviation of split frequencies: 0.010492
370500 -- (-494.936) (-496.778) (-501.121) [-496.211] * (-494.382) (-495.337) (-493.712) [-494.292] -- 0:00:40
371000 -- (-493.664) (-498.054) [-497.030] (-496.652) * (-494.605) [-494.792] (-495.311) (-494.426) -- 0:00:40
371500 -- [-494.373] (-497.952) (-496.561) (-494.109) * [-494.575] (-495.585) (-499.282) (-494.417) -- 0:00:40
372000 -- (-494.777) (-495.696) (-493.212) [-497.690] * (-495.043) (-495.833) (-497.279) [-496.480] -- 0:00:40
372500 -- [-495.378] (-495.360) (-495.287) (-496.544) * (-494.255) (-498.434) (-496.614) [-493.725] -- 0:00:40
373000 -- (-498.828) (-497.520) (-497.089) [-495.779] * (-496.730) [-494.399] (-500.726) (-495.433) -- 0:00:40
373500 -- [-496.484] (-497.319) (-494.302) (-496.474) * (-498.751) [-497.855] (-494.286) (-493.928) -- 0:00:40
374000 -- [-499.237] (-501.468) (-497.781) (-496.295) * (-496.079) (-495.932) [-496.586] (-495.034) -- 0:00:40
374500 -- [-494.616] (-495.217) (-496.783) (-495.030) * (-496.458) (-495.048) [-497.945] (-494.243) -- 0:00:40
375000 -- (-498.491) (-495.853) (-495.066) [-498.070] * (-493.751) (-494.311) [-496.870] (-494.021) -- 0:00:40
Average standard deviation of split frequencies: 0.010108
375500 -- (-495.512) (-494.501) (-494.527) [-494.927] * (-495.765) (-496.929) [-497.060] (-499.015) -- 0:00:39
376000 -- (-496.981) [-495.368] (-494.640) (-493.635) * (-496.838) (-495.289) [-494.379] (-500.148) -- 0:00:39
376500 -- [-496.059] (-496.065) (-496.895) (-493.980) * [-493.559] (-495.608) (-497.798) (-497.518) -- 0:00:39
377000 -- (-495.344) [-496.210] (-496.306) (-496.902) * (-497.958) (-496.714) (-498.174) [-493.536] -- 0:00:39
377500 -- (-495.280) (-497.120) (-494.316) [-497.879] * (-496.207) [-496.680] (-495.533) (-495.724) -- 0:00:39
378000 -- [-494.444] (-496.384) (-498.238) (-494.268) * (-500.973) [-495.277] (-493.880) (-494.760) -- 0:00:39
378500 -- (-495.026) (-496.609) (-497.426) [-494.250] * (-500.745) (-500.649) (-495.796) [-497.504] -- 0:00:39
379000 -- (-494.620) (-495.822) (-495.296) [-498.837] * (-498.214) (-495.450) [-495.144] (-500.098) -- 0:00:39
379500 -- (-495.784) (-495.802) [-494.613] (-498.497) * (-499.826) [-496.201] (-496.173) (-500.073) -- 0:00:39
380000 -- (-497.097) (-496.355) (-495.868) [-496.379] * (-496.179) [-493.914] (-498.168) (-495.021) -- 0:00:39
Average standard deviation of split frequencies: 0.010449
380500 -- (-496.114) (-494.071) (-497.050) [-494.276] * (-495.282) (-494.795) [-498.825] (-495.060) -- 0:00:39
381000 -- [-494.907] (-497.347) (-495.780) (-494.245) * (-493.801) (-499.313) (-499.815) [-494.845] -- 0:00:38
381500 -- (-495.037) (-499.957) (-495.882) [-497.368] * (-499.285) (-501.908) [-495.392] (-495.736) -- 0:00:38
382000 -- [-496.743] (-498.305) (-496.497) (-495.574) * [-495.782] (-493.811) (-496.876) (-495.179) -- 0:00:40
382500 -- [-494.317] (-499.164) (-494.516) (-494.303) * [-495.488] (-494.147) (-496.689) (-493.771) -- 0:00:40
383000 -- (-496.254) (-494.505) (-497.873) [-493.845] * (-497.418) (-497.165) [-497.377] (-498.636) -- 0:00:40
383500 -- (-493.542) (-497.910) (-495.984) [-495.946] * (-497.980) [-494.595] (-497.439) (-496.642) -- 0:00:40
384000 -- [-493.208] (-503.780) (-494.130) (-495.026) * (-497.365) (-496.961) [-495.819] (-494.492) -- 0:00:40
384500 -- (-493.925) [-495.031] (-494.287) (-496.955) * (-496.434) [-494.729] (-493.852) (-497.040) -- 0:00:40
385000 -- (-494.565) (-496.429) (-498.155) [-495.156] * (-494.353) (-494.726) (-495.411) [-495.980] -- 0:00:39
Average standard deviation of split frequencies: 0.011297
385500 -- (-494.339) [-495.035] (-496.324) (-494.084) * (-493.330) (-497.273) [-494.665] (-496.502) -- 0:00:39
386000 -- (-496.273) [-494.436] (-499.680) (-494.527) * [-495.718] (-493.717) (-496.818) (-497.144) -- 0:00:39
386500 -- [-494.136] (-494.790) (-502.448) (-496.157) * (-496.510) (-493.588) (-494.628) [-496.821] -- 0:00:39
387000 -- (-496.240) (-496.437) (-498.914) [-493.470] * (-495.331) [-495.497] (-500.039) (-494.153) -- 0:00:39
387500 -- (-496.796) (-495.463) [-495.562] (-495.985) * [-498.233] (-495.909) (-497.324) (-494.388) -- 0:00:39
388000 -- (-499.557) (-494.935) [-494.324] (-493.200) * (-495.609) (-495.563) [-493.666] (-497.585) -- 0:00:39
388500 -- (-499.141) (-494.992) (-497.134) [-494.692] * (-494.254) [-494.527] (-495.659) (-494.784) -- 0:00:39
389000 -- (-499.742) [-494.588] (-499.745) (-494.000) * (-494.695) (-498.368) (-501.499) [-493.928] -- 0:00:39
389500 -- [-494.435] (-495.436) (-496.266) (-493.624) * (-496.381) (-495.505) (-494.367) [-495.035] -- 0:00:39
390000 -- [-494.482] (-495.942) (-498.094) (-495.642) * [-495.597] (-496.451) (-494.367) (-495.262) -- 0:00:39
Average standard deviation of split frequencies: 0.011539
390500 -- [-495.164] (-500.662) (-494.241) (-498.586) * [-496.180] (-495.803) (-497.199) (-497.356) -- 0:00:39
391000 -- (-494.128) (-496.683) [-494.207] (-496.676) * [-497.420] (-494.372) (-496.285) (-494.862) -- 0:00:38
391500 -- (-495.548) (-499.412) [-493.815] (-496.445) * (-493.825) [-495.179] (-497.245) (-499.082) -- 0:00:38
392000 -- [-494.984] (-496.153) (-495.886) (-494.534) * (-496.794) [-496.718] (-494.006) (-496.026) -- 0:00:38
392500 -- (-498.715) [-497.558] (-499.548) (-499.125) * [-496.645] (-494.085) (-495.365) (-495.226) -- 0:00:38
393000 -- (-495.327) [-493.127] (-493.949) (-494.521) * (-494.285) (-494.211) (-495.421) [-495.194] -- 0:00:38
393500 -- [-494.739] (-495.673) (-495.723) (-494.015) * (-494.150) (-495.118) [-495.727] (-494.609) -- 0:00:38
394000 -- [-494.690] (-493.207) (-497.845) (-493.886) * (-495.064) (-493.445) [-495.471] (-494.619) -- 0:00:38
394500 -- (-494.394) [-494.928] (-496.802) (-499.203) * [-493.349] (-496.979) (-495.365) (-495.847) -- 0:00:38
395000 -- (-495.479) [-495.938] (-495.051) (-495.964) * [-495.913] (-494.063) (-494.079) (-499.929) -- 0:00:38
Average standard deviation of split frequencies: 0.011904
395500 -- [-496.242] (-495.992) (-495.571) (-494.273) * (-496.035) (-493.725) [-494.947] (-499.105) -- 0:00:38
396000 -- [-495.176] (-497.547) (-498.803) (-496.479) * (-499.495) (-493.591) (-497.164) [-499.709] -- 0:00:38
396500 -- (-494.729) [-494.990] (-495.428) (-500.646) * (-497.042) [-493.955] (-495.264) (-500.083) -- 0:00:38
397000 -- [-494.150] (-497.593) (-495.427) (-499.224) * (-496.269) (-495.807) [-501.664] (-495.132) -- 0:00:37
397500 -- (-494.094) [-494.830] (-496.642) (-498.787) * [-494.783] (-498.599) (-498.449) (-493.759) -- 0:00:37
398000 -- (-495.481) (-497.905) [-494.845] (-496.257) * [-495.686] (-497.294) (-500.357) (-496.626) -- 0:00:37
398500 -- [-495.046] (-494.092) (-499.618) (-495.799) * [-494.457] (-498.638) (-496.225) (-495.323) -- 0:00:37
399000 -- (-495.163) (-495.325) [-495.095] (-495.777) * (-495.953) [-495.377] (-497.989) (-494.948) -- 0:00:37
399500 -- (-499.411) [-496.197] (-496.077) (-494.176) * (-494.089) [-497.015] (-495.469) (-496.349) -- 0:00:39
400000 -- [-496.444] (-501.570) (-495.148) (-495.347) * (-496.894) (-494.104) [-495.179] (-496.346) -- 0:00:39
Average standard deviation of split frequencies: 0.012574
400500 -- [-494.523] (-496.104) (-497.349) (-494.901) * (-498.691) (-497.493) [-494.851] (-498.869) -- 0:00:38
401000 -- (-494.276) (-496.896) [-496.231] (-496.263) * [-498.880] (-495.742) (-495.261) (-495.617) -- 0:00:38
401500 -- (-496.171) (-498.561) [-493.988] (-497.419) * (-497.000) (-495.346) [-494.678] (-495.682) -- 0:00:38
402000 -- (-495.826) [-497.279] (-493.712) (-494.676) * (-496.625) [-495.948] (-494.025) (-496.234) -- 0:00:38
402500 -- (-494.887) (-494.184) (-497.787) [-496.688] * [-494.472] (-496.569) (-495.132) (-497.986) -- 0:00:38
403000 -- [-494.194] (-493.231) (-497.201) (-494.197) * [-497.792] (-494.818) (-497.183) (-494.193) -- 0:00:38
403500 -- (-498.646) (-495.627) (-495.634) [-495.653] * (-499.698) [-493.842] (-495.241) (-495.490) -- 0:00:38
404000 -- (-500.724) [-493.914] (-499.964) (-495.940) * (-495.687) [-495.862] (-494.824) (-495.671) -- 0:00:38
404500 -- [-496.501] (-495.912) (-497.202) (-494.646) * [-493.822] (-494.503) (-495.646) (-497.264) -- 0:00:38
405000 -- [-496.549] (-494.451) (-496.535) (-494.430) * [-494.347] (-495.810) (-495.381) (-494.035) -- 0:00:38
Average standard deviation of split frequencies: 0.011756
405500 -- (-495.392) [-495.385] (-493.155) (-495.211) * (-495.139) [-494.060] (-494.940) (-497.966) -- 0:00:38
406000 -- (-497.013) (-496.530) (-495.304) [-493.931] * [-495.666] (-497.430) (-494.503) (-496.266) -- 0:00:38
406500 -- (-496.747) (-496.298) [-495.866] (-496.740) * (-495.375) (-494.002) [-496.336] (-499.495) -- 0:00:37
407000 -- (-494.413) (-496.691) [-497.151] (-499.757) * [-495.168] (-493.824) (-499.182) (-494.253) -- 0:00:37
407500 -- (-496.255) (-494.954) [-493.903] (-496.875) * (-495.095) (-493.224) (-506.253) [-494.210] -- 0:00:37
408000 -- (-495.440) [-495.816] (-497.314) (-495.090) * (-494.100) [-495.980] (-499.110) (-495.651) -- 0:00:37
408500 -- (-495.272) (-496.388) (-496.255) [-493.867] * (-505.654) (-496.962) (-495.359) [-493.999] -- 0:00:37
409000 -- (-499.898) [-496.927] (-494.448) (-494.322) * (-497.026) (-495.589) [-495.202] (-501.818) -- 0:00:37
409500 -- [-494.244] (-495.163) (-494.449) (-494.844) * (-494.054) (-498.290) (-494.228) [-498.555] -- 0:00:37
410000 -- [-497.477] (-496.732) (-495.989) (-494.706) * [-496.491] (-496.195) (-497.529) (-497.264) -- 0:00:37
Average standard deviation of split frequencies: 0.011049
410500 -- (-497.453) (-496.905) (-493.408) [-494.590] * (-496.480) (-493.988) [-494.841] (-496.640) -- 0:00:37
411000 -- [-493.698] (-497.190) (-498.522) (-498.160) * (-499.653) [-493.352] (-497.372) (-498.708) -- 0:00:37
411500 -- (-495.624) (-497.237) (-498.684) [-494.696] * [-495.445] (-493.756) (-497.046) (-494.481) -- 0:00:37
412000 -- (-495.539) (-493.693) [-497.208] (-493.805) * [-495.010] (-494.060) (-499.629) (-494.240) -- 0:00:37
412500 -- [-495.036] (-495.564) (-505.006) (-493.847) * (-496.871) [-495.374] (-495.564) (-494.351) -- 0:00:37
413000 -- (-497.940) [-494.315] (-497.266) (-493.841) * (-498.747) (-499.260) (-493.826) [-493.623] -- 0:00:36
413500 -- (-494.191) (-495.160) (-493.698) [-494.659] * (-495.348) (-494.572) [-493.861] (-493.816) -- 0:00:36
414000 -- (-497.141) (-497.130) (-496.827) [-494.077] * (-496.046) [-496.306] (-496.611) (-494.110) -- 0:00:36
414500 -- (-496.579) (-500.753) [-494.659] (-494.524) * (-494.980) [-494.211] (-498.921) (-494.015) -- 0:00:36
415000 -- (-495.050) [-494.587] (-493.344) (-494.535) * (-497.101) (-493.319) [-495.168] (-495.277) -- 0:00:36
Average standard deviation of split frequencies: 0.010694
415500 -- (-494.777) [-493.841] (-493.800) (-497.705) * [-495.560] (-498.829) (-494.188) (-494.622) -- 0:00:36
416000 -- (-494.097) [-493.324] (-494.175) (-494.524) * (-494.057) [-493.571] (-493.911) (-493.558) -- 0:00:37
416500 -- [-495.336] (-497.623) (-495.038) (-493.724) * [-493.365] (-493.773) (-495.038) (-494.018) -- 0:00:37
417000 -- [-494.074] (-495.890) (-495.331) (-493.417) * [-494.698] (-495.572) (-496.928) (-497.438) -- 0:00:37
417500 -- [-495.075] (-494.838) (-496.524) (-494.843) * (-498.059) (-493.529) (-496.455) [-495.053] -- 0:00:37
418000 -- (-496.019) [-494.619] (-498.725) (-497.573) * [-494.926] (-493.688) (-495.288) (-498.503) -- 0:00:37
418500 -- (-495.433) [-493.807] (-497.973) (-495.230) * (-493.604) [-494.555] (-496.435) (-494.735) -- 0:00:37
419000 -- (-498.880) (-493.724) [-496.188] (-497.909) * (-496.076) (-496.527) (-497.774) [-497.987] -- 0:00:37
419500 -- [-498.992] (-496.820) (-497.642) (-496.088) * (-494.870) (-495.886) [-495.168] (-494.049) -- 0:00:37
420000 -- (-495.203) (-495.216) [-494.282] (-494.641) * (-497.138) (-495.096) (-497.613) [-494.875] -- 0:00:37
Average standard deviation of split frequencies: 0.010436
420500 -- (-496.244) (-495.229) [-498.624] (-493.886) * (-494.771) (-497.161) (-494.703) [-497.864] -- 0:00:37
421000 -- [-493.821] (-497.067) (-494.735) (-493.740) * (-497.859) (-496.612) [-494.317] (-498.305) -- 0:00:37
421500 -- (-494.574) [-494.676] (-497.585) (-496.523) * (-495.667) (-495.237) (-493.308) [-495.344] -- 0:00:37
422000 -- (-494.070) [-496.922] (-494.689) (-494.485) * (-494.926) (-494.134) [-493.546] (-495.787) -- 0:00:36
422500 -- (-497.318) [-496.652] (-495.064) (-499.280) * (-495.143) (-497.438) [-495.409] (-494.867) -- 0:00:36
423000 -- (-496.668) (-501.302) (-501.826) [-495.674] * (-495.243) (-494.163) [-496.453] (-494.786) -- 0:00:36
423500 -- (-496.180) (-498.297) (-494.108) [-495.340] * (-496.673) [-493.796] (-495.514) (-496.085) -- 0:00:36
424000 -- (-502.143) (-497.640) (-495.418) [-496.344] * (-495.175) [-495.692] (-495.230) (-494.405) -- 0:00:36
424500 -- (-494.327) (-495.679) [-495.577] (-495.806) * (-496.082) [-496.730] (-497.350) (-494.576) -- 0:00:36
425000 -- [-494.660] (-497.650) (-494.930) (-495.741) * (-495.853) [-495.107] (-501.034) (-494.161) -- 0:00:36
Average standard deviation of split frequencies: 0.010513
425500 -- (-494.792) [-495.665] (-494.946) (-493.784) * (-493.570) [-495.096] (-493.660) (-494.275) -- 0:00:36
426000 -- (-497.207) [-495.249] (-497.664) (-497.320) * [-493.428] (-494.008) (-495.757) (-496.429) -- 0:00:36
426500 -- (-496.396) (-495.679) (-494.011) [-494.843] * [-494.917] (-497.434) (-496.017) (-494.549) -- 0:00:36
427000 -- [-495.484] (-496.652) (-493.419) (-496.664) * [-495.342] (-496.826) (-495.579) (-495.337) -- 0:00:36
427500 -- (-496.454) (-496.488) [-498.300] (-495.998) * (-494.286) [-497.685] (-495.733) (-494.864) -- 0:00:36
428000 -- [-493.960] (-493.848) (-493.530) (-494.277) * [-496.651] (-497.916) (-495.171) (-494.267) -- 0:00:36
428500 -- (-494.299) (-494.143) (-496.084) [-496.315] * (-494.620) (-496.200) [-495.584] (-498.421) -- 0:00:36
429000 -- (-495.519) [-494.319] (-495.972) (-495.694) * (-495.236) (-494.931) [-493.408] (-499.707) -- 0:00:35
429500 -- (-494.071) (-495.294) [-493.563] (-498.458) * [-495.707] (-497.633) (-493.281) (-496.264) -- 0:00:35
430000 -- (-494.854) (-500.242) (-493.609) [-495.582] * (-495.112) [-496.149] (-498.650) (-497.512) -- 0:00:35
Average standard deviation of split frequencies: 0.010262
430500 -- (-498.267) (-496.634) (-495.418) [-493.944] * (-496.088) (-500.063) (-496.383) [-494.757] -- 0:00:35
431000 -- (-499.490) (-493.709) [-493.896] (-496.250) * [-495.565] (-496.170) (-500.899) (-495.425) -- 0:00:35
431500 -- (-503.208) (-493.943) (-500.315) [-493.678] * (-494.390) (-494.573) (-496.696) [-493.392] -- 0:00:35
432000 -- (-494.095) (-493.951) (-496.261) [-494.454] * (-494.277) (-495.235) (-498.153) [-494.121] -- 0:00:35
432500 -- (-495.217) [-494.946] (-494.164) (-494.543) * (-500.462) (-495.983) (-499.483) [-495.601] -- 0:00:35
433000 -- (-496.280) [-497.094] (-496.170) (-496.084) * (-496.332) [-493.975] (-494.928) (-495.104) -- 0:00:35
433500 -- (-494.484) (-494.640) [-495.861] (-495.299) * (-495.610) [-493.967] (-498.125) (-497.766) -- 0:00:36
434000 -- (-495.195) [-493.916] (-496.495) (-494.856) * (-496.494) (-494.140) (-496.565) [-495.834] -- 0:00:36
434500 -- [-494.210] (-494.279) (-494.954) (-496.139) * (-494.369) [-494.445] (-495.393) (-493.955) -- 0:00:36
435000 -- (-495.432) (-495.455) [-497.577] (-497.225) * (-494.935) [-494.955] (-496.206) (-495.355) -- 0:00:36
Average standard deviation of split frequencies: 0.009731
435500 -- (-497.700) [-493.991] (-496.931) (-494.235) * (-494.058) (-495.263) (-494.043) [-495.380] -- 0:00:36
436000 -- (-493.582) (-497.722) (-494.659) [-495.794] * (-494.036) (-498.903) (-493.391) [-495.326] -- 0:00:36
436500 -- (-496.264) (-497.597) (-494.655) [-497.984] * [-494.909] (-495.015) (-493.212) (-499.470) -- 0:00:36
437000 -- (-497.439) [-500.776] (-495.402) (-496.441) * [-495.152] (-493.982) (-496.076) (-501.221) -- 0:00:36
437500 -- [-495.538] (-494.660) (-496.407) (-493.314) * [-493.690] (-499.072) (-494.263) (-497.571) -- 0:00:36
438000 -- (-494.716) (-496.776) [-495.220] (-494.759) * (-495.946) [-494.161] (-498.618) (-497.687) -- 0:00:35
438500 -- [-494.904] (-494.476) (-494.800) (-497.260) * (-496.195) [-497.186] (-494.898) (-494.715) -- 0:00:35
439000 -- [-493.342] (-495.094) (-494.357) (-494.826) * (-495.803) (-494.474) [-496.117] (-495.406) -- 0:00:35
439500 -- (-494.424) [-494.837] (-495.422) (-494.809) * (-495.919) (-495.440) [-494.985] (-493.861) -- 0:00:35
440000 -- [-498.370] (-495.959) (-494.568) (-496.460) * (-494.691) [-499.317] (-501.806) (-495.238) -- 0:00:35
Average standard deviation of split frequencies: 0.010198
440500 -- (-494.498) (-497.058) (-495.754) [-495.710] * (-497.394) [-498.171] (-496.323) (-495.842) -- 0:00:35
441000 -- [-495.551] (-495.548) (-500.669) (-494.014) * [-495.461] (-494.947) (-497.596) (-494.258) -- 0:00:35
441500 -- [-494.660] (-498.038) (-495.471) (-496.918) * (-497.336) (-494.273) [-495.640] (-499.598) -- 0:00:35
442000 -- (-494.704) (-494.707) (-495.443) [-495.738] * (-497.395) [-495.430] (-493.951) (-498.176) -- 0:00:35
442500 -- (-497.223) [-499.305] (-497.811) (-494.503) * (-495.996) (-497.170) [-497.184] (-494.771) -- 0:00:35
443000 -- (-494.365) [-497.376] (-498.102) (-494.223) * [-496.234] (-494.949) (-494.636) (-494.544) -- 0:00:35
443500 -- [-494.713] (-496.959) (-498.959) (-495.427) * (-497.176) [-495.886] (-493.971) (-495.107) -- 0:00:35
444000 -- (-496.458) (-495.217) [-494.861] (-497.321) * (-496.454) [-495.165] (-496.390) (-494.443) -- 0:00:35
444500 -- (-495.923) (-496.062) (-496.441) [-494.098] * (-495.070) (-495.569) (-494.350) [-493.359] -- 0:00:34
445000 -- (-497.072) (-493.993) [-496.994] (-497.685) * (-497.495) (-494.687) (-494.630) [-495.307] -- 0:00:34
Average standard deviation of split frequencies: 0.009654
445500 -- (-501.753) [-493.997] (-494.799) (-500.075) * (-495.977) (-497.190) [-496.322] (-494.931) -- 0:00:34
446000 -- (-496.543) (-494.965) [-495.038] (-499.363) * (-493.950) [-495.791] (-496.288) (-496.999) -- 0:00:34
446500 -- (-494.904) (-495.592) (-495.948) [-494.469] * (-497.130) (-497.758) [-495.672] (-496.803) -- 0:00:34
447000 -- (-494.649) (-497.984) (-495.733) [-496.468] * (-499.024) [-500.394] (-496.063) (-496.385) -- 0:00:34
447500 -- (-496.157) (-496.617) (-494.789) [-495.937] * [-494.812] (-496.262) (-497.471) (-498.215) -- 0:00:34
448000 -- [-493.821] (-493.736) (-496.346) (-497.248) * [-493.793] (-494.438) (-497.662) (-502.676) -- 0:00:34
448500 -- (-493.512) [-493.946] (-494.288) (-493.990) * (-494.289) (-497.405) [-496.775] (-497.347) -- 0:00:34
449000 -- (-493.482) (-495.158) [-495.869] (-497.732) * (-501.424) (-494.441) [-493.978] (-496.578) -- 0:00:34
449500 -- (-493.388) (-494.550) (-495.567) [-494.283] * [-496.204] (-495.489) (-494.716) (-497.480) -- 0:00:34
450000 -- (-493.988) [-494.614] (-499.873) (-498.871) * [-498.049] (-499.253) (-496.277) (-495.808) -- 0:00:34
Average standard deviation of split frequencies: 0.009623
450500 -- [-494.523] (-497.291) (-494.288) (-496.402) * (-496.603) (-496.439) [-493.626] (-496.417) -- 0:00:35
451000 -- (-495.755) [-496.556] (-493.384) (-495.788) * [-496.062] (-497.079) (-493.751) (-494.742) -- 0:00:35
451500 -- [-495.407] (-494.249) (-495.653) (-495.218) * [-497.281] (-494.196) (-498.795) (-496.162) -- 0:00:35
452000 -- (-495.426) (-497.515) (-497.833) [-495.439] * (-498.918) [-493.243] (-495.250) (-498.003) -- 0:00:35
452500 -- (-495.498) [-494.924] (-494.770) (-497.124) * (-497.197) (-498.564) (-497.987) [-493.713] -- 0:00:35
453000 -- (-498.987) (-494.825) (-493.595) [-498.543] * [-494.849] (-498.401) (-494.493) (-493.942) -- 0:00:35
453500 -- (-495.013) [-496.252] (-493.417) (-496.440) * (-495.916) [-494.693] (-494.872) (-496.109) -- 0:00:34
454000 -- (-496.284) (-493.471) (-493.444) [-495.221] * (-495.559) (-494.828) [-495.359] (-497.062) -- 0:00:34
454500 -- (-504.450) [-497.846] (-495.745) (-495.638) * (-495.010) (-494.894) (-499.615) [-495.842] -- 0:00:34
455000 -- (-498.035) [-494.372] (-494.558) (-495.508) * (-494.416) [-493.975] (-496.686) (-495.786) -- 0:00:34
Average standard deviation of split frequencies: 0.008546
455500 -- (-497.048) (-494.885) [-496.378] (-497.224) * [-493.706] (-495.279) (-496.072) (-495.995) -- 0:00:34
456000 -- (-495.797) [-493.457] (-496.830) (-493.867) * (-494.280) (-495.135) [-496.535] (-494.419) -- 0:00:34
456500 -- (-496.227) (-497.362) [-494.630] (-495.436) * (-494.841) [-495.461] (-496.433) (-497.583) -- 0:00:34
457000 -- (-494.031) [-497.061] (-494.137) (-494.223) * (-497.546) (-493.340) [-495.301] (-497.612) -- 0:00:34
457500 -- (-494.394) (-493.948) (-495.833) [-493.713] * (-497.788) [-494.327] (-496.976) (-494.797) -- 0:00:34
458000 -- (-495.183) [-493.869] (-497.038) (-495.282) * (-496.088) (-495.653) (-494.329) [-494.381] -- 0:00:34
458500 -- (-495.805) (-495.244) (-494.518) [-493.879] * (-494.091) [-495.829] (-494.248) (-494.918) -- 0:00:34
459000 -- (-494.660) (-494.457) [-496.693] (-497.583) * (-497.569) [-495.797] (-496.531) (-498.411) -- 0:00:34
459500 -- (-495.666) (-495.072) [-495.920] (-493.728) * [-496.561] (-496.547) (-495.636) (-495.711) -- 0:00:34
460000 -- (-505.180) [-500.791] (-497.310) (-495.540) * (-499.285) (-494.144) (-503.094) [-493.342] -- 0:00:34
Average standard deviation of split frequencies: 0.010169
460500 -- [-494.322] (-501.891) (-495.755) (-494.335) * (-495.111) (-494.629) (-496.465) [-493.904] -- 0:00:33
461000 -- (-494.714) [-495.649] (-493.779) (-500.642) * [-496.821] (-494.700) (-498.236) (-497.858) -- 0:00:33
461500 -- (-495.866) (-496.711) [-494.668] (-496.817) * (-496.255) (-494.042) [-494.284] (-495.479) -- 0:00:33
462000 -- (-496.093) (-498.326) (-493.707) [-493.743] * [-496.915] (-495.043) (-496.431) (-496.020) -- 0:00:33
462500 -- (-495.058) [-493.979] (-494.242) (-495.178) * (-494.069) [-494.543] (-497.569) (-494.307) -- 0:00:33
463000 -- (-495.543) (-494.804) [-493.392] (-494.968) * [-495.347] (-497.300) (-496.382) (-497.565) -- 0:00:33
463500 -- (-495.948) (-495.277) [-495.286] (-495.531) * (-502.037) (-496.703) (-495.306) [-495.612] -- 0:00:33
464000 -- (-493.501) [-495.986] (-496.416) (-495.437) * (-494.316) (-496.298) [-495.103] (-500.278) -- 0:00:33
464500 -- (-493.868) (-502.506) (-494.876) [-494.996] * (-494.625) (-495.642) (-498.276) [-498.543] -- 0:00:33
465000 -- [-493.668] (-499.685) (-495.486) (-500.558) * (-500.517) [-495.431] (-495.340) (-496.052) -- 0:00:33
Average standard deviation of split frequencies: 0.011380
465500 -- (-493.403) (-493.811) [-496.134] (-498.246) * (-496.406) (-495.048) (-493.152) [-494.161] -- 0:00:33
466000 -- (-497.008) (-493.739) [-495.683] (-494.736) * (-499.097) (-496.347) [-493.476] (-497.056) -- 0:00:33
466500 -- [-493.776] (-493.554) (-496.404) (-495.386) * (-499.151) [-494.407] (-494.226) (-495.119) -- 0:00:33
467000 -- (-494.213) (-495.189) [-495.021] (-494.541) * (-494.585) (-493.781) [-494.042] (-493.815) -- 0:00:34
467500 -- (-495.657) (-497.299) [-496.905] (-499.395) * (-495.389) [-496.546] (-493.772) (-495.155) -- 0:00:34
468000 -- (-498.251) (-494.181) [-494.015] (-499.510) * [-494.617] (-496.668) (-493.961) (-495.385) -- 0:00:34
468500 -- (-497.809) (-494.174) [-496.262] (-497.083) * [-493.171] (-494.375) (-495.972) (-497.604) -- 0:00:34
469000 -- (-502.259) (-495.253) (-494.452) [-495.620] * (-496.591) (-495.786) [-497.960] (-498.841) -- 0:00:33
469500 -- (-495.502) (-493.931) [-498.448] (-496.268) * (-496.360) (-495.003) [-497.191] (-494.338) -- 0:00:33
470000 -- (-494.005) [-493.467] (-493.313) (-497.624) * (-497.554) [-495.454] (-495.730) (-495.057) -- 0:00:33
Average standard deviation of split frequencies: 0.010955
470500 -- (-497.673) (-494.101) [-493.901] (-496.733) * (-497.162) [-495.172] (-496.121) (-495.970) -- 0:00:33
471000 -- (-494.083) (-494.518) (-494.257) [-496.747] * (-493.668) [-496.692] (-495.695) (-496.990) -- 0:00:33
471500 -- (-501.899) (-496.904) [-495.521] (-496.204) * (-494.785) (-495.896) (-501.455) [-497.035] -- 0:00:33
472000 -- (-498.629) (-500.729) (-494.683) [-494.521] * (-494.116) (-496.568) (-496.071) [-494.140] -- 0:00:33
472500 -- (-497.726) (-496.227) (-493.820) [-494.376] * [-496.654] (-495.538) (-495.570) (-496.255) -- 0:00:33
473000 -- (-496.013) [-495.790] (-493.869) (-495.022) * (-495.274) (-494.705) (-496.181) [-494.587] -- 0:00:33
473500 -- [-494.754] (-496.470) (-494.265) (-495.264) * (-494.232) (-495.947) [-496.139] (-497.503) -- 0:00:33
474000 -- [-496.889] (-497.702) (-494.311) (-494.561) * (-495.127) (-497.678) (-497.927) [-494.879] -- 0:00:33
474500 -- [-494.813] (-497.188) (-496.182) (-493.550) * (-494.801) (-495.740) [-498.412] (-495.895) -- 0:00:33
475000 -- (-500.592) (-493.383) [-493.934] (-496.113) * [-494.577] (-504.080) (-494.381) (-497.134) -- 0:00:33
Average standard deviation of split frequencies: 0.011637
475500 -- (-496.427) [-497.621] (-494.192) (-495.711) * (-495.107) (-496.466) (-495.579) [-494.499] -- 0:00:33
476000 -- (-496.799) (-498.078) [-494.204] (-494.192) * (-494.820) [-494.800] (-494.167) (-494.086) -- 0:00:33
476500 -- [-497.284] (-498.425) (-496.045) (-494.824) * (-496.028) (-494.816) [-496.576] (-494.349) -- 0:00:32
477000 -- (-495.382) [-494.831] (-496.029) (-495.554) * (-497.317) [-495.034] (-493.732) (-495.269) -- 0:00:32
477500 -- (-495.618) [-494.317] (-493.704) (-497.027) * (-500.934) (-496.355) [-493.299] (-496.174) -- 0:00:32
478000 -- (-495.766) (-495.815) [-494.882] (-495.729) * (-495.020) [-499.754] (-494.186) (-498.954) -- 0:00:32
478500 -- (-494.635) (-493.848) [-499.165] (-495.979) * [-495.110] (-498.420) (-494.529) (-495.827) -- 0:00:32
479000 -- (-495.970) [-493.513] (-496.295) (-497.339) * (-493.839) [-494.551] (-495.652) (-494.442) -- 0:00:32
479500 -- (-495.078) [-495.182] (-493.257) (-494.650) * (-498.070) (-496.649) [-495.511] (-494.106) -- 0:00:32
480000 -- [-499.090] (-494.851) (-497.474) (-497.179) * (-503.207) (-495.473) [-494.649] (-503.573) -- 0:00:32
Average standard deviation of split frequencies: 0.011095
480500 -- (-499.410) (-494.287) (-494.881) [-496.624] * [-498.126] (-499.529) (-499.768) (-505.925) -- 0:00:32
481000 -- (-495.443) [-493.551] (-495.990) (-500.353) * (-501.766) (-498.662) [-499.680] (-496.390) -- 0:00:32
481500 -- [-495.051] (-495.943) (-498.061) (-495.400) * (-498.096) (-495.942) [-497.365] (-494.638) -- 0:00:32
482000 -- [-499.087] (-495.595) (-499.279) (-498.239) * (-499.715) [-494.643] (-494.267) (-495.457) -- 0:00:32
482500 -- (-497.041) (-494.532) (-496.562) [-497.889] * (-499.640) (-494.272) (-494.868) [-494.433] -- 0:00:32
483000 -- (-499.738) (-494.505) (-493.936) [-496.350] * [-498.844] (-493.970) (-497.425) (-493.515) -- 0:00:33
483500 -- (-497.826) [-493.476] (-494.953) (-498.497) * [-493.781] (-494.686) (-494.362) (-494.216) -- 0:00:33
484000 -- (-495.897) (-495.071) (-493.986) [-496.163] * [-495.259] (-494.100) (-494.851) (-495.451) -- 0:00:33
484500 -- (-494.755) (-496.503) (-493.768) [-498.096] * (-496.075) [-494.604] (-494.506) (-497.807) -- 0:00:32
485000 -- (-493.778) (-495.882) [-498.562] (-496.271) * (-500.199) [-494.738] (-493.752) (-496.230) -- 0:00:32
Average standard deviation of split frequencies: 0.011276
485500 -- [-495.052] (-494.973) (-502.118) (-499.309) * (-498.756) [-497.273] (-494.522) (-497.180) -- 0:00:32
486000 -- (-494.378) [-494.998] (-494.631) (-496.103) * (-498.666) [-495.014] (-498.038) (-495.774) -- 0:00:32
486500 -- (-496.276) [-494.027] (-496.877) (-496.095) * (-495.668) [-493.739] (-493.911) (-494.617) -- 0:00:32
487000 -- (-495.319) [-494.136] (-495.025) (-501.371) * (-493.891) [-493.959] (-495.729) (-494.620) -- 0:00:32
487500 -- (-494.108) (-497.346) [-498.031] (-497.722) * (-495.374) [-495.318] (-496.450) (-495.044) -- 0:00:32
488000 -- [-496.458] (-495.881) (-496.688) (-496.608) * (-493.514) (-497.867) [-494.244] (-496.350) -- 0:00:32
488500 -- (-496.361) [-493.948] (-495.240) (-494.448) * (-498.893) (-496.744) (-496.683) [-493.899] -- 0:00:32
489000 -- (-495.350) [-495.303] (-495.155) (-497.424) * [-494.650] (-498.688) (-498.429) (-495.744) -- 0:00:32
489500 -- [-496.695] (-497.084) (-496.997) (-495.038) * [-498.433] (-495.677) (-496.028) (-494.400) -- 0:00:32
490000 -- (-494.145) (-495.304) (-503.687) [-494.405] * (-496.148) (-495.640) [-494.001] (-495.433) -- 0:00:32
Average standard deviation of split frequencies: 0.011889
490500 -- (-493.402) [-496.008] (-499.840) (-493.307) * (-495.142) (-494.411) (-496.419) [-494.392] -- 0:00:32
491000 -- (-496.268) [-495.059] (-503.332) (-493.949) * (-495.096) (-501.357) (-494.145) [-494.437] -- 0:00:32
491500 -- [-494.206] (-496.452) (-495.072) (-494.937) * [-495.211] (-494.034) (-493.943) (-493.764) -- 0:00:32
492000 -- (-494.873) (-495.184) (-499.164) [-496.283] * (-496.161) (-502.448) [-493.686] (-495.535) -- 0:00:32
492500 -- [-495.517] (-498.042) (-494.030) (-498.518) * (-495.032) (-495.824) (-497.892) [-496.220] -- 0:00:31
493000 -- [-495.546] (-495.924) (-494.306) (-501.372) * (-494.398) (-494.160) [-493.672] (-495.036) -- 0:00:31
493500 -- (-494.592) (-495.819) [-497.099] (-495.264) * (-495.897) [-494.528] (-494.289) (-500.534) -- 0:00:31
494000 -- [-496.765] (-495.590) (-497.309) (-495.191) * [-496.455] (-497.354) (-494.215) (-495.310) -- 0:00:31
494500 -- (-494.568) (-496.794) [-494.887] (-495.663) * (-494.888) [-497.169] (-494.075) (-495.433) -- 0:00:31
495000 -- (-493.463) [-493.853] (-496.185) (-497.091) * (-494.852) (-494.169) [-493.736] (-496.248) -- 0:00:31
Average standard deviation of split frequencies: 0.011880
495500 -- (-494.082) [-494.228] (-498.370) (-498.270) * (-495.625) [-493.565] (-495.539) (-496.349) -- 0:00:31
496000 -- (-496.319) (-496.922) (-497.653) [-496.495] * (-497.224) [-493.207] (-495.988) (-495.050) -- 0:00:31
496500 -- (-500.802) [-494.042] (-495.832) (-497.987) * (-496.577) (-494.342) (-493.757) [-495.892] -- 0:00:31
497000 -- (-494.559) [-493.745] (-496.248) (-499.055) * (-495.094) (-498.676) (-499.367) [-495.978] -- 0:00:31
497500 -- (-494.727) [-493.850] (-497.226) (-498.557) * (-494.185) (-500.601) [-493.779] (-494.584) -- 0:00:31
498000 -- (-494.203) (-493.682) [-493.534] (-495.626) * (-500.098) (-496.146) (-499.233) [-495.583] -- 0:00:31
498500 -- (-496.224) (-494.390) (-496.732) [-497.815] * [-497.288] (-495.924) (-495.697) (-495.182) -- 0:00:31
499000 -- (-495.941) [-494.966] (-497.569) (-496.981) * (-496.516) (-494.512) [-494.528] (-495.082) -- 0:00:31
499500 -- [-496.911] (-497.353) (-494.954) (-495.750) * [-495.375] (-494.761) (-494.380) (-494.451) -- 0:00:31
500000 -- (-496.007) (-496.854) [-494.638] (-503.336) * (-493.855) (-494.779) [-494.006] (-493.915) -- 0:00:32
Average standard deviation of split frequencies: 0.012593
500500 -- (-493.803) [-494.611] (-495.350) (-510.318) * (-498.270) [-493.942] (-496.156) (-496.558) -- 0:00:31
501000 -- (-494.460) (-498.168) [-493.896] (-507.033) * (-494.109) (-493.710) [-496.201] (-495.501) -- 0:00:31
501500 -- (-498.163) (-500.426) [-495.940] (-498.288) * (-495.048) [-493.641] (-495.464) (-494.763) -- 0:00:31
502000 -- [-493.567] (-495.736) (-494.180) (-498.374) * [-494.613] (-494.646) (-493.868) (-496.858) -- 0:00:31
502500 -- (-497.766) (-496.450) (-494.286) [-497.123] * (-496.067) (-496.239) [-495.101] (-494.794) -- 0:00:31
503000 -- [-495.425] (-495.510) (-496.024) (-496.924) * (-495.766) (-494.674) [-495.346] (-495.768) -- 0:00:31
503500 -- (-496.096) (-494.047) [-495.132] (-493.196) * (-493.882) (-494.618) (-493.617) [-496.958] -- 0:00:31
504000 -- [-498.666] (-493.704) (-495.642) (-494.769) * (-497.857) (-494.524) [-493.696] (-496.610) -- 0:00:31
504500 -- (-497.937) (-494.229) (-494.320) [-495.004] * (-494.107) [-495.749] (-496.778) (-496.609) -- 0:00:31
505000 -- (-494.383) (-493.773) (-496.590) [-496.283] * (-497.966) [-495.878] (-494.400) (-495.290) -- 0:00:31
Average standard deviation of split frequencies: 0.012330
505500 -- [-498.150] (-496.283) (-499.515) (-494.144) * (-501.474) (-496.042) [-495.310] (-495.422) -- 0:00:31
506000 -- (-501.464) [-494.224] (-495.769) (-494.723) * (-495.617) (-497.634) [-499.908] (-494.385) -- 0:00:31
506500 -- (-495.391) [-493.994] (-493.834) (-501.233) * [-494.486] (-498.033) (-494.978) (-496.296) -- 0:00:31
507000 -- (-500.037) [-498.676] (-495.525) (-499.394) * [-495.134] (-495.943) (-496.565) (-495.151) -- 0:00:31
507500 -- (-495.835) (-495.927) (-493.828) [-494.612] * (-497.279) [-494.124] (-496.592) (-498.011) -- 0:00:31
508000 -- [-495.122] (-494.445) (-493.145) (-495.489) * (-494.361) (-495.309) [-494.076] (-496.120) -- 0:00:30
508500 -- (-495.151) (-494.881) (-493.793) [-496.392] * (-493.894) [-497.783] (-495.774) (-500.070) -- 0:00:30
509000 -- (-495.751) (-496.570) [-494.768] (-503.766) * (-494.101) (-495.729) [-497.482] (-495.944) -- 0:00:30
509500 -- (-496.650) (-496.157) (-495.675) [-498.524] * (-496.799) [-498.900] (-496.868) (-494.391) -- 0:00:30
510000 -- (-494.246) (-496.706) [-495.059] (-494.630) * (-495.890) (-497.093) [-493.850] (-496.964) -- 0:00:30
Average standard deviation of split frequencies: 0.012635
510500 -- (-495.731) (-495.414) (-496.410) [-494.848] * (-498.752) (-496.133) (-496.843) [-495.165] -- 0:00:30
511000 -- (-497.094) (-501.514) (-498.523) [-494.388] * (-494.621) (-496.501) [-494.385] (-497.669) -- 0:00:30
511500 -- (-496.940) (-499.719) [-495.162] (-497.694) * (-493.895) (-495.303) (-494.283) [-493.560] -- 0:00:30
512000 -- (-495.474) (-496.801) (-501.321) [-495.115] * (-496.258) (-493.838) [-494.800] (-498.848) -- 0:00:30
512500 -- [-495.677] (-500.700) (-495.632) (-494.692) * (-494.838) (-494.173) (-498.671) [-500.906] -- 0:00:30
513000 -- (-493.884) (-501.214) (-496.772) [-494.255] * (-496.733) (-496.646) [-500.469] (-494.476) -- 0:00:30
513500 -- (-497.974) (-500.529) [-494.278] (-493.495) * (-493.901) [-499.706] (-495.498) (-494.100) -- 0:00:30
514000 -- (-494.480) (-494.646) [-494.500] (-494.725) * (-495.207) [-496.311] (-498.712) (-494.197) -- 0:00:30
514500 -- [-496.856] (-494.799) (-500.574) (-494.931) * (-494.602) (-497.062) [-493.639] (-496.565) -- 0:00:30
515000 -- (-495.753) (-494.248) [-496.176] (-497.796) * (-493.245) [-494.919] (-494.475) (-495.202) -- 0:00:30
Average standard deviation of split frequencies: 0.012676
515500 -- (-495.033) (-494.752) [-493.537] (-493.255) * [-494.923] (-496.477) (-493.947) (-494.649) -- 0:00:30
516000 -- (-494.042) (-495.467) [-494.664] (-493.283) * [-495.070] (-497.089) (-494.437) (-497.982) -- 0:00:30
516500 -- [-498.036] (-495.965) (-496.560) (-494.301) * (-495.294) (-498.256) [-495.188] (-493.782) -- 0:00:29
517000 -- (-497.590) (-499.284) (-494.894) [-494.140] * [-496.245] (-495.867) (-495.213) (-496.024) -- 0:00:30
517500 -- (-498.309) [-493.486] (-495.515) (-495.027) * [-495.287] (-494.374) (-494.753) (-500.834) -- 0:00:30
518000 -- (-501.666) (-494.018) (-496.611) [-494.224] * [-493.727] (-497.541) (-496.177) (-496.872) -- 0:00:30
518500 -- (-498.200) (-495.380) (-495.392) [-494.267] * (-496.352) [-498.401] (-495.399) (-497.089) -- 0:00:30
519000 -- (-500.852) [-494.600] (-495.490) (-495.681) * (-499.104) (-494.472) (-497.200) [-494.622] -- 0:00:30
519500 -- [-494.244] (-495.487) (-496.292) (-496.242) * (-497.935) [-494.229] (-494.230) (-495.807) -- 0:00:30
520000 -- (-494.830) [-495.895] (-496.049) (-495.265) * (-495.605) (-496.365) [-498.129] (-494.242) -- 0:00:30
Average standard deviation of split frequencies: 0.012392
520500 -- [-496.428] (-495.682) (-499.108) (-494.073) * (-495.590) [-495.488] (-493.638) (-497.282) -- 0:00:30
521000 -- [-496.210] (-497.199) (-496.406) (-497.304) * [-498.471] (-494.985) (-496.427) (-494.789) -- 0:00:30
521500 -- (-496.651) (-503.438) [-495.146] (-495.854) * (-498.147) (-496.048) (-494.987) [-498.713] -- 0:00:30
522000 -- (-496.691) (-496.572) (-495.395) [-496.916] * [-498.908] (-500.948) (-494.637) (-496.855) -- 0:00:30
522500 -- (-495.142) (-499.505) [-497.185] (-494.877) * [-493.503] (-493.892) (-494.993) (-493.579) -- 0:00:30
523000 -- (-495.678) (-500.262) [-494.860] (-493.521) * [-496.579] (-496.642) (-495.967) (-497.989) -- 0:00:30
523500 -- (-495.259) [-494.751] (-495.154) (-495.407) * (-495.336) (-497.952) (-494.316) [-501.810] -- 0:00:30
524000 -- (-494.772) (-495.980) [-494.374] (-499.413) * [-495.683] (-495.702) (-494.490) (-500.049) -- 0:00:29
524500 -- (-495.710) (-498.419) (-495.084) [-496.787] * [-494.876] (-493.923) (-494.518) (-493.543) -- 0:00:29
525000 -- [-495.577] (-496.068) (-496.055) (-494.966) * (-493.937) [-498.215] (-496.219) (-494.681) -- 0:00:29
Average standard deviation of split frequencies: 0.012827
525500 -- (-493.792) (-495.949) [-495.146] (-494.130) * [-494.028] (-498.713) (-497.621) (-496.017) -- 0:00:29
526000 -- (-495.877) (-494.594) [-497.709] (-496.439) * [-495.814] (-494.596) (-494.623) (-494.090) -- 0:00:29
526500 -- [-493.283] (-495.427) (-494.448) (-495.170) * (-495.910) [-495.117] (-496.892) (-496.896) -- 0:00:29
527000 -- [-493.820] (-493.368) (-494.936) (-496.354) * [-495.029] (-495.892) (-496.057) (-496.613) -- 0:00:29
527500 -- [-494.422] (-495.494) (-500.872) (-494.666) * (-496.142) [-495.204] (-493.991) (-495.633) -- 0:00:29
528000 -- (-495.869) (-496.057) (-497.375) [-494.329] * (-497.060) (-497.561) [-496.274] (-493.488) -- 0:00:29
528500 -- (-498.153) [-493.820] (-497.226) (-496.144) * (-495.385) (-493.378) [-496.250] (-495.716) -- 0:00:29
529000 -- (-494.046) [-498.933] (-497.753) (-495.401) * [-495.142] (-494.077) (-498.151) (-494.096) -- 0:00:29
529500 -- (-502.061) (-494.156) (-498.847) [-493.893] * (-495.921) (-493.815) (-493.561) [-493.125] -- 0:00:29
530000 -- (-495.756) (-495.883) [-495.643] (-496.238) * (-496.452) (-496.959) (-497.018) [-493.949] -- 0:00:29
Average standard deviation of split frequencies: 0.012200
530500 -- (-495.843) [-494.148] (-494.217) (-496.661) * (-495.247) (-498.936) [-495.453] (-494.140) -- 0:00:29
531000 -- (-501.807) [-494.145] (-493.558) (-494.807) * (-496.512) (-496.794) (-493.787) [-493.769] -- 0:00:29
531500 -- (-494.717) (-493.895) (-493.916) [-497.007] * (-495.841) (-500.754) [-493.661] (-497.409) -- 0:00:29
532000 -- (-494.248) (-493.650) (-493.949) [-496.511] * (-494.997) (-503.982) [-494.274] (-495.028) -- 0:00:29
532500 -- [-496.080] (-495.454) (-500.089) (-498.475) * (-497.006) [-495.069] (-495.600) (-494.980) -- 0:00:28
533000 -- (-497.600) [-498.314] (-495.649) (-494.250) * (-495.809) (-493.834) [-496.036] (-497.029) -- 0:00:28
533500 -- (-494.556) (-497.897) (-493.955) [-493.723] * (-494.056) [-495.330] (-495.307) (-499.420) -- 0:00:28
534000 -- (-493.746) (-497.853) [-494.287] (-498.313) * (-495.624) [-494.326] (-493.541) (-496.373) -- 0:00:28
534500 -- [-494.439] (-498.943) (-494.131) (-496.372) * (-495.601) [-495.538] (-493.939) (-496.232) -- 0:00:29
535000 -- (-494.480) (-498.102) [-494.140] (-494.955) * [-494.609] (-497.885) (-493.941) (-496.928) -- 0:00:29
Average standard deviation of split frequencies: 0.012643
535500 -- (-494.039) (-494.641) (-500.021) [-496.079] * (-498.597) (-496.712) (-495.032) [-495.774] -- 0:00:29
536000 -- [-497.185] (-497.443) (-497.805) (-497.122) * (-498.134) (-497.222) [-493.406] (-494.930) -- 0:00:29
536500 -- (-494.163) [-494.802] (-496.206) (-496.686) * [-494.894] (-497.194) (-498.230) (-493.337) -- 0:00:29
537000 -- [-495.327] (-495.039) (-497.382) (-496.797) * (-494.007) [-494.962] (-495.019) (-496.183) -- 0:00:29
537500 -- (-493.391) [-494.910] (-497.349) (-496.319) * (-496.092) (-494.817) [-494.282] (-498.119) -- 0:00:29
538000 -- (-495.338) [-497.511] (-496.496) (-497.678) * (-493.675) (-500.420) [-495.234] (-494.872) -- 0:00:29
538500 -- [-498.314] (-495.554) (-497.173) (-499.486) * [-494.109] (-495.962) (-498.295) (-494.208) -- 0:00:29
539000 -- (-495.155) [-496.547] (-496.882) (-496.370) * (-494.047) [-494.916] (-497.079) (-493.697) -- 0:00:29
539500 -- (-494.057) [-495.159] (-497.247) (-496.288) * (-496.623) (-497.360) [-496.672] (-493.734) -- 0:00:29
540000 -- [-495.713] (-494.507) (-503.220) (-499.703) * (-497.096) (-494.760) [-496.376] (-494.208) -- 0:00:28
Average standard deviation of split frequencies: 0.012323
540500 -- (-493.687) (-497.036) (-497.645) [-495.264] * [-494.826] (-498.526) (-496.686) (-494.889) -- 0:00:28
541000 -- (-493.821) (-494.466) (-500.023) [-496.970] * (-496.695) [-496.867] (-496.071) (-495.090) -- 0:00:28
541500 -- (-493.890) (-496.514) [-496.224] (-495.840) * (-496.043) (-494.909) [-497.106] (-494.787) -- 0:00:28
542000 -- (-493.514) (-498.849) (-495.638) [-495.802] * (-496.432) (-496.678) (-497.106) [-494.324] -- 0:00:28
542500 -- [-493.917] (-496.660) (-496.816) (-495.383) * [-495.452] (-495.819) (-495.483) (-495.623) -- 0:00:28
543000 -- (-495.344) (-494.601) (-496.158) [-496.396] * (-495.837) (-496.102) [-494.212] (-496.043) -- 0:00:28
543500 -- (-494.330) (-494.565) (-498.190) [-499.287] * (-495.445) [-494.407] (-496.317) (-500.312) -- 0:00:28
544000 -- (-497.975) (-494.452) (-496.436) [-494.652] * (-494.359) (-494.256) [-496.476] (-496.703) -- 0:00:28
544500 -- (-494.228) (-496.881) [-494.777] (-496.169) * (-495.086) (-495.384) [-494.090] (-495.778) -- 0:00:28
545000 -- [-494.431] (-498.296) (-495.548) (-494.551) * (-496.667) (-496.354) [-494.490] (-496.136) -- 0:00:28
Average standard deviation of split frequencies: 0.012573
545500 -- (-496.104) (-498.394) [-497.177] (-494.401) * (-496.976) [-494.111] (-495.521) (-497.868) -- 0:00:28
546000 -- (-494.690) (-500.622) (-495.922) [-499.367] * (-497.699) [-496.025] (-493.989) (-495.212) -- 0:00:28
546500 -- [-495.675] (-495.950) (-496.143) (-497.036) * (-497.498) (-495.360) [-499.687] (-494.850) -- 0:00:28
547000 -- (-496.381) [-498.845] (-495.458) (-498.638) * (-495.525) (-497.438) (-496.164) [-493.331] -- 0:00:28
547500 -- [-494.905] (-494.171) (-496.460) (-497.582) * [-494.989] (-498.028) (-494.232) (-494.615) -- 0:00:28
548000 -- [-494.732] (-501.774) (-497.180) (-498.431) * (-494.725) (-497.373) (-495.964) [-498.092] -- 0:00:28
548500 -- (-496.474) (-498.647) (-497.448) [-493.923] * (-494.076) (-494.830) [-494.384] (-496.593) -- 0:00:27
549000 -- (-494.789) [-495.522] (-497.158) (-494.718) * (-495.592) (-495.546) (-494.982) [-495.206] -- 0:00:27
549500 -- (-497.386) [-497.691] (-497.966) (-493.515) * (-497.577) [-493.702] (-496.919) (-495.244) -- 0:00:27
550000 -- (-498.469) (-494.856) (-497.204) [-496.499] * (-499.222) [-493.869] (-496.051) (-496.245) -- 0:00:27
Average standard deviation of split frequencies: 0.011871
550500 -- (-495.685) (-496.345) (-494.398) [-494.160] * [-497.105] (-495.294) (-495.442) (-496.706) -- 0:00:27
551000 -- (-496.178) (-495.482) [-494.969] (-497.857) * [-494.286] (-494.012) (-496.655) (-496.722) -- 0:00:27
551500 -- [-495.562] (-495.603) (-496.050) (-494.996) * (-493.857) [-495.155] (-497.085) (-494.336) -- 0:00:28
552000 -- (-498.444) (-496.318) (-499.165) [-496.327] * (-496.878) [-494.999] (-498.059) (-497.049) -- 0:00:28
552500 -- (-495.560) (-495.127) (-497.335) [-496.470] * (-495.365) (-495.923) (-497.466) [-495.737] -- 0:00:28
553000 -- [-493.598] (-495.203) (-495.478) (-496.701) * (-500.128) (-497.159) [-496.384] (-498.221) -- 0:00:28
553500 -- [-494.209] (-496.071) (-495.742) (-494.974) * (-500.674) [-497.165] (-498.809) (-495.079) -- 0:00:28
554000 -- (-497.226) [-494.555] (-494.853) (-494.859) * (-495.690) (-493.930) [-495.746] (-493.579) -- 0:00:28
554500 -- (-495.629) [-497.028] (-493.905) (-498.987) * (-495.553) [-494.594] (-495.291) (-495.575) -- 0:00:28
555000 -- (-496.235) (-499.076) (-494.630) [-497.530] * (-495.903) (-494.111) (-495.549) [-493.993] -- 0:00:28
Average standard deviation of split frequencies: 0.012241
555500 -- (-496.035) (-498.140) [-495.142] (-503.037) * [-497.598] (-497.712) (-497.026) (-493.475) -- 0:00:28
556000 -- (-495.023) [-493.921] (-495.378) (-496.414) * [-494.139] (-493.412) (-495.305) (-499.368) -- 0:00:27
556500 -- (-493.659) [-494.753] (-494.613) (-494.925) * (-493.908) (-494.967) (-497.810) [-494.807] -- 0:00:27
557000 -- (-494.456) (-498.843) (-496.356) [-495.299] * (-495.771) (-495.882) (-494.214) [-497.462] -- 0:00:27
557500 -- (-495.073) (-500.407) [-497.631] (-499.089) * (-498.161) (-496.761) [-493.543] (-496.869) -- 0:00:27
558000 -- (-493.566) (-495.736) (-494.922) [-495.619] * (-494.100) (-498.263) [-497.192] (-494.285) -- 0:00:27
558500 -- (-495.050) (-493.827) [-496.546] (-495.853) * [-494.586] (-495.451) (-497.414) (-499.783) -- 0:00:27
559000 -- (-498.441) (-494.548) (-494.957) [-497.415] * (-494.783) (-495.466) [-493.883] (-494.525) -- 0:00:27
559500 -- [-496.395] (-494.632) (-495.496) (-498.024) * [-495.622] (-495.914) (-496.089) (-494.408) -- 0:00:27
560000 -- [-495.715] (-499.984) (-500.556) (-497.279) * (-495.029) (-494.821) [-495.233] (-494.264) -- 0:00:27
Average standard deviation of split frequencies: 0.011267
560500 -- (-498.170) [-495.303] (-493.680) (-494.648) * (-496.671) [-494.313] (-499.160) (-496.230) -- 0:00:27
561000 -- (-495.453) (-495.117) (-495.517) [-495.395] * [-495.798] (-496.089) (-493.368) (-499.257) -- 0:00:27
561500 -- (-496.748) (-497.613) [-497.659] (-498.974) * [-494.350] (-495.623) (-497.258) (-498.412) -- 0:00:27
562000 -- (-495.525) (-496.574) (-493.533) [-493.787] * (-494.426) (-494.975) (-497.675) [-495.605] -- 0:00:27
562500 -- (-496.901) (-498.383) [-494.303] (-494.971) * (-495.430) [-494.982] (-495.723) (-495.818) -- 0:00:27
563000 -- (-498.257) [-495.463] (-496.997) (-496.632) * (-498.706) [-494.777] (-495.908) (-499.087) -- 0:00:27
563500 -- (-494.317) [-496.949] (-495.955) (-495.412) * [-496.001] (-501.161) (-498.474) (-494.810) -- 0:00:27
564000 -- [-494.388] (-498.095) (-495.127) (-494.401) * (-494.779) (-494.512) [-497.127] (-495.452) -- 0:00:27
564500 -- [-495.717] (-493.405) (-498.560) (-494.408) * (-498.192) [-494.357] (-494.345) (-496.397) -- 0:00:27
565000 -- [-495.313] (-493.396) (-497.614) (-494.639) * (-496.736) (-496.112) [-494.870] (-495.332) -- 0:00:26
Average standard deviation of split frequencies: 0.010661
565500 -- (-494.922) (-495.772) (-494.889) [-495.386] * [-494.075] (-494.052) (-494.674) (-496.491) -- 0:00:26
566000 -- (-496.451) (-496.212) [-499.933] (-493.813) * (-496.906) (-494.585) (-495.545) [-496.743] -- 0:00:26
566500 -- (-496.612) (-494.433) [-493.549] (-496.733) * (-495.714) (-501.225) (-497.916) [-494.877] -- 0:00:26
567000 -- [-494.263] (-495.518) (-494.750) (-495.616) * (-495.156) (-499.244) [-495.263] (-495.696) -- 0:00:26
567500 -- [-495.438] (-494.174) (-496.731) (-495.042) * (-495.333) (-494.209) (-494.182) [-495.222] -- 0:00:26
568000 -- [-496.086] (-497.549) (-495.363) (-495.514) * [-493.978] (-501.865) (-496.985) (-496.377) -- 0:00:26
568500 -- (-499.821) (-497.555) (-499.106) [-495.210] * [-494.605] (-497.832) (-498.323) (-495.964) -- 0:00:27
569000 -- (-495.606) (-497.069) (-495.665) [-497.085] * (-494.391) (-495.758) (-494.275) [-494.688] -- 0:00:27
569500 -- (-494.158) [-495.170] (-495.512) (-496.393) * (-496.380) [-495.719] (-495.419) (-494.268) -- 0:00:27
570000 -- (-494.969) [-495.113] (-495.962) (-494.107) * (-497.561) (-494.086) [-498.069] (-497.814) -- 0:00:27
Average standard deviation of split frequencies: 0.010518
570500 -- (-498.922) [-495.103] (-495.118) (-493.989) * (-495.171) [-493.319] (-502.547) (-497.110) -- 0:00:27
571000 -- (-495.980) (-497.815) [-495.989] (-494.109) * (-495.629) (-493.438) (-497.633) [-497.595] -- 0:00:27
571500 -- [-494.147] (-500.435) (-498.519) (-494.583) * [-493.180] (-495.116) (-496.695) (-494.702) -- 0:00:26
572000 -- (-495.086) (-499.466) (-494.777) [-494.864] * [-493.983] (-495.977) (-498.015) (-495.070) -- 0:00:26
572500 -- (-496.876) (-498.929) [-493.530] (-493.733) * (-496.696) (-493.925) [-493.915] (-495.947) -- 0:00:26
573000 -- (-497.301) (-494.117) (-495.587) [-493.889] * (-496.430) [-494.809] (-496.156) (-494.987) -- 0:00:26
573500 -- (-495.345) [-494.412] (-493.845) (-499.929) * (-496.958) (-495.222) (-494.751) [-494.583] -- 0:00:26
574000 -- (-495.786) (-496.602) [-501.384] (-494.638) * (-495.392) (-499.007) [-493.520] (-495.637) -- 0:00:26
574500 -- (-497.816) (-496.358) (-496.731) [-498.748] * [-495.518] (-497.608) (-498.258) (-497.826) -- 0:00:26
575000 -- (-503.729) [-493.955] (-497.358) (-495.331) * [-496.140] (-496.505) (-495.763) (-496.616) -- 0:00:26
Average standard deviation of split frequencies: 0.009930
575500 -- (-495.988) [-496.504] (-494.944) (-497.721) * (-495.858) (-494.235) (-494.287) [-494.034] -- 0:00:26
576000 -- (-495.693) (-496.532) [-495.512] (-496.103) * (-495.960) (-497.065) (-496.220) [-495.339] -- 0:00:26
576500 -- (-501.888) [-494.625] (-494.469) (-494.935) * [-494.665] (-498.453) (-494.601) (-496.575) -- 0:00:26
577000 -- (-496.285) [-494.073] (-495.330) (-496.024) * (-496.196) (-494.442) [-495.160] (-497.761) -- 0:00:26
577500 -- (-495.666) (-494.725) [-494.321] (-496.111) * (-500.023) [-494.166] (-495.052) (-495.078) -- 0:00:26
578000 -- [-494.548] (-495.756) (-496.718) (-496.757) * (-493.786) [-494.274] (-497.418) (-493.793) -- 0:00:26
578500 -- [-493.740] (-494.717) (-496.707) (-496.372) * (-500.435) (-497.350) [-496.989] (-494.939) -- 0:00:26
579000 -- (-495.407) (-502.073) (-496.330) [-495.278] * (-495.622) (-494.610) (-501.307) [-495.931] -- 0:00:26
579500 -- (-495.291) [-496.371] (-494.952) (-495.718) * (-495.884) (-494.777) [-494.166] (-495.481) -- 0:00:26
580000 -- [-496.902] (-502.519) (-494.556) (-495.769) * (-495.047) [-494.793] (-496.267) (-494.394) -- 0:00:26
Average standard deviation of split frequencies: 0.009526
580500 -- [-499.643] (-494.565) (-496.846) (-496.220) * (-495.540) [-495.482] (-497.009) (-497.018) -- 0:00:26
581000 -- (-495.929) [-495.459] (-496.809) (-494.116) * [-500.558] (-496.193) (-500.411) (-498.444) -- 0:00:25
581500 -- (-497.517) (-494.796) [-498.322] (-493.402) * (-497.586) (-495.046) (-496.883) [-495.831] -- 0:00:25
582000 -- [-496.111] (-494.641) (-495.120) (-498.927) * (-494.583) (-494.659) (-495.696) [-495.580] -- 0:00:25
582500 -- (-497.583) (-496.049) [-493.948] (-495.976) * [-495.064] (-498.450) (-500.274) (-496.232) -- 0:00:25
583000 -- (-499.462) [-497.901] (-494.347) (-500.247) * (-496.239) [-497.016] (-496.851) (-494.111) -- 0:00:25
583500 -- (-502.209) (-498.218) [-493.745] (-500.124) * (-498.946) (-498.738) [-494.149] (-493.938) -- 0:00:25
584000 -- [-494.243] (-494.735) (-499.494) (-493.807) * (-501.045) (-495.486) [-494.381] (-495.722) -- 0:00:25
584500 -- [-493.733] (-494.630) (-502.032) (-497.114) * [-494.240] (-497.390) (-497.376) (-497.758) -- 0:00:25
585000 -- (-496.022) (-496.340) [-496.833] (-494.263) * (-494.076) (-497.667) [-493.198] (-500.439) -- 0:00:25
Average standard deviation of split frequencies: 0.009854
585500 -- (-495.612) (-494.033) [-494.761] (-494.477) * (-496.190) (-496.635) (-493.751) [-495.485] -- 0:00:26
586000 -- (-498.486) (-493.973) (-493.693) [-495.668] * (-497.921) (-495.953) (-496.552) [-495.775] -- 0:00:26
586500 -- [-495.438] (-496.383) (-493.162) (-496.187) * [-494.266] (-494.043) (-495.877) (-499.516) -- 0:00:26
587000 -- (-497.097) (-496.355) [-498.663] (-495.074) * (-495.352) [-494.877] (-498.114) (-495.035) -- 0:00:26
587500 -- (-496.061) (-494.658) (-500.104) [-495.410] * (-496.092) [-497.322] (-493.954) (-495.322) -- 0:00:25
588000 -- [-495.143] (-496.029) (-495.955) (-494.580) * [-498.041] (-494.014) (-497.214) (-495.441) -- 0:00:25
588500 -- [-493.873] (-494.641) (-496.562) (-495.460) * (-500.428) (-494.010) (-495.148) [-493.568] -- 0:00:25
589000 -- (-495.993) (-493.687) (-494.939) [-494.850] * (-497.591) (-494.181) [-494.552] (-496.226) -- 0:00:25
589500 -- (-494.738) [-494.085] (-493.966) (-495.501) * (-496.557) [-494.695] (-495.730) (-495.688) -- 0:00:25
590000 -- (-494.841) (-495.996) (-494.882) [-493.887] * (-494.859) (-494.760) [-495.544] (-496.206) -- 0:00:25
Average standard deviation of split frequencies: 0.009524
590500 -- (-495.780) (-495.204) [-497.137] (-498.574) * (-499.955) [-493.524] (-497.732) (-494.358) -- 0:00:25
591000 -- [-496.341] (-496.697) (-496.944) (-497.093) * [-494.715] (-495.938) (-494.261) (-496.389) -- 0:00:25
591500 -- [-497.194] (-497.114) (-498.555) (-494.603) * (-493.726) (-494.531) [-493.762] (-493.523) -- 0:00:25
592000 -- [-494.551] (-495.845) (-496.295) (-494.131) * (-493.892) [-496.036] (-494.721) (-497.053) -- 0:00:25
592500 -- [-496.213] (-495.623) (-498.339) (-493.730) * (-495.569) (-494.063) [-499.073] (-496.241) -- 0:00:25
593000 -- (-494.808) [-499.367] (-494.295) (-496.499) * [-496.157] (-497.808) (-503.579) (-498.393) -- 0:00:25
593500 -- [-495.310] (-494.295) (-495.328) (-496.189) * [-497.914] (-499.412) (-495.702) (-496.775) -- 0:00:25
594000 -- (-494.903) (-497.027) (-496.698) [-498.945] * (-505.407) (-494.576) (-494.022) [-494.939] -- 0:00:25
594500 -- (-495.573) (-496.596) [-495.213] (-495.882) * (-494.205) (-494.677) [-496.064] (-494.815) -- 0:00:25
595000 -- (-494.822) (-493.582) [-495.087] (-494.748) * [-496.021] (-494.421) (-495.696) (-496.945) -- 0:00:25
Average standard deviation of split frequencies: 0.009590
595500 -- (-499.653) [-495.984] (-494.610) (-496.966) * (-496.755) (-496.320) [-496.394] (-500.160) -- 0:00:25
596000 -- [-496.303] (-502.510) (-497.886) (-493.968) * (-495.872) (-496.820) (-494.477) [-495.165] -- 0:00:25
596500 -- [-498.528] (-498.418) (-493.737) (-493.477) * (-495.036) (-494.723) [-498.992] (-493.671) -- 0:00:25
597000 -- (-498.320) (-498.730) [-493.812] (-494.419) * (-496.317) (-499.200) (-495.895) [-495.768] -- 0:00:24
597500 -- [-497.128] (-498.102) (-496.028) (-495.635) * (-496.861) [-497.084] (-497.160) (-494.827) -- 0:00:24
598000 -- (-495.496) (-494.285) (-493.494) [-494.581] * [-494.598] (-494.779) (-496.235) (-494.748) -- 0:00:24
598500 -- (-496.047) (-493.809) [-493.937] (-494.859) * (-494.689) (-496.893) (-495.785) [-494.553] -- 0:00:24
599000 -- (-496.520) [-494.015] (-495.443) (-497.554) * [-494.430] (-496.530) (-495.460) (-494.605) -- 0:00:24
599500 -- [-496.740] (-498.086) (-494.851) (-494.637) * (-495.107) (-497.269) [-503.503] (-496.637) -- 0:00:24
600000 -- (-494.512) [-495.157] (-495.531) (-495.685) * (-496.691) (-494.766) (-501.473) [-498.653] -- 0:00:24
Average standard deviation of split frequencies: 0.009418
600500 -- (-493.283) (-496.693) [-495.925] (-493.732) * (-498.346) [-494.213] (-498.054) (-495.066) -- 0:00:24
601000 -- (-494.486) (-494.953) [-496.539] (-495.706) * (-498.524) (-494.147) [-496.402] (-494.131) -- 0:00:24
601500 -- (-497.010) (-495.630) [-494.596] (-495.224) * (-494.051) [-493.961] (-496.120) (-494.901) -- 0:00:24
602000 -- (-498.671) (-496.825) (-497.657) [-494.467] * (-493.961) (-495.201) (-495.159) [-494.675] -- 0:00:25
602500 -- (-496.313) [-495.950] (-495.537) (-495.885) * (-493.714) (-495.318) [-493.778] (-495.461) -- 0:00:25
603000 -- (-494.541) (-494.521) [-496.122] (-496.839) * (-494.777) [-498.253] (-493.728) (-495.244) -- 0:00:25
603500 -- (-493.830) (-494.900) (-495.084) [-496.245] * (-496.450) (-496.434) (-495.026) [-494.644] -- 0:00:24
604000 -- [-496.365] (-495.198) (-493.906) (-495.817) * (-495.720) (-494.397) (-494.755) [-494.271] -- 0:00:24
604500 -- (-496.263) (-493.389) [-494.452] (-495.410) * (-495.099) [-494.830] (-493.981) (-494.206) -- 0:00:24
605000 -- (-496.188) (-496.646) (-495.399) [-493.402] * [-494.007] (-499.304) (-495.099) (-500.828) -- 0:00:24
Average standard deviation of split frequencies: 0.009043
605500 -- [-496.069] (-496.620) (-495.460) (-493.250) * (-493.708) (-496.791) [-496.446] (-500.843) -- 0:00:24
606000 -- [-495.805] (-494.854) (-494.863) (-494.031) * [-494.472] (-494.049) (-493.758) (-498.110) -- 0:00:24
606500 -- (-498.550) [-497.995] (-493.805) (-495.575) * [-493.615] (-495.598) (-499.407) (-506.217) -- 0:00:24
607000 -- (-495.873) (-495.902) [-495.498] (-495.202) * (-496.989) [-495.597] (-496.336) (-501.878) -- 0:00:24
607500 -- (-495.914) (-498.525) (-499.063) [-496.327] * (-494.839) [-498.572] (-493.761) (-497.318) -- 0:00:24
608000 -- [-494.761] (-493.510) (-493.698) (-495.608) * (-494.442) (-495.076) [-495.094] (-495.555) -- 0:00:24
608500 -- (-494.288) [-496.700] (-497.854) (-495.434) * [-498.304] (-495.993) (-496.912) (-494.764) -- 0:00:24
609000 -- (-503.374) (-495.359) (-495.471) [-493.885] * (-496.752) (-498.087) [-502.905] (-494.895) -- 0:00:24
609500 -- (-495.963) [-499.024] (-496.353) (-493.911) * [-495.137] (-494.824) (-497.261) (-500.250) -- 0:00:24
610000 -- (-494.800) [-494.899] (-495.673) (-495.521) * (-498.062) (-493.324) (-494.909) [-494.579] -- 0:00:24
Average standard deviation of split frequencies: 0.009456
610500 -- (-494.933) (-494.568) (-495.511) [-496.812] * (-496.213) (-495.416) (-496.167) [-496.315] -- 0:00:24
611000 -- [-493.895] (-493.895) (-494.840) (-497.020) * (-495.691) [-493.937] (-497.726) (-493.393) -- 0:00:24
611500 -- (-493.277) [-494.497] (-494.196) (-496.716) * (-493.908) (-499.359) [-496.505] (-497.201) -- 0:00:24
612000 -- [-493.610] (-494.290) (-495.168) (-493.505) * (-494.067) (-494.833) [-494.923] (-495.768) -- 0:00:24
612500 -- (-495.762) (-493.812) [-496.619] (-496.990) * [-494.559] (-495.177) (-496.267) (-494.756) -- 0:00:24
613000 -- (-496.526) [-494.614] (-496.258) (-495.465) * (-496.802) [-493.923] (-494.490) (-499.456) -- 0:00:23
613500 -- (-499.005) (-493.689) (-494.087) [-496.800] * (-495.393) (-494.958) (-495.003) [-493.301] -- 0:00:23
614000 -- (-494.702) (-494.358) (-494.535) [-496.993] * (-495.944) [-494.582] (-499.590) (-495.035) -- 0:00:23
614500 -- (-494.515) (-494.114) [-497.066] (-493.703) * (-496.569) [-497.161] (-495.571) (-493.098) -- 0:00:23
615000 -- (-501.273) [-494.612] (-494.362) (-493.788) * (-497.965) [-495.522] (-495.961) (-495.015) -- 0:00:23
Average standard deviation of split frequencies: 0.009183
615500 -- (-494.092) (-497.938) (-493.826) [-496.599] * (-496.291) (-494.487) (-495.169) [-496.130] -- 0:00:23
616000 -- [-494.329] (-495.944) (-494.709) (-498.140) * (-495.243) (-494.080) (-494.357) [-496.476] -- 0:00:23
616500 -- (-493.956) [-496.343] (-495.301) (-495.956) * (-498.610) (-495.688) [-494.450] (-495.366) -- 0:00:23
617000 -- (-495.003) [-495.345] (-493.933) (-500.982) * (-495.553) (-498.787) (-493.926) [-494.064] -- 0:00:23
617500 -- (-495.913) (-497.344) [-495.237] (-495.729) * [-499.313] (-498.770) (-495.042) (-494.759) -- 0:00:23
618000 -- (-496.076) [-493.929] (-495.285) (-494.806) * (-494.644) [-496.582] (-494.402) (-495.183) -- 0:00:23
618500 -- (-495.741) (-493.852) (-499.609) [-498.300] * [-497.203] (-495.144) (-494.667) (-493.719) -- 0:00:23
619000 -- (-498.590) (-495.291) (-495.815) [-494.199] * (-495.130) [-493.873] (-498.045) (-494.524) -- 0:00:23
619500 -- (-496.038) (-496.559) (-495.671) [-494.681] * (-494.983) (-494.913) [-493.984] (-495.181) -- 0:00:23
620000 -- [-493.593] (-494.960) (-495.618) (-494.299) * [-496.032] (-493.575) (-495.447) (-502.911) -- 0:00:23
Average standard deviation of split frequencies: 0.009779
620500 -- (-495.101) (-499.135) [-494.026] (-497.068) * (-496.387) (-497.291) (-494.818) [-493.492] -- 0:00:23
621000 -- (-496.721) [-500.891] (-505.347) (-494.888) * (-496.436) [-496.874] (-493.760) (-493.317) -- 0:00:23
621500 -- [-498.302] (-497.641) (-500.792) (-500.062) * (-494.554) (-493.783) (-494.266) [-495.055] -- 0:00:23
622000 -- (-496.641) [-493.307] (-496.043) (-499.609) * (-498.742) (-494.993) [-494.469] (-495.140) -- 0:00:23
622500 -- [-499.652] (-493.327) (-494.821) (-493.464) * (-495.273) (-498.196) [-499.521] (-493.743) -- 0:00:23
623000 -- (-500.996) (-497.229) [-495.509] (-494.907) * (-494.518) (-496.426) (-495.455) [-496.095] -- 0:00:23
623500 -- (-496.647) (-494.922) (-495.892) [-494.570] * (-495.204) [-494.456] (-500.290) (-497.692) -- 0:00:23
624000 -- (-496.390) (-499.012) [-495.045] (-499.946) * [-497.111] (-494.237) (-495.311) (-497.086) -- 0:00:23
624500 -- [-494.013] (-496.170) (-494.861) (-495.090) * (-494.502) (-495.439) (-498.132) [-495.139] -- 0:00:23
625000 -- (-496.670) (-495.843) (-499.041) [-494.921] * (-493.945) (-497.120) (-500.394) [-496.262] -- 0:00:23
Average standard deviation of split frequencies: 0.009695
625500 -- (-495.186) (-495.428) (-495.079) [-493.941] * [-494.383] (-495.941) (-496.797) (-497.481) -- 0:00:23
626000 -- (-496.337) (-495.215) [-494.146] (-495.432) * [-493.377] (-497.374) (-494.436) (-503.209) -- 0:00:23
626500 -- (-494.786) [-494.848] (-493.986) (-499.787) * (-493.504) (-495.623) (-502.074) [-496.653] -- 0:00:23
627000 -- (-497.178) [-493.511] (-496.032) (-501.254) * [-494.022] (-497.252) (-497.349) (-497.652) -- 0:00:23
627500 -- [-498.317] (-494.882) (-503.322) (-494.184) * [-493.859] (-497.470) (-494.686) (-495.237) -- 0:00:23
628000 -- (-497.986) (-494.344) (-495.518) [-494.866] * (-495.901) (-497.860) (-494.633) [-494.564] -- 0:00:23
628500 -- (-496.968) [-496.496] (-495.756) (-494.860) * (-495.090) (-496.002) [-494.351] (-496.700) -- 0:00:23
629000 -- (-494.892) [-494.827] (-493.961) (-496.467) * (-497.916) (-496.704) (-496.541) [-497.280] -- 0:00:23
629500 -- (-495.643) (-495.621) [-494.283] (-494.118) * (-498.154) (-495.513) [-495.361] (-496.280) -- 0:00:22
630000 -- (-498.239) (-494.708) [-494.469] (-496.324) * [-494.160] (-493.753) (-501.809) (-496.853) -- 0:00:22
Average standard deviation of split frequencies: 0.009811
630500 -- (-499.007) (-496.172) [-493.340] (-496.192) * (-493.571) (-497.026) [-494.407] (-495.234) -- 0:00:22
631000 -- (-495.725) (-493.988) [-494.255] (-501.823) * (-494.149) (-496.672) (-496.809) [-496.641] -- 0:00:22
631500 -- (-497.183) (-494.263) (-493.437) [-493.734] * (-493.628) (-495.167) (-494.741) [-494.456] -- 0:00:22
632000 -- (-496.184) (-493.644) [-493.488] (-497.277) * (-495.671) (-496.927) [-494.875] (-494.635) -- 0:00:22
632500 -- (-493.523) [-494.249] (-495.761) (-495.085) * [-495.899] (-494.297) (-494.315) (-494.330) -- 0:00:22
633000 -- (-496.010) (-495.985) [-494.604] (-496.989) * (-494.055) [-493.526] (-493.798) (-494.370) -- 0:00:22
633500 -- (-498.206) (-496.878) (-495.463) [-497.909] * [-493.610] (-496.303) (-494.824) (-496.263) -- 0:00:22
634000 -- (-493.774) [-498.908] (-496.712) (-497.962) * (-493.831) (-497.584) (-494.753) [-495.608] -- 0:00:22
634500 -- (-494.922) (-496.330) (-495.503) [-496.784] * (-493.390) (-494.181) (-497.396) [-494.024] -- 0:00:22
635000 -- (-495.492) [-498.129] (-502.120) (-500.583) * [-494.022] (-494.222) (-494.968) (-494.542) -- 0:00:22
Average standard deviation of split frequencies: 0.009311
635500 -- (-498.178) (-493.667) (-496.324) [-494.905] * [-498.211] (-493.820) (-494.617) (-495.022) -- 0:00:22
636000 -- (-498.643) (-498.089) (-498.404) [-495.959] * [-493.680] (-494.821) (-497.256) (-498.456) -- 0:00:22
636500 -- (-496.085) (-494.998) [-494.566] (-495.213) * (-500.673) (-496.118) [-496.548] (-493.713) -- 0:00:22
637000 -- [-495.104] (-497.902) (-494.520) (-495.068) * (-496.309) (-494.875) (-496.906) [-497.556] -- 0:00:22
637500 -- (-494.301) (-495.498) (-502.058) [-496.079] * [-497.298] (-495.028) (-497.709) (-496.989) -- 0:00:22
638000 -- [-495.443] (-495.709) (-494.787) (-495.081) * (-495.542) (-496.734) [-494.148] (-496.000) -- 0:00:22
638500 -- [-498.725] (-496.688) (-495.179) (-496.678) * [-499.092] (-496.526) (-497.906) (-498.184) -- 0:00:22
639000 -- (-495.904) (-500.314) (-493.271) [-494.162] * (-496.250) (-500.190) [-494.332] (-495.072) -- 0:00:22
639500 -- (-496.552) (-503.734) [-493.393] (-499.287) * [-496.392] (-495.201) (-495.179) (-495.818) -- 0:00:22
640000 -- (-494.046) [-497.553] (-496.448) (-495.686) * [-493.724] (-498.647) (-494.069) (-500.891) -- 0:00:22
Average standard deviation of split frequencies: 0.009795
640500 -- (-493.877) (-495.764) (-496.590) [-495.395] * [-494.456] (-497.389) (-494.091) (-497.400) -- 0:00:22
641000 -- (-496.683) [-494.681] (-495.399) (-495.211) * (-495.865) (-494.083) (-493.798) [-496.354] -- 0:00:22
641500 -- (-495.033) [-494.678] (-494.700) (-495.963) * (-499.001) (-495.881) (-495.129) [-494.652] -- 0:00:22
642000 -- (-496.377) (-495.549) (-496.531) [-495.990] * (-497.374) (-495.682) [-494.354] (-494.845) -- 0:00:22
642500 -- (-494.352) (-499.204) [-495.869] (-495.242) * (-499.190) (-494.276) (-493.276) [-496.954] -- 0:00:22
643000 -- (-494.367) [-496.458] (-494.807) (-497.468) * (-494.304) [-495.106] (-495.072) (-495.207) -- 0:00:22
643500 -- (-497.045) (-497.483) (-497.895) [-496.142] * (-495.294) (-497.700) (-498.740) [-495.387] -- 0:00:22
644000 -- (-493.720) (-496.618) (-493.677) [-495.100] * (-493.998) (-495.872) (-493.555) [-497.058] -- 0:00:22
644500 -- (-496.994) (-496.555) (-493.436) [-496.627] * (-495.038) [-495.956] (-494.510) (-494.915) -- 0:00:22
645000 -- (-499.097) (-494.364) (-495.692) [-494.339] * (-493.555) (-495.692) [-494.670] (-494.638) -- 0:00:22
Average standard deviation of split frequencies: 0.009578
645500 -- (-497.281) (-496.323) (-507.583) [-494.792] * [-494.691] (-494.195) (-494.842) (-497.094) -- 0:00:21
646000 -- [-495.217] (-495.793) (-496.594) (-494.764) * [-495.518] (-495.517) (-494.399) (-495.761) -- 0:00:21
646500 -- (-496.898) [-495.019] (-496.999) (-494.310) * [-500.335] (-499.547) (-496.608) (-495.749) -- 0:00:21
647000 -- [-496.074] (-497.144) (-495.716) (-494.226) * (-496.473) (-497.790) [-494.398] (-495.732) -- 0:00:21
647500 -- (-495.848) (-493.327) (-494.655) [-495.367] * (-496.088) (-500.330) (-495.024) [-495.066] -- 0:00:21
648000 -- (-495.868) (-494.620) (-493.974) [-495.337] * (-495.845) (-497.357) [-496.304] (-495.384) -- 0:00:21
648500 -- (-493.810) [-493.939] (-495.831) (-494.292) * (-494.915) [-493.377] (-493.717) (-496.015) -- 0:00:21
649000 -- (-494.724) (-495.210) [-495.035] (-496.378) * (-496.987) (-495.581) [-496.475] (-495.861) -- 0:00:21
649500 -- (-494.627) (-495.037) (-494.077) [-494.645] * (-495.899) (-495.237) [-497.745] (-495.382) -- 0:00:21
650000 -- [-496.404] (-500.839) (-495.384) (-494.922) * (-493.990) (-495.632) [-495.052] (-501.131) -- 0:00:21
Average standard deviation of split frequencies: 0.009645
650500 -- (-493.942) (-498.477) [-494.344] (-496.456) * [-493.460] (-494.847) (-498.394) (-499.862) -- 0:00:21
651000 -- (-495.982) [-494.626] (-493.533) (-495.706) * (-494.142) (-497.110) (-495.607) [-498.858] -- 0:00:21
651500 -- (-494.225) (-495.620) [-496.466] (-493.596) * (-501.527) [-494.049] (-495.832) (-494.191) -- 0:00:21
652000 -- (-495.553) (-494.811) [-497.992] (-496.167) * (-499.012) [-496.391] (-497.522) (-493.647) -- 0:00:21
652500 -- (-497.513) [-496.468] (-494.720) (-494.180) * [-495.396] (-494.634) (-494.105) (-498.495) -- 0:00:21
653000 -- (-495.105) (-494.552) (-494.745) [-495.115] * (-497.188) [-493.635] (-494.388) (-495.107) -- 0:00:21
653500 -- (-494.665) (-495.476) [-495.858] (-494.280) * (-494.464) (-496.882) (-496.099) [-494.131] -- 0:00:21
654000 -- [-494.904] (-495.912) (-498.110) (-496.444) * (-493.948) [-498.541] (-500.900) (-494.304) -- 0:00:21
654500 -- (-495.183) (-494.979) [-494.707] (-495.811) * [-494.119] (-499.434) (-501.102) (-493.976) -- 0:00:21
655000 -- (-495.551) [-493.938] (-496.344) (-495.415) * (-496.190) [-493.545] (-496.685) (-496.211) -- 0:00:21
Average standard deviation of split frequencies: 0.009746
655500 -- [-497.413] (-493.949) (-495.376) (-493.835) * (-495.306) (-494.965) (-496.422) [-496.803] -- 0:00:21
656000 -- (-496.223) (-496.474) (-494.648) [-494.072] * (-494.076) [-494.936] (-495.935) (-496.038) -- 0:00:21
656500 -- (-496.845) (-497.367) [-495.149] (-500.633) * (-498.356) (-494.236) [-498.882] (-499.074) -- 0:00:21
657000 -- (-495.890) [-495.447] (-495.530) (-496.049) * (-496.691) [-494.025] (-497.207) (-496.366) -- 0:00:21
657500 -- (-499.162) (-497.050) (-494.413) [-494.666] * (-493.664) (-494.588) (-495.005) [-495.927] -- 0:00:21
658000 -- (-500.934) [-496.385] (-497.131) (-495.825) * (-494.035) (-494.850) [-494.665] (-495.436) -- 0:00:21
658500 -- (-499.584) (-496.520) (-494.589) [-495.614] * (-497.078) [-503.435] (-495.059) (-500.543) -- 0:00:21
659000 -- [-496.032] (-497.560) (-497.262) (-498.676) * (-495.889) (-497.850) [-496.614] (-495.933) -- 0:00:21
659500 -- [-495.765] (-494.259) (-493.751) (-494.015) * (-502.425) [-496.316] (-494.474) (-494.954) -- 0:00:21
660000 -- [-497.729] (-494.811) (-497.165) (-493.466) * (-499.239) (-494.689) [-495.939] (-497.814) -- 0:00:21
Average standard deviation of split frequencies: 0.009677
660500 -- (-497.303) (-494.130) [-495.315] (-496.275) * (-496.301) (-499.637) (-494.946) [-494.285] -- 0:00:21
661000 -- (-497.658) (-494.160) (-495.524) [-495.949] * [-495.223] (-500.435) (-495.770) (-495.564) -- 0:00:21
661500 -- (-495.591) [-494.147] (-494.785) (-494.576) * (-501.365) (-502.862) (-493.936) [-496.686] -- 0:00:20
662000 -- (-494.704) (-494.170) (-494.786) [-494.027] * (-494.134) [-495.949] (-496.776) (-493.465) -- 0:00:20
662500 -- (-496.667) [-497.706] (-495.858) (-494.218) * (-499.907) [-494.525] (-494.059) (-493.427) -- 0:00:20
663000 -- (-500.887) (-495.993) [-496.111] (-496.137) * (-494.388) (-497.517) (-493.772) [-495.212] -- 0:00:20
663500 -- (-496.961) (-496.429) [-494.475] (-495.345) * (-493.975) (-497.097) [-495.387] (-494.601) -- 0:00:20
664000 -- [-494.286] (-495.149) (-497.706) (-496.755) * (-496.590) (-494.446) [-495.985] (-500.380) -- 0:00:20
664500 -- (-496.535) [-494.547] (-496.011) (-500.717) * (-498.298) (-494.275) [-494.171] (-501.505) -- 0:00:20
665000 -- (-495.641) [-494.742] (-495.609) (-496.739) * [-496.819] (-495.342) (-495.854) (-496.625) -- 0:00:20
Average standard deviation of split frequencies: 0.009555
665500 -- [-493.809] (-495.487) (-493.443) (-497.133) * (-496.991) (-501.042) (-494.452) [-497.066] -- 0:00:20
666000 -- [-494.479] (-494.722) (-495.410) (-494.469) * (-497.900) (-500.102) (-495.527) [-496.180] -- 0:00:20
666500 -- (-497.119) (-496.098) [-493.924] (-497.339) * (-497.757) [-496.026] (-493.527) (-495.743) -- 0:00:20
667000 -- [-494.964] (-493.123) (-495.008) (-495.425) * (-496.142) [-494.226] (-493.528) (-496.766) -- 0:00:20
667500 -- (-494.919) [-495.082] (-498.215) (-494.170) * [-497.922] (-493.963) (-496.558) (-494.117) -- 0:00:20
668000 -- [-498.600] (-496.637) (-495.058) (-495.551) * (-496.537) (-496.505) (-494.633) [-493.681] -- 0:00:20
668500 -- (-495.510) (-496.564) [-494.157] (-494.212) * (-497.462) (-499.248) (-495.051) [-494.781] -- 0:00:20
669000 -- (-495.876) (-499.103) [-494.834] (-497.249) * (-495.508) (-497.725) (-499.597) [-495.355] -- 0:00:20
669500 -- (-495.457) [-495.133] (-495.339) (-497.088) * (-493.195) [-493.567] (-496.180) (-494.220) -- 0:00:20
670000 -- [-498.121] (-501.879) (-495.447) (-495.408) * (-497.108) (-494.949) (-501.927) [-496.792] -- 0:00:20
Average standard deviation of split frequencies: 0.010368
670500 -- [-495.625] (-496.441) (-494.362) (-494.026) * (-495.566) [-497.214] (-493.552) (-496.631) -- 0:00:20
671000 -- [-493.427] (-497.003) (-494.805) (-494.427) * [-495.925] (-498.054) (-494.100) (-497.870) -- 0:00:20
671500 -- (-493.612) (-494.775) [-494.431] (-494.697) * (-495.469) (-495.118) (-495.110) [-494.156] -- 0:00:20
672000 -- (-495.704) [-496.290] (-495.008) (-497.449) * (-495.659) (-495.434) [-494.061] (-494.737) -- 0:00:20
672500 -- (-502.559) [-493.980] (-498.575) (-496.169) * (-497.588) [-495.560] (-495.313) (-495.267) -- 0:00:20
673000 -- (-499.131) [-495.402] (-498.000) (-496.736) * (-495.049) [-494.150] (-496.296) (-494.389) -- 0:00:20
673500 -- (-496.664) (-494.725) (-500.266) [-495.124] * (-496.566) (-496.610) [-497.024] (-493.652) -- 0:00:20
674000 -- (-494.614) (-495.185) [-494.804] (-498.488) * (-502.110) (-495.425) [-496.493] (-496.691) -- 0:00:20
674500 -- (-494.971) [-496.462] (-496.681) (-495.689) * (-494.213) [-495.600] (-495.735) (-494.972) -- 0:00:20
675000 -- (-496.251) [-494.768] (-494.974) (-496.030) * (-493.794) [-494.596] (-497.461) (-494.949) -- 0:00:20
Average standard deviation of split frequencies: 0.010042
675500 -- [-494.154] (-495.353) (-494.828) (-495.476) * (-493.642) [-494.523] (-495.502) (-493.598) -- 0:00:20
676000 -- (-494.765) (-495.122) [-496.893] (-496.958) * (-494.915) [-494.020] (-496.244) (-498.071) -- 0:00:20
676500 -- (-494.216) (-501.852) (-497.474) [-497.356] * (-496.623) (-496.046) [-494.273] (-494.691) -- 0:00:20
677000 -- (-493.962) (-495.181) [-495.447] (-495.430) * (-495.475) [-494.991] (-495.864) (-495.133) -- 0:00:20
677500 -- (-497.111) (-497.432) [-501.233] (-495.062) * (-495.473) (-494.265) (-496.663) [-493.337] -- 0:00:19
678000 -- (-494.743) (-496.777) (-498.000) [-494.937] * (-495.291) [-495.386] (-496.752) (-496.104) -- 0:00:19
678500 -- (-500.129) [-498.799] (-494.176) (-497.587) * (-502.055) (-493.803) [-494.113] (-495.329) -- 0:00:19
679000 -- [-501.780] (-495.473) (-495.675) (-494.102) * (-501.158) [-494.113] (-497.808) (-498.262) -- 0:00:19
679500 -- [-496.311] (-494.945) (-495.396) (-494.589) * [-499.504] (-493.852) (-498.144) (-494.904) -- 0:00:19
680000 -- (-497.780) [-501.410] (-496.733) (-501.661) * (-499.639) (-495.444) (-495.090) [-494.128] -- 0:00:19
Average standard deviation of split frequencies: 0.010111
680500 -- (-496.120) (-497.964) [-494.872] (-499.145) * [-495.498] (-496.213) (-493.588) (-494.801) -- 0:00:19
681000 -- (-496.911) [-495.281] (-494.361) (-499.845) * (-495.982) (-494.978) [-493.747] (-495.972) -- 0:00:19
681500 -- (-494.612) (-494.883) [-493.877] (-500.836) * (-494.794) (-496.964) [-495.766] (-496.376) -- 0:00:19
682000 -- (-494.489) (-496.330) (-497.592) [-495.120] * (-495.665) (-496.882) [-494.825] (-496.123) -- 0:00:19
682500 -- [-496.864] (-496.299) (-495.633) (-494.462) * (-495.596) [-497.159] (-497.160) (-495.199) -- 0:00:19
683000 -- (-493.302) (-497.110) [-497.822] (-497.085) * [-494.466] (-496.302) (-495.106) (-496.205) -- 0:00:19
683500 -- (-494.003) (-498.521) [-493.890] (-500.885) * (-495.636) (-495.466) (-494.313) [-494.476] -- 0:00:19
684000 -- (-495.921) (-494.958) (-496.668) [-493.863] * (-495.945) (-494.902) [-494.005] (-495.275) -- 0:00:19
684500 -- (-494.310) [-494.703] (-494.381) (-494.339) * (-495.158) [-493.537] (-495.475) (-493.608) -- 0:00:19
685000 -- (-497.813) (-495.359) (-493.504) [-494.151] * (-498.925) [-494.202] (-496.319) (-495.462) -- 0:00:19
Average standard deviation of split frequencies: 0.010079
685500 -- (-496.410) (-494.102) [-494.967] (-498.202) * (-496.593) [-498.027] (-495.902) (-504.765) -- 0:00:19
686000 -- (-493.671) (-493.622) [-495.890] (-496.690) * (-495.668) (-494.898) (-493.178) [-493.262] -- 0:00:19
686500 -- [-495.850] (-493.939) (-494.991) (-495.721) * [-494.311] (-496.353) (-497.001) (-493.611) -- 0:00:19
687000 -- (-494.913) (-493.636) (-497.218) [-494.001] * (-495.659) (-495.843) [-498.816] (-493.768) -- 0:00:19
687500 -- (-496.114) (-501.174) (-494.101) [-493.998] * [-498.099] (-493.611) (-500.888) (-495.023) -- 0:00:19
688000 -- [-497.002] (-497.335) (-496.779) (-495.199) * [-498.058] (-497.750) (-498.456) (-496.739) -- 0:00:19
688500 -- (-495.521) [-496.002] (-496.827) (-494.482) * (-495.771) (-496.991) [-498.492] (-501.505) -- 0:00:19
689000 -- (-495.983) (-496.899) (-496.653) [-495.115] * (-494.331) (-502.800) [-497.044] (-496.676) -- 0:00:19
689500 -- [-497.305] (-494.011) (-496.529) (-494.053) * (-493.970) (-494.426) [-494.908] (-499.541) -- 0:00:19
690000 -- (-493.647) (-493.649) [-495.705] (-494.471) * (-493.941) (-493.553) [-497.665] (-497.324) -- 0:00:19
Average standard deviation of split frequencies: 0.009783
690500 -- (-495.950) [-495.605] (-499.799) (-494.636) * [-497.501] (-498.294) (-494.836) (-494.436) -- 0:00:19
691000 -- (-496.114) (-495.119) (-501.336) [-493.861] * (-495.332) [-497.097] (-495.897) (-494.650) -- 0:00:19
691500 -- (-501.021) (-499.589) (-495.456) [-493.777] * (-493.889) [-493.817] (-494.934) (-496.578) -- 0:00:19
692000 -- (-494.557) (-497.031) [-495.844] (-499.474) * (-495.369) (-493.735) (-497.957) [-494.445] -- 0:00:19
692500 -- (-498.088) [-494.113] (-496.443) (-494.111) * (-494.086) (-494.868) (-495.641) [-495.233] -- 0:00:19
693000 -- (-493.691) [-493.502] (-495.854) (-494.663) * (-498.430) (-498.610) (-496.041) [-494.473] -- 0:00:19
693500 -- (-493.671) [-494.187] (-494.547) (-497.354) * (-493.558) (-494.848) [-495.203] (-494.388) -- 0:00:19
694000 -- [-494.096] (-495.054) (-493.745) (-494.034) * (-493.935) (-495.409) [-495.161] (-495.482) -- 0:00:18
694500 -- (-494.038) (-494.441) (-495.308) [-494.217] * (-494.373) [-495.776] (-496.479) (-495.188) -- 0:00:18
695000 -- (-495.076) (-497.438) [-495.206] (-495.475) * (-495.515) [-495.953] (-495.937) (-494.570) -- 0:00:18
Average standard deviation of split frequencies: 0.010566
695500 -- (-497.448) (-499.079) (-495.293) [-494.898] * (-499.224) [-494.603] (-495.839) (-493.946) -- 0:00:18
696000 -- (-497.592) [-498.287] (-494.354) (-494.789) * (-495.312) (-495.333) (-494.154) [-493.517] -- 0:00:18
696500 -- [-496.690] (-496.250) (-494.379) (-500.312) * (-494.398) (-495.469) [-493.703] (-494.402) -- 0:00:18
697000 -- [-496.233] (-498.074) (-495.505) (-495.974) * (-497.861) [-500.280] (-498.515) (-494.713) -- 0:00:18
697500 -- (-494.675) (-493.885) (-496.448) [-494.352] * (-497.672) [-496.619] (-497.960) (-494.025) -- 0:00:18
698000 -- (-499.865) (-493.735) (-496.683) [-496.709] * (-498.606) (-495.904) (-500.539) [-493.978] -- 0:00:18
698500 -- [-494.524] (-496.258) (-495.404) (-497.896) * (-497.014) [-497.201] (-495.772) (-495.968) -- 0:00:18
699000 -- (-498.208) [-500.795] (-495.505) (-496.527) * [-497.340] (-493.615) (-494.340) (-495.921) -- 0:00:18
699500 -- (-495.089) (-500.999) (-496.159) [-494.181] * [-495.888] (-494.035) (-496.478) (-494.788) -- 0:00:18
700000 -- (-500.455) [-498.527] (-495.595) (-496.471) * (-496.904) (-495.444) [-496.453] (-495.954) -- 0:00:18
Average standard deviation of split frequencies: 0.010540
700500 -- (-494.745) [-494.046] (-496.897) (-496.865) * [-496.203] (-495.184) (-498.590) (-497.472) -- 0:00:18
701000 -- (-494.286) [-494.443] (-495.384) (-498.604) * [-498.319] (-497.052) (-494.061) (-494.891) -- 0:00:18
701500 -- (-495.022) (-494.896) [-497.291] (-494.983) * (-496.783) (-495.654) (-493.866) [-497.456] -- 0:00:18
702000 -- (-495.933) (-496.670) [-495.141] (-495.511) * (-495.189) (-500.711) [-494.328] (-496.821) -- 0:00:18
702500 -- (-495.635) (-500.941) [-494.550] (-494.356) * [-500.754] (-496.517) (-494.160) (-494.180) -- 0:00:18
703000 -- (-497.016) (-497.277) [-494.692] (-494.614) * [-495.752] (-496.796) (-498.304) (-494.691) -- 0:00:18
703500 -- (-495.124) [-496.509] (-495.345) (-496.047) * (-494.297) [-495.499] (-494.280) (-493.824) -- 0:00:18
704000 -- (-496.239) (-498.038) (-495.091) [-494.434] * (-493.806) (-499.268) (-495.225) [-493.395] -- 0:00:18
704500 -- (-497.291) (-497.845) (-494.677) [-494.117] * (-496.337) (-501.296) [-495.168] (-494.555) -- 0:00:18
705000 -- (-498.690) (-494.156) (-494.298) [-495.076] * (-496.022) (-499.752) [-494.584] (-494.210) -- 0:00:18
Average standard deviation of split frequencies: 0.010391
705500 -- (-494.780) (-495.104) (-496.178) [-493.814] * [-495.952] (-496.268) (-495.422) (-493.751) -- 0:00:18
706000 -- (-495.965) (-495.459) [-501.693] (-496.452) * (-495.330) (-495.159) (-496.228) [-494.377] -- 0:00:18
706500 -- (-496.706) [-494.159] (-500.791) (-494.329) * [-494.590] (-496.887) (-496.840) (-495.233) -- 0:00:18
707000 -- (-495.817) (-494.046) [-495.359] (-499.621) * [-496.334] (-493.524) (-496.870) (-494.280) -- 0:00:18
707500 -- (-498.142) [-498.360] (-498.009) (-495.456) * [-495.082] (-494.613) (-494.633) (-495.345) -- 0:00:18
708000 -- (-497.259) [-496.541] (-494.225) (-496.738) * (-494.534) (-494.895) [-495.382] (-495.066) -- 0:00:18
708500 -- (-497.667) [-495.382] (-494.520) (-495.030) * [-494.104] (-494.545) (-494.832) (-498.263) -- 0:00:18
709000 -- (-499.936) (-496.756) (-493.890) [-494.005] * (-495.012) (-497.358) (-494.298) [-494.917] -- 0:00:18
709500 -- [-495.320] (-495.086) (-494.648) (-505.252) * [-493.900] (-503.469) (-494.335) (-496.243) -- 0:00:18
710000 -- (-497.282) (-495.703) (-496.489) [-494.307] * [-493.888] (-494.948) (-497.527) (-494.627) -- 0:00:17
Average standard deviation of split frequencies: 0.009618
710500 -- (-496.030) (-498.503) (-496.258) [-500.258] * [-494.900] (-494.848) (-493.357) (-494.640) -- 0:00:17
711000 -- (-497.874) (-502.023) (-497.175) [-494.382] * (-494.916) [-494.952] (-493.487) (-496.492) -- 0:00:17
711500 -- (-497.002) (-495.593) (-496.411) [-494.053] * [-494.470] (-494.032) (-498.241) (-497.768) -- 0:00:17
712000 -- [-497.140] (-494.416) (-494.714) (-498.751) * (-493.784) [-493.696] (-496.184) (-498.372) -- 0:00:17
712500 -- (-496.923) (-495.639) [-495.077] (-493.979) * (-495.263) (-495.904) (-496.699) [-494.878] -- 0:00:17
713000 -- [-497.884] (-495.413) (-495.426) (-493.696) * (-496.016) (-495.097) [-496.304] (-495.450) -- 0:00:17
713500 -- (-495.551) (-495.514) (-495.177) [-499.540] * [-497.005] (-496.389) (-497.697) (-493.390) -- 0:00:17
714000 -- (-495.225) (-494.191) (-498.391) [-497.812] * (-496.724) [-495.578] (-497.835) (-493.660) -- 0:00:17
714500 -- [-493.891] (-495.742) (-495.745) (-500.085) * [-494.195] (-494.230) (-494.133) (-494.501) -- 0:00:17
715000 -- (-495.862) (-496.163) [-493.764] (-495.746) * (-496.033) [-495.525] (-493.874) (-496.957) -- 0:00:17
Average standard deviation of split frequencies: 0.009752
715500 -- [-496.903] (-495.165) (-496.146) (-499.744) * (-504.417) [-493.818] (-498.108) (-496.103) -- 0:00:17
716000 -- (-498.904) [-494.849] (-496.562) (-497.896) * (-498.980) [-495.716] (-494.885) (-495.745) -- 0:00:17
716500 -- (-498.995) [-494.762] (-495.111) (-496.137) * (-495.594) (-495.424) [-493.494] (-494.190) -- 0:00:17
717000 -- (-494.660) [-496.129] (-497.106) (-497.129) * (-495.300) (-495.954) [-495.914] (-495.040) -- 0:00:17
717500 -- (-493.905) (-497.043) (-496.049) [-493.980] * (-496.116) (-493.956) [-496.298] (-493.460) -- 0:00:17
718000 -- (-494.412) [-497.151] (-495.056) (-494.275) * (-501.545) (-493.852) [-498.650] (-498.773) -- 0:00:17
718500 -- (-493.176) (-495.378) [-495.064] (-494.697) * (-495.983) (-493.704) [-499.859] (-500.061) -- 0:00:17
719000 -- (-495.856) [-493.254] (-493.623) (-495.620) * (-499.368) [-499.283] (-493.861) (-496.543) -- 0:00:17
719500 -- [-495.704] (-493.759) (-494.468) (-493.556) * [-498.467] (-493.984) (-494.647) (-497.517) -- 0:00:17
720000 -- (-498.134) [-495.105] (-497.598) (-493.551) * (-496.198) [-497.666] (-494.830) (-495.458) -- 0:00:17
Average standard deviation of split frequencies: 0.010030
720500 -- (-494.665) (-500.974) [-495.568] (-496.686) * (-495.542) (-494.138) [-493.728] (-494.868) -- 0:00:17
721000 -- (-494.673) [-495.042] (-496.064) (-498.421) * [-495.394] (-501.141) (-494.195) (-495.366) -- 0:00:17
721500 -- [-495.938] (-494.780) (-494.122) (-497.567) * (-496.814) (-496.141) [-494.536] (-497.350) -- 0:00:16
722000 -- (-495.675) [-500.440] (-495.110) (-497.611) * [-494.803] (-494.522) (-495.174) (-499.892) -- 0:00:17
722500 -- (-494.107) (-497.266) (-496.160) [-494.223] * (-503.078) (-499.520) [-499.791] (-494.589) -- 0:00:17
723000 -- (-493.700) [-495.664] (-495.177) (-494.438) * (-494.620) [-495.712] (-496.917) (-495.756) -- 0:00:17
723500 -- (-494.721) (-499.165) (-493.898) [-499.891] * (-493.779) (-498.549) (-496.128) [-494.309] -- 0:00:17
724000 -- [-495.018] (-496.825) (-497.709) (-495.121) * (-497.328) (-496.689) [-493.561] (-494.147) -- 0:00:17
724500 -- (-495.138) (-495.954) (-496.298) [-496.771] * [-495.659] (-496.560) (-498.163) (-493.645) -- 0:00:17
725000 -- (-495.169) (-502.382) (-493.936) [-494.693] * (-495.013) (-496.579) [-497.868] (-493.954) -- 0:00:17
Average standard deviation of split frequencies: 0.009699
725500 -- (-496.546) [-494.137] (-497.596) (-493.924) * (-494.289) (-495.498) [-498.068] (-496.645) -- 0:00:17
726000 -- (-494.630) (-497.677) (-494.582) [-494.253] * (-493.412) (-494.667) [-493.828] (-498.322) -- 0:00:16
726500 -- (-495.035) (-496.052) (-497.863) [-493.762] * [-493.278] (-494.427) (-494.794) (-496.319) -- 0:00:16
727000 -- [-495.113] (-497.585) (-498.001) (-494.940) * (-497.290) [-493.146] (-493.674) (-494.377) -- 0:00:16
727500 -- (-494.444) [-498.916] (-496.627) (-496.774) * (-496.339) [-494.443] (-493.868) (-495.549) -- 0:00:16
728000 -- (-494.952) (-496.648) (-496.388) [-499.504] * [-495.886] (-496.973) (-495.134) (-495.320) -- 0:00:16
728500 -- (-496.604) (-494.930) (-493.974) [-499.183] * (-494.325) [-496.616] (-494.665) (-502.393) -- 0:00:16
729000 -- (-500.053) [-498.216] (-496.664) (-494.807) * [-494.274] (-498.507) (-495.207) (-498.628) -- 0:00:16
729500 -- (-495.542) (-496.967) [-494.330] (-494.008) * (-494.702) (-496.562) (-495.180) [-494.062] -- 0:00:16
730000 -- (-495.120) (-497.085) [-495.287] (-500.584) * (-494.928) (-498.816) [-495.278] (-496.197) -- 0:00:16
Average standard deviation of split frequencies: 0.010081
730500 -- [-494.158] (-496.977) (-498.981) (-495.100) * (-494.570) (-497.529) [-498.710] (-493.322) -- 0:00:16
731000 -- (-498.791) (-496.761) (-497.428) [-502.606] * [-497.452] (-494.364) (-496.675) (-495.406) -- 0:00:16
731500 -- (-500.133) (-494.583) [-494.863] (-497.836) * [-496.549] (-496.644) (-493.901) (-493.729) -- 0:00:16
732000 -- [-496.060] (-497.521) (-496.696) (-494.356) * (-494.469) [-493.942] (-495.132) (-494.082) -- 0:00:16
732500 -- (-494.112) [-494.196] (-494.769) (-494.282) * (-497.828) (-502.210) [-494.190] (-493.812) -- 0:00:16
733000 -- [-494.544] (-496.914) (-495.626) (-493.408) * (-493.244) [-495.632] (-494.461) (-496.900) -- 0:00:16
733500 -- [-495.734] (-497.254) (-493.894) (-496.075) * (-495.668) (-497.303) [-495.642] (-497.504) -- 0:00:16
734000 -- [-495.507] (-496.195) (-494.694) (-495.425) * [-496.056] (-497.291) (-493.667) (-497.569) -- 0:00:16
734500 -- (-499.481) (-496.273) (-494.738) [-494.379] * (-495.009) [-497.628] (-493.728) (-496.092) -- 0:00:16
735000 -- (-495.014) (-494.185) [-494.427] (-497.897) * [-495.171] (-500.899) (-494.432) (-495.420) -- 0:00:16
Average standard deviation of split frequencies: 0.010376
735500 -- [-494.828] (-495.954) (-493.270) (-498.120) * [-494.673] (-497.577) (-495.364) (-497.389) -- 0:00:16
736000 -- [-495.312] (-496.497) (-494.321) (-496.808) * (-495.428) (-498.744) [-493.870] (-497.099) -- 0:00:16
736500 -- [-494.483] (-496.104) (-496.575) (-494.162) * [-495.211] (-496.344) (-495.537) (-494.286) -- 0:00:16
737000 -- (-493.613) (-495.513) (-493.676) [-494.386] * (-498.997) [-494.625] (-495.675) (-494.600) -- 0:00:16
737500 -- (-495.283) (-497.482) [-494.757] (-495.958) * (-495.527) [-496.114] (-496.916) (-495.320) -- 0:00:16
738000 -- (-495.980) (-495.890) [-494.876] (-495.017) * (-494.600) [-495.814] (-497.057) (-494.605) -- 0:00:15
738500 -- [-494.101] (-494.126) (-496.284) (-494.482) * (-493.787) [-493.519] (-494.810) (-495.261) -- 0:00:15
739000 -- (-497.529) (-499.276) (-494.452) [-499.051] * (-496.348) (-494.127) (-496.326) [-493.785] -- 0:00:16
739500 -- (-497.756) [-497.099] (-500.043) (-494.456) * [-494.909] (-495.703) (-494.850) (-495.902) -- 0:00:16
740000 -- (-498.203) [-495.748] (-497.825) (-496.543) * (-499.755) [-496.796] (-496.756) (-493.933) -- 0:00:16
Average standard deviation of split frequencies: 0.010820
740500 -- (-496.913) (-495.066) [-500.097] (-496.957) * (-498.822) (-498.588) [-495.844] (-495.350) -- 0:00:16
741000 -- (-497.131) [-495.040] (-498.005) (-494.927) * (-499.327) (-495.858) [-497.385] (-498.001) -- 0:00:16
741500 -- (-496.383) [-496.008] (-499.472) (-493.253) * [-495.249] (-493.594) (-495.260) (-497.182) -- 0:00:16
742000 -- (-497.572) (-495.152) [-496.416] (-496.039) * (-495.580) [-494.696] (-495.270) (-498.297) -- 0:00:15
742500 -- (-493.652) (-496.822) (-495.496) [-496.037] * (-495.795) (-494.356) (-495.526) [-496.589] -- 0:00:15
743000 -- (-494.910) [-496.460] (-502.781) (-495.024) * (-494.213) [-493.515] (-498.579) (-496.883) -- 0:00:15
743500 -- (-495.433) [-497.026] (-497.328) (-494.246) * (-495.183) (-497.544) [-494.974] (-497.713) -- 0:00:15
744000 -- [-496.439] (-494.109) (-494.702) (-494.200) * (-496.353) (-495.011) [-495.783] (-495.767) -- 0:00:15
744500 -- (-500.015) (-494.028) (-494.436) [-496.064] * (-493.789) (-496.084) (-494.470) [-495.038] -- 0:00:15
745000 -- (-495.570) (-498.479) [-495.184] (-496.378) * (-494.649) (-500.051) [-493.999] (-495.964) -- 0:00:15
Average standard deviation of split frequencies: 0.010387
745500 -- (-495.818) [-495.766] (-497.153) (-496.037) * [-494.245] (-494.713) (-495.847) (-496.797) -- 0:00:15
746000 -- (-493.834) (-500.212) [-501.269] (-494.181) * (-495.287) (-496.489) (-495.921) [-500.049] -- 0:00:15
746500 -- [-494.615] (-503.085) (-499.667) (-495.171) * (-497.102) [-493.899] (-494.963) (-495.065) -- 0:00:15
747000 -- (-494.819) [-493.595] (-507.093) (-494.731) * (-495.637) (-493.820) [-494.337] (-499.105) -- 0:00:15
747500 -- (-494.020) (-496.296) [-494.130] (-498.632) * [-495.477] (-494.608) (-493.828) (-499.254) -- 0:00:15
748000 -- (-495.224) (-494.253) [-495.894] (-494.217) * [-498.729] (-495.180) (-494.931) (-501.712) -- 0:00:15
748500 -- (-497.757) [-496.301] (-494.641) (-497.000) * (-501.701) (-496.243) (-500.044) [-497.544] -- 0:00:15
749000 -- (-495.387) [-495.037] (-498.345) (-496.379) * [-498.988] (-497.515) (-495.773) (-496.699) -- 0:00:15
749500 -- (-493.714) (-494.694) (-496.506) [-495.563] * (-495.619) (-497.195) (-493.854) [-495.412] -- 0:00:15
750000 -- (-494.763) (-497.820) [-494.054] (-496.314) * (-495.395) (-499.325) [-499.545] (-493.842) -- 0:00:15
Average standard deviation of split frequencies: 0.010634
750500 -- (-497.036) [-496.240] (-494.588) (-494.905) * (-497.301) (-497.777) (-495.465) [-495.419] -- 0:00:15
751000 -- (-495.942) (-494.762) (-494.775) [-497.197] * (-494.707) (-496.692) [-497.269] (-496.264) -- 0:00:15
751500 -- (-494.005) [-494.608] (-494.726) (-495.586) * (-495.450) [-496.368] (-496.765) (-493.596) -- 0:00:15
752000 -- (-494.923) (-493.848) (-494.152) [-495.733] * [-496.413] (-495.705) (-497.651) (-493.297) -- 0:00:15
752500 -- (-496.971) (-497.407) (-496.436) [-495.762] * (-496.966) [-497.566] (-496.394) (-498.469) -- 0:00:15
753000 -- (-498.261) (-497.217) (-494.434) [-493.788] * (-497.492) (-498.251) [-493.651] (-495.112) -- 0:00:15
753500 -- (-495.321) [-495.294] (-496.156) (-494.718) * (-495.651) (-499.553) [-494.889] (-495.851) -- 0:00:15
754000 -- (-498.889) [-497.212] (-493.268) (-494.571) * (-496.673) (-494.255) (-497.879) [-495.083] -- 0:00:15
754500 -- (-496.102) (-496.618) [-495.356] (-493.556) * [-494.394] (-497.711) (-498.185) (-494.983) -- 0:00:14
755000 -- (-497.205) (-495.705) (-500.778) [-494.484] * [-495.290] (-495.579) (-494.312) (-495.189) -- 0:00:14
Average standard deviation of split frequencies: 0.010850
755500 -- (-494.985) (-495.514) (-498.533) [-494.086] * (-495.720) [-495.230] (-495.451) (-496.608) -- 0:00:14
756000 -- (-494.347) (-496.227) [-495.183] (-495.836) * (-495.977) [-495.315] (-494.755) (-497.707) -- 0:00:15
756500 -- (-500.306) (-496.823) [-498.647] (-495.408) * (-497.266) [-495.418] (-495.655) (-495.819) -- 0:00:15
757000 -- (-496.621) (-494.272) (-495.265) [-496.217] * (-495.875) [-495.949] (-496.871) (-494.438) -- 0:00:15
757500 -- (-499.538) [-493.708] (-495.551) (-494.071) * [-496.082] (-495.740) (-495.962) (-500.327) -- 0:00:15
758000 -- (-498.621) (-494.651) (-497.303) [-495.352] * [-495.408] (-497.554) (-495.494) (-499.960) -- 0:00:15
758500 -- (-495.408) [-496.346] (-499.058) (-494.392) * (-498.482) [-496.432] (-494.710) (-496.045) -- 0:00:14
759000 -- (-495.064) [-494.105] (-495.433) (-494.233) * (-494.280) (-496.780) [-494.357] (-493.808) -- 0:00:14
759500 -- (-496.847) (-501.052) (-502.018) [-495.119] * [-495.935] (-498.615) (-494.783) (-493.788) -- 0:00:14
760000 -- (-494.127) [-496.012] (-495.808) (-494.633) * (-499.162) [-495.357] (-494.355) (-494.175) -- 0:00:14
Average standard deviation of split frequencies: 0.010453
760500 -- (-497.712) (-493.211) [-494.831] (-496.952) * (-498.407) (-495.035) (-494.443) [-493.966] -- 0:00:14
761000 -- [-495.809] (-496.907) (-495.435) (-501.116) * [-502.179] (-494.534) (-494.173) (-494.942) -- 0:00:14
761500 -- (-499.750) [-494.750] (-494.002) (-494.927) * (-494.646) (-494.856) [-494.209] (-495.133) -- 0:00:14
762000 -- (-504.166) [-494.137] (-494.011) (-494.557) * (-496.091) [-494.189] (-496.498) (-495.506) -- 0:00:14
762500 -- (-494.782) (-495.585) (-497.271) [-495.547] * [-496.415] (-494.503) (-497.168) (-494.054) -- 0:00:14
763000 -- (-495.002) [-495.225] (-495.627) (-494.343) * (-502.561) [-494.182] (-493.837) (-494.886) -- 0:00:14
763500 -- [-494.406] (-494.868) (-497.611) (-497.471) * (-495.436) [-495.719] (-496.080) (-497.964) -- 0:00:14
764000 -- (-494.523) (-494.206) [-494.382] (-497.217) * (-493.759) (-497.845) [-498.538] (-493.758) -- 0:00:14
764500 -- (-495.142) [-497.028] (-498.702) (-498.910) * (-495.555) [-495.471] (-498.371) (-495.503) -- 0:00:14
765000 -- (-494.834) (-497.298) (-497.775) [-497.399] * (-494.686) (-496.581) (-495.483) [-496.090] -- 0:00:14
Average standard deviation of split frequencies: 0.010052
765500 -- (-494.424) (-495.854) (-501.206) [-496.678] * (-493.973) (-495.743) (-500.052) [-499.603] -- 0:00:14
766000 -- (-494.133) [-495.641] (-499.013) (-494.707) * (-494.981) (-497.208) [-497.171] (-496.380) -- 0:00:14
766500 -- (-495.282) (-495.004) [-495.040] (-496.036) * (-495.727) [-494.657] (-497.695) (-496.244) -- 0:00:14
767000 -- [-494.825] (-494.177) (-495.111) (-496.774) * [-493.941] (-494.841) (-493.982) (-496.849) -- 0:00:14
767500 -- [-495.029] (-499.428) (-495.112) (-500.291) * [-495.186] (-494.372) (-495.599) (-496.421) -- 0:00:14
768000 -- (-495.198) [-497.475] (-494.061) (-496.837) * (-493.818) (-495.390) [-494.730] (-495.679) -- 0:00:14
768500 -- (-494.774) (-494.775) (-494.832) [-493.936] * (-495.551) (-494.591) (-495.959) [-495.115] -- 0:00:14
769000 -- (-502.202) [-496.149] (-496.206) (-494.759) * (-496.276) (-493.401) (-495.479) [-494.477] -- 0:00:14
769500 -- (-499.497) (-496.852) [-495.440] (-494.835) * (-493.984) (-493.306) (-494.071) [-494.127] -- 0:00:14
770000 -- (-494.680) (-494.309) [-495.263] (-493.825) * (-494.512) (-494.272) (-495.618) [-494.199] -- 0:00:14
Average standard deviation of split frequencies: 0.009298
770500 -- (-496.272) [-495.701] (-495.911) (-498.606) * (-494.194) (-494.338) (-497.314) [-495.230] -- 0:00:13
771000 -- (-493.530) (-495.214) [-499.203] (-494.929) * (-502.114) [-495.457] (-496.623) (-496.665) -- 0:00:13
771500 -- [-494.658] (-496.351) (-494.176) (-497.547) * (-495.675) (-493.894) (-495.725) [-496.800] -- 0:00:13
772000 -- (-499.083) (-494.711) (-494.976) [-496.599] * (-496.224) [-494.254] (-496.365) (-496.543) -- 0:00:13
772500 -- (-498.174) [-494.483] (-495.817) (-495.888) * (-496.782) (-498.351) (-495.985) [-494.528] -- 0:00:13
773000 -- [-498.397] (-497.206) (-493.879) (-494.142) * [-493.941] (-495.279) (-496.545) (-495.457) -- 0:00:14
773500 -- [-497.116] (-495.450) (-494.694) (-495.572) * (-497.324) (-494.103) [-496.579] (-496.041) -- 0:00:14
774000 -- (-496.550) [-495.285] (-496.252) (-494.867) * (-496.244) (-494.839) (-497.660) [-493.703] -- 0:00:14
774500 -- (-495.681) [-494.611] (-497.870) (-493.677) * (-495.167) (-499.637) (-496.137) [-495.339] -- 0:00:13
775000 -- (-496.032) (-493.910) [-494.631] (-498.398) * (-495.766) [-493.834] (-497.597) (-500.288) -- 0:00:13
Average standard deviation of split frequencies: 0.009477
775500 -- (-496.153) (-493.428) (-496.625) [-494.100] * [-493.792] (-493.525) (-493.552) (-497.909) -- 0:00:13
776000 -- (-497.272) (-495.249) (-494.619) [-494.356] * (-496.782) [-494.193] (-495.026) (-493.891) -- 0:00:13
776500 -- [-497.428] (-497.625) (-496.152) (-495.483) * [-493.214] (-500.136) (-500.154) (-494.966) -- 0:00:13
777000 -- (-496.677) (-499.288) (-495.493) [-495.498] * (-495.129) (-498.089) (-497.613) [-495.463] -- 0:00:13
777500 -- (-494.318) (-495.047) [-496.431] (-494.382) * [-493.905] (-494.700) (-496.241) (-497.040) -- 0:00:13
778000 -- (-494.267) (-496.414) [-493.684] (-503.408) * [-494.101] (-496.400) (-494.204) (-496.131) -- 0:00:13
778500 -- [-495.978] (-494.854) (-496.737) (-496.056) * (-496.382) (-496.680) [-493.466] (-495.944) -- 0:00:13
779000 -- (-496.737) [-494.741] (-495.741) (-495.410) * (-497.161) (-496.541) [-493.533] (-499.751) -- 0:00:13
779500 -- (-495.054) [-495.266] (-501.639) (-495.088) * [-494.438] (-497.052) (-495.026) (-495.477) -- 0:00:13
780000 -- [-495.965] (-495.477) (-497.012) (-496.088) * (-493.943) (-497.558) (-497.581) [-496.989] -- 0:00:13
Average standard deviation of split frequencies: 0.009903
780500 -- [-496.603] (-505.616) (-500.736) (-494.054) * [-497.458] (-495.954) (-494.194) (-499.295) -- 0:00:13
781000 -- (-500.099) [-494.207] (-495.317) (-494.136) * (-498.258) (-493.999) [-495.452] (-494.689) -- 0:00:13
781500 -- [-498.198] (-495.530) (-495.670) (-495.809) * (-502.119) (-495.221) (-497.899) [-494.896] -- 0:00:13
782000 -- (-494.502) [-495.687] (-496.901) (-497.861) * (-495.320) (-495.217) [-498.191] (-496.921) -- 0:00:13
782500 -- [-494.078] (-495.345) (-494.758) (-498.779) * (-494.729) [-495.583] (-498.632) (-496.657) -- 0:00:13
783000 -- (-494.769) (-496.891) [-494.529] (-497.824) * (-494.543) (-497.783) (-495.752) [-497.063] -- 0:00:13
783500 -- (-497.241) (-497.033) (-495.328) [-494.281] * (-499.630) [-495.634] (-494.881) (-495.446) -- 0:00:13
784000 -- (-502.570) (-497.386) (-494.930) [-495.456] * [-495.250] (-495.288) (-499.043) (-495.391) -- 0:00:13
784500 -- (-494.354) [-493.784] (-494.325) (-495.321) * (-498.340) (-495.123) [-498.423] (-495.707) -- 0:00:13
785000 -- (-493.143) (-494.057) (-494.996) [-496.049] * (-496.870) [-495.273] (-496.816) (-495.692) -- 0:00:13
Average standard deviation of split frequencies: 0.009556
785500 -- (-494.218) (-495.485) (-497.868) [-501.060] * [-494.076] (-496.942) (-495.202) (-496.661) -- 0:00:13
786000 -- (-497.335) [-494.314] (-495.331) (-501.173) * (-493.717) (-500.073) [-493.790] (-497.029) -- 0:00:13
786500 -- (-499.365) [-495.020] (-497.096) (-496.182) * (-496.751) (-495.326) (-495.265) [-495.450] -- 0:00:13
787000 -- (-495.921) [-496.590] (-497.299) (-494.120) * (-497.179) (-496.392) (-495.352) [-495.479] -- 0:00:12
787500 -- [-493.492] (-497.480) (-501.341) (-493.352) * (-494.019) (-496.120) (-495.749) [-495.634] -- 0:00:12
788000 -- (-493.509) (-495.153) (-497.388) [-494.497] * [-495.970] (-495.143) (-495.446) (-496.282) -- 0:00:12
788500 -- [-494.655] (-497.960) (-493.937) (-494.461) * (-496.507) [-494.418] (-495.906) (-494.350) -- 0:00:12
789000 -- (-493.287) [-494.374] (-496.237) (-498.355) * (-493.850) [-493.939] (-496.711) (-494.562) -- 0:00:12
789500 -- (-496.299) [-496.308] (-496.355) (-496.112) * [-494.929] (-497.731) (-501.025) (-496.368) -- 0:00:12
790000 -- [-495.191] (-495.941) (-495.369) (-495.838) * (-497.915) (-494.006) (-496.112) [-494.076] -- 0:00:13
Average standard deviation of split frequencies: 0.009341
790500 -- (-497.656) (-495.936) (-495.381) [-499.298] * [-494.669] (-495.127) (-493.566) (-498.219) -- 0:00:12
791000 -- (-495.504) (-496.007) [-495.194] (-499.232) * (-495.706) (-494.029) [-494.475] (-497.099) -- 0:00:12
791500 -- (-495.766) [-497.313] (-495.578) (-496.826) * [-494.194] (-494.606) (-496.287) (-495.417) -- 0:00:12
792000 -- (-495.386) (-497.934) (-497.970) [-498.385] * (-494.391) (-500.803) [-495.398] (-496.830) -- 0:00:12
792500 -- [-495.403] (-494.522) (-494.378) (-496.642) * (-496.684) [-494.706] (-495.422) (-496.257) -- 0:00:12
793000 -- (-493.703) (-495.236) [-494.877] (-494.482) * [-494.982] (-496.355) (-494.242) (-496.788) -- 0:00:12
793500 -- (-493.311) (-495.940) (-495.956) [-495.026] * (-495.103) [-496.013] (-493.845) (-498.533) -- 0:00:12
794000 -- (-493.808) [-495.923] (-496.143) (-494.116) * [-495.235] (-494.066) (-495.029) (-494.600) -- 0:00:12
794500 -- (-501.371) [-494.075] (-494.584) (-495.342) * (-493.943) (-496.635) [-495.069] (-494.511) -- 0:00:12
795000 -- (-496.179) [-494.833] (-495.200) (-494.997) * [-498.659] (-494.429) (-493.986) (-494.939) -- 0:00:12
Average standard deviation of split frequencies: 0.009752
795500 -- (-497.171) (-495.439) [-493.980] (-496.569) * (-497.876) (-493.810) [-495.846] (-494.985) -- 0:00:12
796000 -- [-496.746] (-497.532) (-496.024) (-498.934) * (-496.990) (-497.037) (-497.020) [-494.778] -- 0:00:12
796500 -- (-495.272) (-497.770) [-496.149] (-495.263) * (-494.591) [-494.556] (-494.439) (-500.253) -- 0:00:12
797000 -- [-494.885] (-494.364) (-496.255) (-494.068) * (-495.565) [-495.955] (-495.884) (-493.521) -- 0:00:12
797500 -- (-496.913) [-495.560] (-495.109) (-496.696) * (-497.814) (-493.578) (-494.096) [-494.148] -- 0:00:12
798000 -- (-495.268) [-494.212] (-495.126) (-498.443) * (-494.902) [-494.383] (-494.435) (-498.295) -- 0:00:12
798500 -- (-495.480) (-493.451) (-494.348) [-495.825] * (-495.189) [-494.760] (-496.319) (-494.329) -- 0:00:12
799000 -- (-496.550) (-495.526) [-496.246] (-497.747) * (-493.185) (-494.714) [-496.742] (-494.981) -- 0:00:12
799500 -- [-493.824] (-497.798) (-495.856) (-496.270) * (-500.231) (-495.084) [-499.291] (-494.529) -- 0:00:12
800000 -- [-496.325] (-497.838) (-495.564) (-494.314) * (-495.531) [-494.899] (-495.385) (-496.666) -- 0:00:12
Average standard deviation of split frequencies: 0.009678
800500 -- (-496.757) [-495.844] (-502.087) (-494.498) * (-494.471) (-498.423) (-494.845) [-493.527] -- 0:00:12
801000 -- (-494.338) (-496.188) [-495.745] (-494.754) * (-495.691) [-497.146] (-494.162) (-494.135) -- 0:00:12
801500 -- (-494.598) (-495.248) (-496.027) [-493.988] * (-496.690) (-494.774) [-494.420] (-494.269) -- 0:00:12
802000 -- (-497.606) (-498.592) (-497.569) [-493.499] * (-496.052) [-496.881] (-494.888) (-494.720) -- 0:00:12
802500 -- (-495.260) (-495.194) [-497.172] (-499.819) * [-494.153] (-499.545) (-496.414) (-494.135) -- 0:00:12
803000 -- [-494.744] (-494.656) (-496.244) (-494.531) * [-494.228] (-504.090) (-496.594) (-495.497) -- 0:00:12
803500 -- (-494.611) (-496.910) (-497.723) [-494.696] * (-494.056) (-501.155) (-499.901) [-496.530] -- 0:00:11
804000 -- [-495.001] (-494.524) (-493.581) (-497.866) * [-496.331] (-495.801) (-495.368) (-494.498) -- 0:00:11
804500 -- (-493.493) [-493.444] (-497.059) (-494.743) * (-498.096) (-495.481) (-496.927) [-494.751] -- 0:00:11
805000 -- (-495.134) (-494.868) (-495.918) [-494.424] * (-501.064) (-497.130) [-495.025] (-499.149) -- 0:00:11
Average standard deviation of split frequencies: 0.009394
805500 -- [-494.766] (-496.500) (-494.467) (-495.379) * (-501.414) [-498.901] (-494.459) (-494.574) -- 0:00:11
806000 -- (-495.831) (-496.293) [-493.245] (-495.653) * [-494.786] (-494.254) (-494.765) (-495.011) -- 0:00:11
806500 -- (-497.399) [-496.817] (-493.570) (-494.624) * (-494.922) (-495.368) [-494.203] (-497.463) -- 0:00:11
807000 -- [-493.542] (-496.289) (-496.011) (-495.885) * [-495.557] (-494.279) (-497.235) (-494.885) -- 0:00:11
807500 -- [-495.627] (-493.453) (-497.554) (-494.713) * (-494.902) (-493.848) [-495.605] (-499.430) -- 0:00:11
808000 -- (-499.299) (-500.657) (-495.182) [-494.943] * (-495.538) [-494.335] (-497.066) (-500.273) -- 0:00:11
808500 -- (-494.285) (-496.907) (-496.370) [-496.102] * [-494.136] (-493.922) (-497.622) (-496.993) -- 0:00:11
809000 -- (-496.261) (-498.796) (-497.610) [-495.821] * (-495.067) (-493.739) [-496.652] (-499.928) -- 0:00:11
809500 -- (-493.648) (-493.539) (-497.580) [-495.957] * (-495.879) (-496.877) [-496.569] (-494.659) -- 0:00:11
810000 -- (-494.455) (-495.106) [-494.438] (-495.470) * (-501.230) (-495.250) (-498.171) [-498.597] -- 0:00:11
Average standard deviation of split frequencies: 0.009777
810500 -- (-499.100) [-494.419] (-495.606) (-502.531) * (-495.892) [-494.296] (-496.177) (-499.324) -- 0:00:11
811000 -- [-497.257] (-497.469) (-495.346) (-494.552) * (-495.510) [-494.188] (-497.156) (-494.411) -- 0:00:11
811500 -- [-496.403] (-496.777) (-495.119) (-495.545) * (-493.743) [-496.640] (-493.686) (-493.670) -- 0:00:11
812000 -- (-494.346) (-494.872) [-494.781] (-494.693) * (-494.807) (-497.310) (-496.645) [-497.315] -- 0:00:11
812500 -- (-497.682) [-495.181] (-495.183) (-496.504) * (-495.346) (-495.793) (-494.081) [-498.746] -- 0:00:11
813000 -- (-495.313) [-494.530] (-497.183) (-494.675) * [-494.304] (-495.634) (-495.873) (-496.402) -- 0:00:11
813500 -- (-496.870) (-498.263) (-499.330) [-493.675] * [-494.878] (-495.979) (-496.497) (-498.077) -- 0:00:11
814000 -- (-494.144) (-496.838) [-495.328] (-493.488) * [-496.338] (-499.644) (-495.118) (-495.396) -- 0:00:11
814500 -- (-494.344) [-494.025] (-496.999) (-495.256) * [-494.252] (-494.574) (-498.976) (-496.012) -- 0:00:11
815000 -- (-494.344) (-495.757) (-495.283) [-494.219] * (-496.408) (-499.695) [-493.878] (-496.196) -- 0:00:11
Average standard deviation of split frequencies: 0.010146
815500 -- (-496.026) (-494.634) (-493.559) [-496.627] * (-494.600) (-496.556) (-494.819) [-494.461] -- 0:00:11
816000 -- [-495.841] (-495.035) (-494.254) (-495.996) * (-496.624) (-494.812) [-493.919] (-497.630) -- 0:00:11
816500 -- (-496.541) (-495.375) [-493.753] (-494.092) * (-497.574) (-494.387) [-494.081] (-497.972) -- 0:00:11
817000 -- (-495.043) (-499.989) (-495.206) [-494.243] * [-496.513] (-496.430) (-495.792) (-496.577) -- 0:00:11
817500 -- [-494.758] (-493.293) (-496.685) (-493.525) * (-495.364) (-496.079) [-495.429] (-494.088) -- 0:00:11
818000 -- (-498.946) (-493.515) [-496.227] (-494.948) * [-494.259] (-494.931) (-495.122) (-495.879) -- 0:00:11
818500 -- [-495.971] (-495.684) (-494.257) (-494.741) * (-494.184) [-497.409] (-497.025) (-495.781) -- 0:00:11
819000 -- (-497.173) (-496.118) (-493.671) [-495.549] * (-493.985) (-494.255) [-494.893] (-494.299) -- 0:00:11
819500 -- (-497.670) [-495.066] (-496.737) (-495.043) * (-494.395) (-498.505) [-494.326] (-493.402) -- 0:00:11
820000 -- (-496.716) (-495.840) (-494.108) [-496.831] * (-501.381) (-500.405) (-494.732) [-493.772] -- 0:00:10
Average standard deviation of split frequencies: 0.010531
820500 -- (-494.514) (-494.448) (-493.690) [-498.643] * (-496.386) (-495.463) [-494.858] (-494.089) -- 0:00:10
821000 -- (-493.844) (-495.105) [-498.202] (-496.079) * [-494.885] (-494.942) (-495.598) (-493.825) -- 0:00:10
821500 -- (-496.838) [-496.383] (-499.230) (-496.656) * [-494.576] (-495.561) (-494.278) (-498.955) -- 0:00:10
822000 -- (-495.948) (-499.053) (-499.225) [-494.123] * (-493.200) (-495.930) (-497.281) [-495.432] -- 0:00:10
822500 -- (-495.118) (-497.868) [-500.412] (-496.012) * [-494.393] (-498.485) (-494.771) (-493.511) -- 0:00:10
823000 -- [-495.292] (-495.248) (-495.903) (-494.776) * [-495.423] (-495.252) (-494.302) (-495.041) -- 0:00:10
823500 -- (-494.763) (-493.661) (-493.845) [-499.206] * (-495.739) [-493.919] (-494.910) (-494.610) -- 0:00:10
824000 -- [-496.547] (-494.468) (-495.084) (-494.239) * (-495.138) [-494.787] (-498.378) (-495.179) -- 0:00:10
824500 -- (-497.082) (-493.747) (-495.558) [-496.146] * (-494.566) (-494.112) [-495.417] (-500.590) -- 0:00:10
825000 -- (-497.774) (-494.774) [-496.203] (-499.913) * [-494.484] (-495.121) (-494.009) (-493.805) -- 0:00:10
Average standard deviation of split frequencies: 0.010425
825500 -- (-493.909) (-496.374) (-498.456) [-497.124] * (-498.910) (-499.704) (-493.941) [-495.041] -- 0:00:10
826000 -- (-495.863) (-494.362) [-497.734] (-494.417) * (-495.163) [-494.250] (-495.610) (-494.172) -- 0:00:10
826500 -- (-495.800) (-497.286) (-496.211) [-494.777] * (-496.684) (-493.426) [-498.306] (-496.535) -- 0:00:10
827000 -- (-499.283) (-499.648) [-494.174] (-494.511) * (-494.826) (-494.744) [-494.990] (-494.288) -- 0:00:10
827500 -- (-495.463) (-498.879) [-496.276] (-498.548) * (-494.452) (-498.421) [-494.144] (-495.275) -- 0:00:10
828000 -- (-500.049) (-498.179) [-493.929] (-499.287) * (-496.269) [-495.994] (-495.951) (-496.983) -- 0:00:10
828500 -- (-493.777) (-495.300) [-496.056] (-497.747) * (-495.612) (-494.181) (-495.092) [-496.309] -- 0:00:10
829000 -- (-494.401) (-494.269) (-495.029) [-493.584] * (-494.872) (-493.743) [-495.548] (-494.242) -- 0:00:10
829500 -- [-495.983] (-494.319) (-495.206) (-494.459) * (-493.756) (-493.546) [-494.063] (-496.874) -- 0:00:10
830000 -- (-495.231) (-496.414) (-498.173) [-493.810] * (-494.100) (-497.811) [-494.504] (-493.947) -- 0:00:10
Average standard deviation of split frequencies: 0.010480
830500 -- (-495.625) (-496.723) (-495.853) [-495.114] * [-494.263] (-493.852) (-493.696) (-493.808) -- 0:00:10
831000 -- (-495.738) [-495.032] (-495.862) (-494.176) * (-496.144) (-494.534) (-496.142) [-494.072] -- 0:00:10
831500 -- (-495.666) [-495.858] (-499.357) (-494.836) * (-495.431) (-497.094) [-497.179] (-494.893) -- 0:00:10
832000 -- [-498.731] (-495.545) (-498.750) (-496.181) * (-494.079) [-496.398] (-493.624) (-501.953) -- 0:00:10
832500 -- (-497.259) (-495.612) (-495.779) [-494.716] * (-495.074) [-493.895] (-500.255) (-495.752) -- 0:00:10
833000 -- (-494.712) (-493.566) (-494.680) [-495.960] * (-496.745) [-493.488] (-494.722) (-495.162) -- 0:00:10
833500 -- (-496.056) (-495.073) [-494.264] (-498.056) * [-495.892] (-493.502) (-494.831) (-495.312) -- 0:00:10
834000 -- [-496.272] (-498.812) (-497.966) (-495.542) * [-495.238] (-493.441) (-495.273) (-496.923) -- 0:00:10
834500 -- (-496.891) [-497.360] (-500.365) (-495.174) * (-497.085) (-493.444) [-494.784] (-495.613) -- 0:00:10
835000 -- (-494.819) (-495.607) [-495.497] (-495.699) * (-498.449) (-495.084) [-493.905] (-494.780) -- 0:00:10
Average standard deviation of split frequencies: 0.010789
835500 -- (-499.092) [-495.441] (-497.195) (-498.345) * (-504.180) [-497.894] (-495.615) (-494.148) -- 0:00:10
836000 -- (-495.935) [-496.068] (-502.078) (-497.601) * (-497.077) (-494.330) (-494.580) [-494.828] -- 0:00:10
836500 -- [-496.480] (-496.924) (-498.010) (-495.814) * (-495.476) (-496.738) [-496.529] (-494.857) -- 0:00:09
837000 -- (-495.168) (-495.631) [-494.834] (-496.735) * (-496.107) (-496.631) (-497.056) [-495.247] -- 0:00:09
837500 -- [-495.647] (-496.842) (-495.919) (-499.566) * (-494.331) (-497.670) (-494.738) [-493.621] -- 0:00:09
838000 -- [-497.427] (-493.360) (-495.635) (-496.736) * (-495.410) [-496.239] (-498.627) (-496.700) -- 0:00:09
838500 -- (-495.749) (-497.240) (-495.145) [-494.548] * (-495.282) (-497.487) [-493.949] (-496.010) -- 0:00:09
839000 -- (-494.139) (-495.254) (-495.336) [-495.709] * (-496.552) (-495.531) (-493.808) [-497.316] -- 0:00:09
839500 -- [-495.157] (-497.685) (-494.432) (-494.322) * (-498.375) [-495.429] (-497.813) (-494.292) -- 0:00:09
840000 -- [-494.896] (-495.448) (-496.992) (-494.987) * (-503.910) (-494.387) (-496.525) [-493.297] -- 0:00:09
Average standard deviation of split frequencies: 0.010549
840500 -- (-493.935) [-497.682] (-495.634) (-494.176) * [-494.642] (-493.622) (-494.414) (-496.297) -- 0:00:09
841000 -- (-494.628) (-499.564) [-493.917] (-494.866) * [-503.155] (-494.732) (-496.914) (-497.650) -- 0:00:09
841500 -- (-494.098) (-497.135) (-494.606) [-495.116] * (-495.150) [-496.949] (-495.833) (-495.107) -- 0:00:09
842000 -- (-494.039) (-496.990) (-499.191) [-496.726] * (-496.015) (-496.586) [-498.719] (-494.490) -- 0:00:09
842500 -- (-493.613) [-496.401] (-494.692) (-495.713) * (-497.217) (-495.960) [-496.326] (-495.815) -- 0:00:09
843000 -- [-495.502] (-494.975) (-495.841) (-498.430) * (-495.430) (-495.929) [-496.511] (-496.451) -- 0:00:09
843500 -- (-495.563) [-495.231] (-494.173) (-495.194) * (-498.598) (-498.988) (-494.353) [-500.899] -- 0:00:09
844000 -- (-495.907) (-496.369) [-495.555] (-496.676) * (-496.214) [-494.494] (-496.274) (-498.228) -- 0:00:09
844500 -- [-495.341] (-495.007) (-497.047) (-497.436) * [-496.156] (-495.265) (-494.425) (-494.610) -- 0:00:09
845000 -- (-494.799) [-494.037] (-495.542) (-496.375) * (-498.664) [-496.317] (-497.712) (-498.684) -- 0:00:09
Average standard deviation of split frequencies: 0.010692
845500 -- [-495.585] (-494.957) (-494.476) (-496.749) * (-496.570) [-501.862] (-497.568) (-497.842) -- 0:00:09
846000 -- (-496.552) [-497.729] (-494.187) (-496.168) * (-497.599) (-500.227) [-495.746] (-495.690) -- 0:00:09
846500 -- (-493.962) (-499.245) [-503.702] (-497.593) * [-495.509] (-495.123) (-495.321) (-498.680) -- 0:00:09
847000 -- [-494.250] (-494.995) (-502.714) (-500.406) * [-493.978] (-496.213) (-500.350) (-499.581) -- 0:00:09
847500 -- (-496.824) [-496.989] (-506.490) (-497.165) * (-496.584) (-495.828) (-495.759) [-495.285] -- 0:00:09
848000 -- [-497.978] (-499.016) (-493.919) (-500.942) * (-495.631) (-495.806) (-494.745) [-495.789] -- 0:00:09
848500 -- (-496.302) (-496.579) (-495.871) [-502.897] * (-496.528) (-495.116) [-496.287] (-496.102) -- 0:00:09
849000 -- (-499.737) [-493.618] (-496.167) (-496.310) * [-497.552] (-494.217) (-493.840) (-497.230) -- 0:00:09
849500 -- (-495.149) (-495.119) [-498.277] (-494.031) * (-495.215) (-495.603) (-494.021) [-496.943] -- 0:00:09
850000 -- [-495.099] (-495.995) (-497.160) (-496.356) * (-494.573) [-494.994] (-499.131) (-497.576) -- 0:00:09
Average standard deviation of split frequencies: 0.010841
850500 -- (-495.938) [-495.118] (-495.596) (-501.150) * (-498.155) (-495.699) [-494.370] (-495.265) -- 0:00:09
851000 -- (-495.104) (-495.811) [-496.488] (-497.486) * (-496.328) (-494.694) [-499.116] (-497.551) -- 0:00:09
851500 -- (-495.079) [-495.032] (-494.710) (-496.232) * (-496.037) (-495.478) [-499.507] (-494.260) -- 0:00:09
852000 -- (-494.454) [-498.011] (-495.306) (-496.866) * (-501.065) [-497.811] (-495.482) (-495.433) -- 0:00:09
852500 -- (-499.372) (-498.538) (-495.339) [-493.529] * (-496.176) [-498.508] (-495.188) (-494.339) -- 0:00:08
853000 -- [-497.012] (-497.157) (-495.492) (-493.551) * (-497.732) [-495.007] (-495.257) (-495.822) -- 0:00:08
853500 -- (-498.323) (-495.561) [-494.764] (-495.566) * (-495.094) (-494.373) (-496.712) [-493.725] -- 0:00:08
854000 -- (-496.184) (-494.221) [-495.257] (-504.982) * (-495.118) (-495.284) [-498.763] (-495.294) -- 0:00:08
854500 -- [-494.006] (-494.573) (-494.698) (-496.124) * (-496.254) [-493.994] (-496.741) (-496.017) -- 0:00:08
855000 -- (-499.343) (-494.950) (-500.172) [-493.992] * (-494.567) (-497.232) (-499.632) [-494.385] -- 0:00:08
Average standard deviation of split frequencies: 0.010794
855500 -- (-496.487) [-497.015] (-502.016) (-496.907) * (-495.491) [-493.561] (-496.143) (-494.529) -- 0:00:08
856000 -- (-495.612) (-499.635) (-496.907) [-493.840] * (-497.588) (-494.919) [-496.467] (-494.058) -- 0:00:08
856500 -- [-496.556] (-498.015) (-494.104) (-493.583) * (-494.564) (-494.876) (-497.165) [-493.677] -- 0:00:08
857000 -- (-499.479) (-497.341) (-496.353) [-497.329] * (-493.806) (-494.122) [-496.749] (-494.476) -- 0:00:08
857500 -- (-495.344) (-493.505) (-495.644) [-494.989] * (-493.646) (-494.352) [-495.167] (-495.618) -- 0:00:08
858000 -- (-494.944) (-493.860) [-497.723] (-496.008) * (-498.074) [-494.566] (-493.968) (-494.280) -- 0:00:08
858500 -- (-496.808) (-493.507) [-494.440] (-493.803) * (-494.350) (-494.021) (-495.273) [-495.759] -- 0:00:08
859000 -- (-495.404) (-494.987) [-494.782] (-495.135) * (-494.489) (-494.626) [-497.154] (-494.477) -- 0:00:08
859500 -- (-495.318) (-495.540) [-497.568] (-496.867) * (-493.952) [-496.772] (-495.359) (-496.080) -- 0:00:08
860000 -- (-494.873) (-494.077) [-497.983] (-495.593) * (-495.428) (-494.594) [-497.694] (-495.162) -- 0:00:08
Average standard deviation of split frequencies: 0.010133
860500 -- [-495.593] (-494.167) (-495.205) (-494.395) * (-495.595) (-494.508) [-493.905] (-495.191) -- 0:00:08
861000 -- (-494.983) (-497.717) [-495.873] (-495.655) * [-498.320] (-494.409) (-493.459) (-497.316) -- 0:00:08
861500 -- (-493.222) (-495.452) [-494.271] (-496.544) * (-494.678) [-494.250] (-493.640) (-496.174) -- 0:00:08
862000 -- (-494.114) [-494.279] (-494.077) (-497.884) * [-494.990] (-495.955) (-499.561) (-496.846) -- 0:00:08
862500 -- [-495.161] (-495.281) (-495.549) (-495.423) * [-496.474] (-494.091) (-496.849) (-496.109) -- 0:00:08
863000 -- [-495.481] (-497.708) (-495.379) (-495.495) * (-499.383) (-495.379) (-495.010) [-494.187] -- 0:00:08
863500 -- (-495.838) (-494.885) [-495.686] (-495.477) * [-494.682] (-495.191) (-495.231) (-500.456) -- 0:00:08
864000 -- [-497.428] (-497.025) (-494.652) (-499.630) * (-496.786) (-495.773) [-495.822] (-497.213) -- 0:00:08
864500 -- (-494.323) [-493.433] (-495.687) (-497.576) * [-496.173] (-495.271) (-494.892) (-496.397) -- 0:00:08
865000 -- (-495.642) (-494.999) (-495.639) [-496.103] * (-495.535) [-494.016] (-494.208) (-497.221) -- 0:00:08
Average standard deviation of split frequencies: 0.009764
865500 -- (-494.457) (-493.785) [-496.517] (-494.742) * (-494.777) (-496.095) [-494.477] (-493.453) -- 0:00:08
866000 -- (-494.236) (-495.411) [-497.136] (-495.701) * (-493.618) (-495.301) (-494.990) [-493.769] -- 0:00:08
866500 -- (-496.019) (-495.877) (-494.460) [-494.213] * (-498.554) (-494.983) (-496.715) [-493.948] -- 0:00:08
867000 -- (-498.450) (-493.709) [-495.977] (-493.923) * [-498.672] (-494.123) (-493.879) (-494.770) -- 0:00:08
867500 -- [-493.653] (-494.118) (-496.730) (-495.013) * (-498.929) [-497.227] (-494.236) (-494.275) -- 0:00:08
868000 -- [-494.055] (-496.061) (-497.980) (-494.325) * (-495.549) (-496.025) (-497.104) [-496.334] -- 0:00:08
868500 -- [-494.355] (-495.904) (-495.862) (-497.557) * (-496.012) (-494.988) [-496.150] (-496.562) -- 0:00:08
869000 -- (-494.775) (-495.277) (-496.549) [-494.562] * (-494.407) (-500.367) [-497.452] (-496.692) -- 0:00:07
869500 -- [-499.477] (-495.317) (-495.395) (-493.965) * [-495.782] (-494.981) (-497.848) (-495.982) -- 0:00:07
870000 -- (-495.578) [-493.253] (-495.146) (-500.657) * (-494.274) (-497.567) (-493.715) [-493.725] -- 0:00:07
Average standard deviation of split frequencies: 0.010504
870500 -- (-494.545) (-494.995) (-493.901) [-495.454] * [-494.321] (-497.977) (-494.725) (-493.840) -- 0:00:07
871000 -- (-495.236) (-493.975) [-493.530] (-496.403) * [-494.105] (-494.119) (-494.131) (-499.958) -- 0:00:07
871500 -- [-496.461] (-494.379) (-497.693) (-498.925) * (-494.887) (-497.849) [-495.112] (-498.649) -- 0:00:07
872000 -- (-495.686) [-494.286] (-501.455) (-494.269) * (-494.909) (-495.172) [-495.269] (-496.494) -- 0:00:07
872500 -- (-499.216) (-494.433) (-496.261) [-493.705] * [-494.136] (-497.331) (-494.492) (-498.297) -- 0:00:07
873000 -- [-493.939] (-495.266) (-494.322) (-493.978) * [-493.190] (-501.190) (-494.504) (-497.264) -- 0:00:07
873500 -- (-494.316) (-496.922) [-496.294] (-495.676) * (-495.011) (-500.246) [-494.884] (-496.258) -- 0:00:07
874000 -- (-496.928) [-496.197] (-499.590) (-494.588) * (-496.135) [-494.557] (-494.255) (-494.812) -- 0:00:07
874500 -- (-493.866) [-495.551] (-496.117) (-493.969) * (-493.914) [-497.028] (-494.187) (-495.081) -- 0:00:07
875000 -- (-494.354) [-493.996] (-495.675) (-494.685) * (-495.363) (-497.691) [-494.693] (-496.247) -- 0:00:07
Average standard deviation of split frequencies: 0.010157
875500 -- [-498.425] (-494.097) (-496.745) (-494.575) * (-495.459) (-497.113) (-494.605) [-494.991] -- 0:00:07
876000 -- (-498.262) (-493.740) (-502.837) [-495.067] * (-497.058) (-498.721) (-494.730) [-494.387] -- 0:00:07
876500 -- (-497.263) (-495.131) [-495.101] (-495.214) * (-498.501) [-498.117] (-495.274) (-493.865) -- 0:00:07
877000 -- (-497.301) (-493.836) [-495.417] (-497.076) * (-494.027) (-494.106) (-496.156) [-500.754] -- 0:00:07
877500 -- (-493.981) [-497.297] (-495.221) (-498.866) * (-497.805) (-496.543) (-497.318) [-495.614] -- 0:00:07
878000 -- [-494.991] (-496.834) (-494.768) (-493.462) * (-495.422) [-494.804] (-496.504) (-494.500) -- 0:00:07
878500 -- (-494.781) (-495.480) [-494.379] (-496.930) * (-495.081) [-495.251] (-495.103) (-494.963) -- 0:00:07
879000 -- (-495.227) (-498.783) (-494.589) [-496.241] * (-494.321) (-494.761) (-496.811) [-495.222] -- 0:00:07
879500 -- [-493.679] (-500.138) (-495.982) (-495.768) * (-503.712) (-497.536) [-497.101] (-495.065) -- 0:00:07
880000 -- (-495.509) [-493.735] (-497.134) (-497.790) * (-493.460) (-495.350) (-494.386) [-496.938] -- 0:00:07
Average standard deviation of split frequencies: 0.010456
880500 -- (-495.249) [-496.065] (-495.588) (-495.365) * (-494.593) (-498.747) (-494.826) [-495.729] -- 0:00:07
881000 -- (-499.456) (-494.702) (-494.857) [-493.663] * (-495.676) (-495.001) [-494.764] (-496.413) -- 0:00:07
881500 -- [-499.267] (-493.734) (-497.139) (-496.569) * [-495.870] (-495.105) (-496.213) (-497.557) -- 0:00:07
882000 -- (-497.569) (-497.504) [-499.879] (-496.294) * (-496.631) (-496.346) [-495.438] (-496.255) -- 0:00:07
882500 -- (-497.387) [-498.116] (-496.817) (-495.561) * [-499.147] (-495.531) (-494.491) (-498.236) -- 0:00:07
883000 -- (-497.274) (-494.961) (-495.072) [-494.528] * (-499.910) [-496.038] (-495.003) (-496.452) -- 0:00:07
883500 -- (-495.983) [-494.459] (-495.154) (-494.217) * (-501.647) [-493.534] (-495.130) (-500.317) -- 0:00:07
884000 -- (-494.300) [-496.937] (-495.273) (-495.919) * (-494.781) [-496.456] (-497.686) (-500.858) -- 0:00:07
884500 -- (-494.683) (-495.404) (-494.911) [-495.188] * (-496.368) (-497.831) (-495.946) [-496.869] -- 0:00:07
885000 -- (-494.690) [-494.356] (-496.894) (-497.303) * (-496.624) [-495.830] (-494.826) (-493.742) -- 0:00:07
Average standard deviation of split frequencies: 0.010499
885500 -- (-496.833) (-497.143) [-496.987] (-495.708) * (-501.505) (-496.158) (-493.863) [-493.602] -- 0:00:06
886000 -- [-494.921] (-495.952) (-494.409) (-494.368) * (-500.342) (-494.764) (-494.548) [-494.073] -- 0:00:06
886500 -- (-495.114) (-501.884) (-494.343) [-494.196] * [-496.107] (-494.146) (-496.895) (-494.625) -- 0:00:06
887000 -- [-495.745] (-497.337) (-494.511) (-500.520) * (-494.084) [-494.545] (-494.236) (-494.890) -- 0:00:06
887500 -- (-493.754) [-494.397] (-494.681) (-496.504) * (-495.538) (-494.686) (-495.543) [-495.035] -- 0:00:06
888000 -- [-493.929] (-494.325) (-497.928) (-496.018) * (-494.380) (-495.142) [-497.075] (-496.315) -- 0:00:06
888500 -- (-494.391) [-494.006] (-500.324) (-498.779) * (-497.614) (-494.889) [-495.930] (-495.320) -- 0:00:06
889000 -- [-494.315] (-496.360) (-500.142) (-496.480) * [-494.051] (-497.925) (-498.831) (-493.947) -- 0:00:06
889500 -- (-497.058) [-494.779] (-500.157) (-496.818) * (-498.024) [-498.138] (-494.702) (-494.066) -- 0:00:06
890000 -- [-495.007] (-497.084) (-497.612) (-495.008) * (-498.992) (-497.774) [-495.288] (-495.808) -- 0:00:06
Average standard deviation of split frequencies: 0.010338
890500 -- (-495.343) (-498.331) (-496.698) [-494.479] * (-500.787) (-499.637) [-498.642] (-495.825) -- 0:00:06
891000 -- (-495.675) (-496.368) [-496.961] (-493.962) * (-496.720) (-498.113) (-496.986) [-493.959] -- 0:00:06
891500 -- [-495.075] (-494.554) (-493.954) (-495.008) * (-495.997) [-494.240] (-497.551) (-495.257) -- 0:00:06
892000 -- (-494.634) (-494.039) [-493.741] (-495.499) * [-494.399] (-493.337) (-495.294) (-495.363) -- 0:00:06
892500 -- [-494.900] (-498.617) (-493.733) (-496.915) * (-494.027) [-493.343] (-495.303) (-496.379) -- 0:00:06
893000 -- (-495.154) [-496.876] (-496.157) (-496.039) * (-496.287) (-497.308) [-494.357] (-498.341) -- 0:00:06
893500 -- (-501.841) (-496.685) [-496.529] (-494.619) * (-497.883) (-498.388) (-494.884) [-496.734] -- 0:00:06
894000 -- (-495.865) (-500.319) (-493.872) [-494.191] * (-498.505) [-496.011] (-495.098) (-496.664) -- 0:00:06
894500 -- (-495.005) (-494.480) (-496.563) [-495.770] * (-496.044) (-498.184) (-495.671) [-495.614] -- 0:00:06
895000 -- (-501.647) (-495.528) (-498.478) [-496.984] * (-494.995) [-493.748] (-496.114) (-497.444) -- 0:00:06
Average standard deviation of split frequencies: 0.010347
895500 -- (-494.393) (-498.774) [-495.071] (-498.361) * [-496.671] (-494.183) (-496.233) (-496.677) -- 0:00:06
896000 -- [-495.329] (-501.024) (-494.075) (-498.022) * (-494.214) [-493.892] (-500.687) (-495.720) -- 0:00:06
896500 -- (-495.334) [-494.124] (-493.740) (-499.324) * (-499.047) [-493.896] (-496.748) (-495.635) -- 0:00:06
897000 -- [-497.641] (-498.057) (-496.516) (-495.005) * (-498.879) (-495.867) [-500.978] (-500.521) -- 0:00:06
897500 -- (-498.102) (-498.768) [-496.788] (-494.679) * (-495.212) (-496.118) (-494.478) [-497.716] -- 0:00:06
898000 -- [-496.754] (-494.436) (-494.560) (-494.636) * (-495.199) (-493.576) [-495.530] (-494.245) -- 0:00:06
898500 -- (-497.834) (-496.178) (-496.169) [-494.565] * (-500.801) [-493.650] (-495.738) (-495.557) -- 0:00:06
899000 -- (-497.979) (-496.053) [-493.384] (-494.622) * (-498.411) (-496.210) [-493.881] (-496.864) -- 0:00:06
899500 -- (-495.503) [-493.666] (-495.238) (-494.723) * (-494.776) (-498.149) [-495.262] (-494.607) -- 0:00:06
900000 -- (-497.781) (-494.571) [-493.568] (-500.939) * (-498.158) (-494.972) [-494.109] (-494.821) -- 0:00:06
Average standard deviation of split frequencies: 0.010119
900500 -- (-497.037) (-494.140) (-497.920) [-494.233] * (-497.120) (-498.512) (-494.864) [-495.736] -- 0:00:06
901000 -- (-493.602) (-494.282) (-495.618) [-497.171] * (-498.084) (-499.140) (-495.047) [-497.218] -- 0:00:06
901500 -- (-494.237) (-496.530) [-500.211] (-498.080) * (-497.283) (-501.098) (-494.795) [-494.784] -- 0:00:06
902000 -- (-495.166) (-497.491) (-493.786) [-502.372] * (-495.604) (-493.363) (-494.453) [-494.151] -- 0:00:05
902500 -- (-498.615) (-497.405) [-493.580] (-498.564) * (-495.020) (-498.353) [-493.482] (-497.451) -- 0:00:05
903000 -- [-498.928] (-495.942) (-498.764) (-495.003) * [-494.509] (-497.699) (-495.689) (-496.787) -- 0:00:05
903500 -- [-496.890] (-495.651) (-497.238) (-494.611) * (-494.603) (-497.960) [-496.494] (-493.788) -- 0:00:05
904000 -- (-496.310) (-494.447) (-498.608) [-495.863] * (-493.454) [-495.707] (-495.021) (-493.974) -- 0:00:05
904500 -- [-497.974] (-493.823) (-498.232) (-495.267) * (-494.126) [-494.128] (-494.118) (-494.324) -- 0:00:05
905000 -- (-494.512) (-494.656) (-498.295) [-495.320] * (-494.747) [-497.011] (-496.311) (-494.102) -- 0:00:05
Average standard deviation of split frequencies: 0.009955
905500 -- (-497.211) [-493.862] (-494.768) (-496.991) * (-496.975) (-493.612) [-496.048] (-501.602) -- 0:00:05
906000 -- (-497.429) (-496.043) (-493.971) [-496.392] * (-494.555) (-495.939) [-494.561] (-499.725) -- 0:00:05
906500 -- (-494.843) (-494.296) (-495.905) [-495.916] * (-494.535) [-499.239] (-493.549) (-500.037) -- 0:00:05
907000 -- [-496.063] (-493.608) (-498.717) (-493.943) * [-495.666] (-499.275) (-494.147) (-498.467) -- 0:00:05
907500 -- [-495.110] (-494.263) (-495.666) (-498.819) * [-495.557] (-499.444) (-497.619) (-495.979) -- 0:00:05
908000 -- (-494.216) (-498.330) [-496.710] (-502.231) * (-495.918) [-494.232] (-497.324) (-496.553) -- 0:00:05
908500 -- (-497.739) [-495.872] (-494.692) (-494.271) * [-495.400] (-495.088) (-494.996) (-494.040) -- 0:00:05
909000 -- (-499.252) (-495.370) (-496.713) [-493.976] * (-496.232) (-496.008) (-497.670) [-494.506] -- 0:00:05
909500 -- (-498.184) [-494.238] (-496.288) (-495.952) * (-501.398) (-493.629) (-494.283) [-495.751] -- 0:00:05
910000 -- (-498.478) [-494.469] (-495.987) (-495.902) * (-496.032) (-495.797) (-493.447) [-494.710] -- 0:00:05
Average standard deviation of split frequencies: 0.010077
910500 -- (-494.392) (-494.405) [-494.416] (-497.772) * (-499.404) (-495.619) [-494.228] (-494.306) -- 0:00:05
911000 -- [-493.555] (-495.762) (-494.489) (-496.032) * (-495.563) [-496.374] (-495.945) (-495.981) -- 0:00:05
911500 -- [-495.474] (-498.824) (-496.479) (-495.748) * [-493.983] (-499.825) (-498.700) (-494.051) -- 0:00:05
912000 -- [-496.023] (-497.910) (-495.102) (-493.776) * (-494.825) (-497.674) (-501.907) [-496.352] -- 0:00:05
912500 -- [-495.517] (-498.432) (-495.868) (-495.414) * (-493.798) [-495.723] (-495.503) (-497.116) -- 0:00:05
913000 -- [-497.479] (-498.569) (-496.694) (-493.421) * (-497.370) (-494.095) (-496.935) [-497.844] -- 0:00:05
913500 -- (-497.521) [-493.706] (-495.799) (-494.282) * [-497.252] (-496.134) (-495.256) (-494.013) -- 0:00:05
914000 -- (-493.515) (-493.866) (-496.707) [-494.025] * (-495.435) (-493.751) [-494.868] (-501.194) -- 0:00:05
914500 -- [-496.291] (-494.726) (-495.123) (-495.362) * (-496.506) (-496.418) (-498.846) [-493.696] -- 0:00:05
915000 -- (-497.729) [-496.155] (-498.953) (-494.904) * (-502.032) (-497.116) [-496.872] (-493.559) -- 0:00:05
Average standard deviation of split frequencies: 0.009984
915500 -- (-496.883) (-498.325) [-499.930] (-498.411) * (-497.915) (-496.274) (-494.193) [-494.757] -- 0:00:05
916000 -- (-494.549) (-496.497) [-493.717] (-498.419) * (-494.938) (-496.445) [-495.182] (-494.483) -- 0:00:05
916500 -- (-496.038) (-496.615) (-494.154) [-495.034] * (-496.391) (-496.942) (-495.632) [-493.971] -- 0:00:05
917000 -- [-493.652] (-499.453) (-494.162) (-495.393) * (-493.586) (-496.054) [-495.055] (-496.160) -- 0:00:05
917500 -- (-495.643) (-499.023) [-494.456] (-498.098) * (-493.609) (-499.846) [-497.271] (-494.141) -- 0:00:05
918000 -- (-497.248) (-503.291) (-496.172) [-497.635] * [-493.229] (-494.560) (-495.882) (-497.435) -- 0:00:05
918500 -- (-497.805) (-496.949) (-496.984) [-497.193] * (-497.840) (-495.142) (-496.004) [-494.682] -- 0:00:04
919000 -- (-494.056) (-495.788) [-500.531] (-495.759) * (-498.415) (-495.084) (-497.167) [-496.409] -- 0:00:04
919500 -- (-493.959) (-498.430) [-495.636] (-496.846) * (-494.478) [-493.950] (-496.542) (-498.092) -- 0:00:04
920000 -- (-494.940) (-496.446) (-495.203) [-497.379] * (-498.102) (-496.214) [-495.878] (-494.630) -- 0:00:04
Average standard deviation of split frequencies: 0.009626
920500 -- [-494.258] (-495.032) (-499.019) (-494.164) * (-502.326) [-495.398] (-493.979) (-495.519) -- 0:00:04
921000 -- [-494.842] (-495.455) (-494.717) (-493.960) * (-497.487) (-498.200) [-497.385] (-497.875) -- 0:00:04
921500 -- (-496.264) [-494.430] (-493.982) (-493.749) * (-494.440) [-493.518] (-494.559) (-495.788) -- 0:00:04
922000 -- (-494.161) (-494.735) [-494.733] (-494.944) * (-494.579) (-494.474) (-494.362) [-495.851] -- 0:00:04
922500 -- (-496.696) (-496.913) (-496.905) [-497.160] * (-496.213) [-494.646] (-495.243) (-494.963) -- 0:00:04
923000 -- (-494.939) (-497.001) (-496.918) [-495.172] * (-497.188) (-497.732) [-495.258] (-495.481) -- 0:00:04
923500 -- (-493.703) [-497.432] (-498.794) (-494.343) * (-495.603) (-498.177) (-495.123) [-495.234] -- 0:00:04
924000 -- (-496.227) [-494.253] (-496.190) (-496.725) * [-494.082] (-500.440) (-494.171) (-494.656) -- 0:00:04
924500 -- [-500.370] (-495.914) (-495.755) (-494.403) * (-496.944) (-495.586) (-494.936) [-495.487] -- 0:00:04
925000 -- [-500.227] (-493.521) (-497.963) (-495.144) * (-496.929) (-497.225) (-495.494) [-495.479] -- 0:00:04
Average standard deviation of split frequencies: 0.009808
925500 -- [-496.200] (-495.993) (-497.594) (-495.253) * (-496.727) (-494.004) [-494.830] (-495.119) -- 0:00:04
926000 -- (-495.571) [-495.067] (-499.268) (-494.392) * (-494.835) (-496.455) (-496.358) [-494.879] -- 0:00:04
926500 -- [-494.868] (-495.436) (-495.007) (-496.973) * [-495.619] (-497.932) (-494.272) (-495.209) -- 0:00:04
927000 -- [-497.315] (-495.626) (-495.327) (-494.709) * (-497.406) (-496.496) (-501.813) [-494.529] -- 0:00:04
927500 -- [-495.246] (-494.382) (-495.132) (-497.043) * [-494.627] (-494.060) (-497.977) (-495.480) -- 0:00:04
928000 -- (-495.929) (-497.755) [-495.151] (-496.170) * (-495.176) [-494.215] (-494.038) (-495.493) -- 0:00:04
928500 -- (-493.904) (-498.872) (-497.215) [-497.935] * [-494.213] (-495.079) (-494.914) (-502.306) -- 0:00:04
929000 -- (-498.562) (-495.763) [-497.515] (-498.283) * (-494.860) (-497.544) (-495.223) [-494.998] -- 0:00:04
929500 -- (-497.036) (-498.300) (-494.912) [-496.199] * (-497.724) (-501.121) (-496.961) [-497.661] -- 0:00:04
930000 -- (-494.086) (-501.344) [-494.173] (-495.796) * (-495.396) [-498.983] (-493.566) (-496.939) -- 0:00:04
Average standard deviation of split frequencies: 0.009759
930500 -- (-494.403) [-493.623] (-497.142) (-495.061) * (-494.091) (-499.599) [-493.940] (-496.243) -- 0:00:04
931000 -- (-494.652) (-494.693) (-495.690) [-495.807] * (-495.104) (-493.697) (-495.787) [-495.671] -- 0:00:04
931500 -- (-493.742) (-496.373) [-494.121] (-494.859) * (-495.779) (-494.991) (-494.390) [-496.469] -- 0:00:04
932000 -- (-494.575) (-495.592) (-493.426) [-493.408] * (-496.672) [-493.664] (-494.614) (-497.425) -- 0:00:04
932500 -- (-494.662) (-494.482) [-497.077] (-495.759) * [-495.414] (-495.177) (-495.636) (-497.628) -- 0:00:04
933000 -- (-495.936) (-494.175) [-500.647] (-495.166) * (-493.769) [-498.586] (-495.385) (-493.361) -- 0:00:04
933500 -- (-495.208) [-497.192] (-493.724) (-501.120) * [-493.729] (-495.764) (-494.248) (-493.796) -- 0:00:04
934000 -- [-494.595] (-497.672) (-493.365) (-495.144) * (-497.072) (-495.829) (-494.120) [-493.686] -- 0:00:04
934500 -- [-500.402] (-498.240) (-495.330) (-494.121) * (-495.261) (-493.222) [-496.502] (-495.173) -- 0:00:03
935000 -- [-497.244] (-495.196) (-495.219) (-497.597) * (-495.126) [-497.456] (-497.058) (-495.234) -- 0:00:03
Average standard deviation of split frequencies: 0.009804
935500 -- (-495.206) [-494.490] (-495.748) (-495.735) * [-494.986] (-498.729) (-493.523) (-495.963) -- 0:00:03
936000 -- [-494.249] (-495.742) (-495.641) (-494.080) * (-493.828) [-494.958] (-494.206) (-498.085) -- 0:00:03
936500 -- (-494.855) (-494.705) [-493.903] (-494.248) * (-498.373) [-495.474] (-495.399) (-497.111) -- 0:00:03
937000 -- (-496.467) (-495.098) (-495.639) [-494.611] * (-496.939) (-493.520) [-497.168] (-500.145) -- 0:00:03
937500 -- (-496.186) [-494.870] (-496.582) (-493.887) * (-498.913) [-493.897] (-497.245) (-495.006) -- 0:00:03
938000 -- [-493.902] (-493.965) (-494.860) (-497.410) * (-496.880) (-498.967) (-498.798) [-496.006] -- 0:00:03
938500 -- (-493.876) [-493.464] (-495.581) (-496.240) * (-495.258) (-497.318) (-493.895) [-493.544] -- 0:00:03
939000 -- (-494.169) (-494.301) [-494.526] (-497.179) * (-496.494) (-495.496) [-494.141] (-494.509) -- 0:00:03
939500 -- (-497.808) (-493.977) [-494.425] (-499.667) * (-494.652) (-494.899) [-501.481] (-494.550) -- 0:00:03
940000 -- (-494.324) [-495.239] (-494.354) (-498.007) * (-493.546) [-494.908] (-495.666) (-495.814) -- 0:00:03
Average standard deviation of split frequencies: 0.009856
940500 -- [-494.281] (-497.494) (-494.318) (-496.895) * [-493.762] (-496.140) (-497.373) (-495.751) -- 0:00:03
941000 -- [-498.056] (-496.512) (-498.758) (-495.961) * [-494.278] (-496.143) (-494.684) (-494.411) -- 0:00:03
941500 -- (-499.852) [-495.221] (-497.766) (-494.550) * (-497.921) (-496.009) [-494.002] (-494.327) -- 0:00:03
942000 -- (-496.587) [-496.029] (-499.661) (-494.170) * (-496.540) [-495.784] (-498.449) (-494.657) -- 0:00:03
942500 -- (-495.994) (-493.683) [-498.847] (-495.071) * [-494.799] (-496.257) (-496.210) (-494.382) -- 0:00:03
943000 -- (-495.275) (-493.632) (-495.599) [-494.752] * (-494.848) (-499.054) (-495.043) [-495.170] -- 0:00:03
943500 -- (-495.486) [-494.286] (-494.614) (-493.174) * (-495.682) [-495.628] (-495.367) (-495.631) -- 0:00:03
944000 -- (-495.336) (-495.261) (-497.309) [-496.281] * [-493.280] (-495.678) (-496.508) (-494.360) -- 0:00:03
944500 -- (-498.972) (-495.958) [-494.948] (-495.367) * [-493.320] (-494.109) (-495.583) (-494.655) -- 0:00:03
945000 -- [-496.440] (-497.509) (-494.649) (-496.734) * [-494.571] (-500.365) (-495.093) (-497.934) -- 0:00:03
Average standard deviation of split frequencies: 0.009501
945500 -- (-499.304) (-496.630) (-495.836) [-497.052] * (-496.508) [-496.653] (-496.635) (-497.752) -- 0:00:03
946000 -- [-494.275] (-498.110) (-496.941) (-495.453) * [-495.428] (-495.754) (-494.364) (-493.686) -- 0:00:03
946500 -- (-495.810) [-495.997] (-495.816) (-497.993) * (-494.524) (-494.458) [-494.341] (-495.065) -- 0:00:03
947000 -- (-494.352) [-493.904] (-496.630) (-494.813) * (-497.900) (-496.616) (-494.884) [-494.734] -- 0:00:03
947500 -- (-497.071) (-494.454) (-494.838) [-495.354] * [-494.580] (-495.135) (-495.655) (-495.992) -- 0:00:03
948000 -- (-493.873) [-493.668] (-495.527) (-497.892) * (-496.440) (-497.940) (-495.451) [-494.533] -- 0:00:03
948500 -- (-496.625) (-495.100) (-500.186) [-494.144] * (-495.392) [-495.712] (-496.329) (-496.594) -- 0:00:03
949000 -- (-496.521) (-494.995) (-496.177) [-495.446] * (-495.453) (-493.483) (-495.860) [-496.944] -- 0:00:03
949500 -- [-495.679] (-494.442) (-502.736) (-493.875) * (-493.704) (-496.164) (-496.400) [-497.182] -- 0:00:03
950000 -- (-494.869) [-494.529] (-496.764) (-494.719) * (-494.170) [-496.284] (-495.539) (-496.706) -- 0:00:03
Average standard deviation of split frequencies: 0.009851
950500 -- (-495.903) (-497.802) [-495.226] (-497.598) * (-494.647) (-495.432) (-495.897) [-497.114] -- 0:00:03
951000 -- (-495.139) [-495.219] (-494.129) (-499.323) * [-493.968] (-495.901) (-494.991) (-495.988) -- 0:00:02
951500 -- (-494.520) [-495.986] (-494.418) (-499.918) * [-494.555] (-497.141) (-494.298) (-496.510) -- 0:00:02
952000 -- (-494.378) (-497.073) (-495.587) [-496.979] * (-495.020) (-498.573) [-497.118] (-495.641) -- 0:00:02
952500 -- (-501.385) (-494.486) (-493.576) [-493.516] * (-494.233) (-495.308) (-498.407) [-495.580] -- 0:00:02
953000 -- [-496.545] (-494.567) (-497.416) (-494.926) * [-494.414] (-497.028) (-497.436) (-493.995) -- 0:00:02
953500 -- (-495.754) [-495.510] (-497.396) (-494.085) * [-495.125] (-494.297) (-496.377) (-493.873) -- 0:00:02
954000 -- [-494.355] (-493.747) (-496.177) (-495.222) * [-494.938] (-495.343) (-496.092) (-494.945) -- 0:00:02
954500 -- (-496.002) [-493.342] (-495.997) (-495.463) * (-493.805) (-498.651) (-496.203) [-497.761] -- 0:00:02
955000 -- (-495.545) [-494.050] (-495.406) (-496.812) * (-493.566) (-496.137) (-495.086) [-494.489] -- 0:00:02
Average standard deviation of split frequencies: 0.009270
955500 -- [-495.483] (-495.796) (-494.281) (-498.517) * (-495.372) (-496.235) (-495.096) [-496.222] -- 0:00:02
956000 -- [-496.711] (-496.427) (-494.623) (-496.190) * (-496.552) (-495.261) (-495.874) [-495.899] -- 0:00:02
956500 -- [-497.001] (-495.997) (-495.250) (-499.222) * [-495.647] (-500.987) (-494.582) (-494.355) -- 0:00:02
957000 -- (-497.184) (-494.910) (-496.461) [-497.507] * [-493.747] (-499.625) (-496.800) (-496.292) -- 0:00:02
957500 -- (-496.082) (-494.225) (-496.391) [-494.612] * (-495.059) (-499.001) (-495.727) [-496.026] -- 0:00:02
958000 -- (-495.027) (-497.067) (-496.390) [-499.576] * (-495.268) (-501.242) [-495.707] (-495.999) -- 0:00:02
958500 -- (-493.913) (-494.897) (-498.217) [-496.190] * (-494.073) (-497.091) (-496.641) [-496.641] -- 0:00:02
959000 -- (-493.660) (-495.036) [-497.913] (-499.190) * (-496.184) (-497.957) (-496.450) [-495.978] -- 0:00:02
959500 -- (-493.325) (-493.919) [-493.922] (-495.628) * (-494.568) (-504.936) [-497.244] (-499.206) -- 0:00:02
960000 -- (-499.538) (-495.665) [-498.310] (-494.236) * [-493.937] (-496.701) (-495.333) (-493.876) -- 0:00:02
Average standard deviation of split frequencies: 0.009291
960500 -- [-503.204] (-497.364) (-498.826) (-494.229) * [-495.668] (-494.834) (-494.842) (-494.089) -- 0:00:02
961000 -- (-500.898) [-494.928] (-494.620) (-495.421) * (-497.344) (-493.694) (-493.650) [-495.127] -- 0:00:02
961500 -- (-496.413) (-494.235) [-495.499] (-496.641) * (-494.382) (-494.350) (-497.740) [-497.864] -- 0:00:02
962000 -- [-496.680] (-497.812) (-495.996) (-499.610) * (-495.379) (-494.357) [-494.632] (-495.202) -- 0:00:02
962500 -- (-493.845) [-494.568] (-494.582) (-496.780) * (-494.246) [-496.304] (-497.443) (-494.122) -- 0:00:02
963000 -- (-495.808) [-497.985] (-493.995) (-494.997) * (-493.119) [-495.866] (-497.652) (-493.689) -- 0:00:02
963500 -- (-493.984) [-496.690] (-494.387) (-495.769) * (-494.223) (-496.224) (-496.277) [-493.787] -- 0:00:02
964000 -- (-495.496) [-495.191] (-493.941) (-495.001) * [-494.724] (-500.045) (-496.094) (-494.515) -- 0:00:02
964500 -- [-495.236] (-496.531) (-493.535) (-495.214) * (-495.657) (-497.995) [-494.350] (-497.197) -- 0:00:02
965000 -- [-496.570] (-495.608) (-494.633) (-496.323) * (-496.472) [-496.205] (-493.933) (-499.160) -- 0:00:02
Average standard deviation of split frequencies: 0.009304
965500 -- (-499.324) (-493.575) [-494.809] (-496.784) * [-499.295] (-502.156) (-497.368) (-494.418) -- 0:00:02
966000 -- [-494.085] (-495.677) (-494.885) (-496.787) * (-493.623) (-496.532) [-496.608] (-494.718) -- 0:00:02
966500 -- (-496.143) (-496.062) (-495.111) [-495.628] * (-496.674) (-493.458) [-494.321] (-496.694) -- 0:00:02
967000 -- [-495.535] (-494.334) (-495.830) (-493.967) * (-496.287) [-493.450] (-494.215) (-495.235) -- 0:00:02
967500 -- (-494.902) (-499.653) (-494.713) [-493.683] * (-494.246) [-496.086] (-494.262) (-495.244) -- 0:00:01
968000 -- (-494.565) (-499.902) [-494.713] (-493.437) * [-494.561] (-495.391) (-494.461) (-496.179) -- 0:00:01
968500 -- (-493.559) (-494.317) (-495.117) [-496.795] * (-494.917) (-494.598) (-497.268) [-493.928] -- 0:00:01
969000 -- (-497.680) (-494.485) [-493.771] (-498.288) * (-496.533) (-493.409) [-495.169] (-494.839) -- 0:00:01
969500 -- (-498.748) (-493.602) (-493.397) [-493.705] * (-496.729) [-493.514] (-499.217) (-494.000) -- 0:00:01
970000 -- (-497.742) [-494.997] (-493.544) (-495.748) * [-494.255] (-494.389) (-494.891) (-494.193) -- 0:00:01
Average standard deviation of split frequencies: 0.009033
970500 -- (-496.421) (-495.002) [-493.525] (-495.868) * (-493.754) (-495.927) (-496.234) [-495.218] -- 0:00:01
971000 -- (-499.358) (-494.521) [-495.402] (-495.959) * (-497.598) (-499.104) [-498.340] (-497.362) -- 0:00:01
971500 -- (-499.936) [-493.603] (-496.657) (-499.876) * (-495.015) (-496.108) [-496.706] (-497.655) -- 0:00:01
972000 -- [-494.667] (-496.114) (-494.903) (-493.536) * [-493.807] (-494.540) (-497.322) (-494.992) -- 0:00:01
972500 -- (-495.799) (-494.246) [-497.260] (-494.375) * (-493.878) (-496.260) [-493.603] (-494.470) -- 0:00:01
973000 -- (-499.382) [-493.522] (-498.862) (-497.791) * (-493.362) (-498.582) [-493.768] (-496.415) -- 0:00:01
973500 -- (-496.002) (-496.452) (-502.564) [-494.490] * (-495.044) (-494.235) [-494.322] (-493.936) -- 0:00:01
974000 -- (-494.835) (-497.226) [-497.468] (-496.603) * (-494.553) (-493.914) (-494.520) [-493.885] -- 0:00:01
974500 -- [-498.715] (-494.022) (-496.637) (-495.720) * [-493.610] (-494.295) (-497.482) (-493.772) -- 0:00:01
975000 -- [-494.139] (-498.579) (-495.286) (-498.608) * (-493.784) (-494.284) [-495.225] (-493.698) -- 0:00:01
Average standard deviation of split frequencies: 0.008952
975500 -- [-495.509] (-501.673) (-495.684) (-496.562) * (-495.467) (-497.046) [-496.467] (-498.328) -- 0:00:01
976000 -- (-495.279) [-500.336] (-494.915) (-499.315) * [-493.780] (-496.336) (-493.760) (-493.843) -- 0:00:01
976500 -- [-497.319] (-497.403) (-494.246) (-496.439) * [-494.190] (-495.097) (-495.388) (-501.564) -- 0:00:01
977000 -- [-494.875] (-495.345) (-495.600) (-493.772) * (-498.463) (-494.695) (-495.970) [-501.093] -- 0:00:01
977500 -- (-494.106) (-494.609) (-497.301) [-496.487] * (-498.003) [-495.000] (-499.588) (-496.310) -- 0:00:01
978000 -- [-494.037] (-495.438) (-493.937) (-498.697) * [-493.207] (-493.784) (-495.989) (-495.661) -- 0:00:01
978500 -- (-494.839) [-494.633] (-494.993) (-495.707) * (-496.751) (-496.202) (-495.572) [-494.108] -- 0:00:01
979000 -- (-495.035) (-494.117) [-496.272] (-495.666) * (-497.354) (-498.068) [-497.022] (-494.007) -- 0:00:01
979500 -- (-498.049) (-494.169) (-498.015) [-494.496] * (-494.227) (-501.470) [-496.928] (-495.035) -- 0:00:01
980000 -- [-493.871] (-494.887) (-494.541) (-494.539) * (-493.866) (-496.004) (-495.727) [-495.923] -- 0:00:01
Average standard deviation of split frequencies: 0.009133
980500 -- (-495.700) (-495.073) (-494.739) [-497.327] * (-494.803) (-495.816) (-500.856) [-493.927] -- 0:00:01
981000 -- (-493.855) (-493.990) [-494.647] (-494.766) * [-496.242] (-496.156) (-501.434) (-495.206) -- 0:00:01
981500 -- (-495.797) (-495.283) [-496.024] (-493.845) * [-498.034] (-495.780) (-495.417) (-495.903) -- 0:00:01
982000 -- (-496.188) (-494.749) (-494.546) [-497.893] * (-494.531) (-494.763) (-494.609) [-496.471] -- 0:00:01
982500 -- (-501.838) (-495.677) (-495.112) [-493.722] * [-495.947] (-495.750) (-496.147) (-497.014) -- 0:00:01
983000 -- (-493.578) (-494.972) (-499.738) [-493.921] * (-496.628) (-496.730) [-496.621] (-498.653) -- 0:00:01
983500 -- (-495.970) (-495.794) [-494.265] (-494.131) * [-494.302] (-497.406) (-495.872) (-497.070) -- 0:00:01
984000 -- (-498.328) [-496.567] (-495.315) (-494.353) * (-495.960) (-495.564) [-494.196] (-496.130) -- 0:00:00
984500 -- [-497.160] (-496.425) (-495.216) (-497.191) * [-494.532] (-498.636) (-495.057) (-498.873) -- 0:00:00
985000 -- (-494.871) (-494.445) [-495.984] (-493.586) * (-494.099) [-495.021] (-495.461) (-494.647) -- 0:00:00
Average standard deviation of split frequencies: 0.008861
985500 -- (-495.856) (-494.813) (-494.797) [-495.706] * (-497.484) (-495.899) (-494.030) [-495.138] -- 0:00:00
986000 -- (-493.543) (-496.132) (-494.871) [-496.659] * (-494.962) (-497.221) (-493.969) [-497.352] -- 0:00:00
986500 -- (-493.698) (-496.662) [-494.122] (-498.074) * (-495.589) (-493.958) (-495.141) [-495.717] -- 0:00:00
987000 -- (-497.976) (-496.530) (-495.299) [-494.332] * (-499.856) [-493.424] (-498.010) (-494.609) -- 0:00:00
987500 -- (-494.724) (-496.212) (-495.580) [-494.034] * (-498.660) (-496.464) [-495.962] (-495.005) -- 0:00:00
988000 -- (-498.298) (-496.250) [-495.034] (-497.000) * [-497.428] (-495.823) (-493.990) (-498.140) -- 0:00:00
988500 -- (-499.061) [-495.482] (-495.837) (-498.160) * (-495.153) [-496.284] (-494.311) (-496.009) -- 0:00:00
989000 -- [-494.774] (-496.057) (-497.259) (-497.133) * (-494.340) (-506.341) (-501.252) [-494.828] -- 0:00:00
989500 -- (-498.062) [-496.251] (-497.868) (-495.679) * (-493.843) (-501.495) [-494.001] (-499.744) -- 0:00:00
990000 -- (-495.006) (-499.904) (-497.893) [-494.064] * (-494.488) (-499.526) (-496.959) [-494.065] -- 0:00:00
Average standard deviation of split frequencies: 0.008724
990500 -- (-494.048) [-496.194] (-495.821) (-496.106) * (-494.149) (-498.284) (-497.174) [-494.301] -- 0:00:00
991000 -- [-495.122] (-494.576) (-495.343) (-494.163) * (-494.377) (-498.806) [-496.229] (-495.767) -- 0:00:00
991500 -- (-493.383) (-496.723) [-493.330] (-493.881) * [-494.432] (-496.999) (-495.042) (-495.151) -- 0:00:00
992000 -- (-493.608) (-495.599) [-494.707] (-494.276) * [-495.798] (-496.702) (-495.840) (-497.657) -- 0:00:00
992500 -- (-493.308) (-496.439) (-498.391) [-493.940] * (-495.287) (-495.213) [-495.133] (-495.486) -- 0:00:00
993000 -- (-493.420) (-496.986) (-493.748) [-493.493] * (-494.451) (-496.838) [-494.518] (-494.068) -- 0:00:00
993500 -- (-494.251) (-496.243) [-496.810] (-493.948) * (-495.870) [-497.000] (-497.793) (-496.109) -- 0:00:00
994000 -- (-493.740) (-501.720) (-497.705) [-495.035] * [-495.221] (-495.036) (-499.314) (-499.757) -- 0:00:00
994500 -- [-493.562] (-494.006) (-495.877) (-495.293) * (-497.675) [-495.736] (-497.070) (-495.006) -- 0:00:00
995000 -- [-493.483] (-495.107) (-497.821) (-495.708) * (-497.454) (-498.886) (-500.637) [-496.199] -- 0:00:00
Average standard deviation of split frequencies: 0.008456
995500 -- (-493.575) [-493.827] (-499.045) (-496.726) * (-495.261) (-495.412) [-494.632] (-495.124) -- 0:00:00
996000 -- [-494.323] (-494.344) (-495.692) (-495.614) * (-498.402) [-498.663] (-496.505) (-495.719) -- 0:00:00
996500 -- (-494.012) (-494.438) (-495.552) [-494.980] * (-494.946) [-496.203] (-500.291) (-494.539) -- 0:00:00
997000 -- (-496.230) [-495.587] (-494.572) (-496.222) * (-496.510) (-495.053) (-496.559) [-493.966] -- 0:00:00
997500 -- (-496.253) (-497.428) [-494.035] (-497.018) * [-493.895] (-494.588) (-495.912) (-495.251) -- 0:00:00
998000 -- (-498.560) (-499.680) [-493.555] (-495.203) * (-499.236) [-494.654] (-495.708) (-494.977) -- 0:00:00
998500 -- (-500.907) (-498.098) (-495.424) [-493.946] * (-496.431) (-494.475) [-493.930] (-494.375) -- 0:00:00
999000 -- (-498.066) [-494.406] (-502.197) (-494.816) * (-493.462) (-496.003) [-493.381] (-493.347) -- 0:00:00
999500 -- [-496.885] (-494.744) (-496.759) (-497.472) * (-495.711) (-496.475) (-493.965) [-493.764] -- 0:00:00
1000000 -- (-496.810) (-496.499) [-495.036] (-502.653) * (-495.623) (-495.018) (-498.314) [-493.922] -- 0:00:00
Average standard deviation of split frequencies: 0.008480
Analysis completed in 1 mins 1 seconds
Analysis used 59.97 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -493.05
Likelihood of best state for "cold" chain of run 2 was -493.05
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.6 % ( 36 %) Dirichlet(Pi{all})
36.2 % ( 25 %) Slider(Pi{all})
78.4 % ( 44 %) Multiplier(Alpha{1,2})
77.8 % ( 53 %) Multiplier(Alpha{3})
24.9 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 18 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.2 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
36.5 % ( 39 %) Dirichlet(Pi{all})
36.0 % ( 24 %) Slider(Pi{all})
79.5 % ( 52 %) Multiplier(Alpha{1,2})
77.9 % ( 56 %) Multiplier(Alpha{3})
25.2 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.3 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166477 0.82 0.66
3 | 166986 166844 0.84
4 | 166135 166801 166757
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166892 0.82 0.67
3 | 166444 166507 0.84
4 | 166774 166578 166805
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -494.69
| 1|
| |
| 1 2 2 2 2 2 2 2 |
| 2 21 2 2 1 1 2 2|
| 1 1 1122 2 1 1 2 2 * 1 1 |
|21 2 * 1 2 11 12 1 12 2 12 1 22 |
|121 2 2 1 122 1 12 12 1 2 2 2 2 |
| 1 212 111 12 1 1 1 2 1 |
| 2 1 121 2 1 21 2 |
| 2 2 1 2 1 1 2 1 |
| 21 2 2 2 1 11 1 |
| 1 1 1 |
| 2 |
| 1 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -496.63
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -494.78 -498.19
2 -494.74 -498.17
--------------------------------------
TOTAL -494.76 -498.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889218 0.087391 0.367448 1.487694 0.857250 1296.29 1310.85 1.000
r(A<->C){all} 0.161086 0.019627 0.000031 0.444831 0.117743 126.44 175.91 1.009
r(A<->G){all} 0.169192 0.021735 0.000036 0.473826 0.130860 158.82 200.84 1.000
r(A<->T){all} 0.156645 0.018750 0.000042 0.439001 0.117971 193.91 264.16 1.006
r(C<->G){all} 0.171245 0.020922 0.000009 0.457601 0.134262 67.68 130.50 1.000
r(C<->T){all} 0.168779 0.021605 0.000028 0.473602 0.130351 192.97 286.21 1.001
r(G<->T){all} 0.173054 0.020170 0.000216 0.454459 0.138462 207.69 233.47 1.000
pi(A){all} 0.272595 0.000524 0.229999 0.318082 0.273091 1318.38 1364.60 1.000
pi(C){all} 0.310472 0.000589 0.262863 0.357785 0.310329 1180.32 1243.22 1.000
pi(G){all} 0.259478 0.000527 0.214918 0.304800 0.259293 1048.84 1112.37 1.000
pi(T){all} 0.157454 0.000355 0.119373 0.192416 0.156944 1143.22 1322.11 1.000
alpha{1,2} 0.414527 0.230214 0.000241 1.381482 0.242333 1245.02 1294.78 1.000
alpha{3} 0.451641 0.233510 0.000209 1.444267 0.296687 1266.98 1360.12 1.000
pinvar{all} 0.995570 0.000027 0.985767 0.999999 0.997270 1349.19 1425.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ..****
9 -- ..**..
10 -- ....**
11 -- .**.**
12 -- ..*..*
13 -- .*.*..
14 -- ...*.*
15 -- .*...*
16 -- ..*.*.
17 -- .*.***
18 -- .**...
19 -- ...**.
20 -- .***.*
21 -- .*..*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.016959 0.139907 0.163891 2
8 448 0.149234 0.002827 0.147235 0.151233 2
9 447 0.148901 0.007066 0.143904 0.153897 2
10 446 0.148568 0.007537 0.143238 0.153897 2
11 439 0.146236 0.019315 0.132578 0.159893 2
12 437 0.145570 0.017430 0.133245 0.157895 2
13 437 0.145570 0.014604 0.135243 0.155896 2
14 431 0.143571 0.009893 0.136576 0.150566 2
15 428 0.142572 0.006595 0.137908 0.147235 2
16 427 0.142239 0.005182 0.138574 0.145903 2
17 419 0.139574 0.008951 0.133245 0.145903 2
18 415 0.138241 0.003298 0.135909 0.140573 2
19 412 0.137242 0.001884 0.135909 0.138574 2
20 412 0.137242 0.004711 0.133911 0.140573 2
21 406 0.135243 0.000942 0.134577 0.135909 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098222 0.009587 0.000050 0.296474 0.066207 1.000 2
length{all}[2] 0.098183 0.009681 0.000015 0.289379 0.068933 1.001 2
length{all}[3] 0.097337 0.009996 0.000047 0.296368 0.066273 1.000 2
length{all}[4] 0.099603 0.009890 0.000007 0.295863 0.070215 1.000 2
length{all}[5] 0.096916 0.009781 0.000063 0.288366 0.068902 1.000 2
length{all}[6] 0.102039 0.010073 0.000064 0.303583 0.072231 1.000 2
length{all}[7] 0.105394 0.010891 0.000219 0.315527 0.068924 0.998 2
length{all}[8] 0.091340 0.007358 0.000138 0.263747 0.070030 0.999 2
length{all}[9] 0.098006 0.009416 0.000247 0.289014 0.068165 1.000 2
length{all}[10] 0.101307 0.010645 0.000017 0.300848 0.068031 1.000 2
length{all}[11] 0.103121 0.010114 0.000336 0.280202 0.074666 0.999 2
length{all}[12] 0.089966 0.007296 0.000256 0.262495 0.064239 0.998 2
length{all}[13] 0.101782 0.013237 0.000089 0.341709 0.063486 1.000 2
length{all}[14] 0.098990 0.010892 0.000070 0.322091 0.065615 1.000 2
length{all}[15] 0.094092 0.010527 0.000545 0.305233 0.062258 1.005 2
length{all}[16] 0.098173 0.009043 0.000143 0.280785 0.063805 0.998 2
length{all}[17] 0.099637 0.010436 0.000495 0.307745 0.067019 1.008 2
length{all}[18] 0.099267 0.012580 0.000135 0.316429 0.063063 1.006 2
length{all}[19] 0.103026 0.011075 0.000001 0.324664 0.069919 0.999 2
length{all}[20] 0.097410 0.008624 0.000238 0.263055 0.068842 1.001 2
length{all}[21] 0.094920 0.011739 0.000052 0.283226 0.060805 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008480
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 363
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 121 / 121 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 121 / 121 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021511 0.086520 0.070163 0.021674 0.054780 0.103634 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -517.095318
Iterating by ming2
Initial: fx= 517.095318
x= 0.02151 0.08652 0.07016 0.02167 0.05478 0.10363 0.30000 1.30000
1 h-m-p 0.0000 0.0002 291.7546 +++ 501.798637 m 0.0002 14 | 1/8
2 h-m-p 0.0031 0.0373 15.5541 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 266.9745 ++ 501.701654 m 0.0000 46 | 2/8
4 h-m-p 0.0001 0.0528 13.1266 ----------.. | 2/8
5 h-m-p 0.0000 0.0003 238.3166 +++ 485.883917 m 0.0003 77 | 3/8
6 h-m-p 0.0053 0.0922 10.7578 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 207.2929 ++ 480.316312 m 0.0001 109 | 4/8
8 h-m-p 0.0160 8.0000 8.3618 -------------.. | 4/8
9 h-m-p 0.0000 0.0001 169.4624 ++ 476.348186 m 0.0001 142 | 5/8
10 h-m-p 0.0160 8.0000 6.0470 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 119.9912 ++ 474.260151 m 0.0001 175 | 6/8
12 h-m-p 1.4351 8.0000 0.0000 ++ 474.260151 m 8.0000 186 | 6/8
13 h-m-p 0.6040 8.0000 0.0000 ---C 474.260151 0 0.0024 202 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 474.260151 m 8.0000 242 | 6/8
16 h-m-p 0.0160 8.0000 0.1373 +++++ 474.260144 m 8.0000 258 | 6/8
17 h-m-p 0.4105 8.0000 2.6756 +++ 474.260109 m 8.0000 272 | 6/8
18 h-m-p 1.6000 8.0000 1.7315 ++ 474.260104 m 8.0000 283 | 6/8
19 h-m-p 0.8302 8.0000 16.6843 ++ 474.260096 m 8.0000 294 | 6/8
20 h-m-p 1.6000 8.0000 4.1425 ++ 474.260096 m 8.0000 305 | 6/8
21 h-m-p 0.6888 4.2249 48.1143 ----------C 474.260096 0 0.0000 326 | 6/8
22 h-m-p 1.6000 8.0000 0.0000 --------Y 474.260096 0 0.0000 345 | 6/8
23 h-m-p 0.0160 8.0000 0.0000 -------N 474.260096 0 0.0000 365
Out..
lnL = -474.260096
366 lfun, 366 eigenQcodon, 2196 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106526 0.090892 0.065921 0.040591 0.103255 0.036771 197.018650 0.766298 0.239694
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.137093
np = 9
lnL0 = -525.558472
Iterating by ming2
Initial: fx= 525.558472
x= 0.10653 0.09089 0.06592 0.04059 0.10325 0.03677 197.01865 0.76630 0.23969
1 h-m-p 0.0000 0.0003 272.7168 +++ 501.078627 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0003 100.0408 ++ 498.752413 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 3394.9621 ++ 488.089839 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 5479.7914 ++ 482.895281 m 0.0000 51 | 4/9
5 h-m-p 0.0021 0.0105 7.9926 ------------.. | 4/9
6 h-m-p 0.0000 0.0001 202.4938 ++ 478.084096 m 0.0001 85 | 5/9
7 h-m-p 0.0083 0.3223 2.3125 -------------.. | 5/9
8 h-m-p 0.0000 0.0001 167.9750 ++ 474.714374 m 0.0001 120 | 6/9
9 h-m-p 0.0040 0.1956 3.5507 ------------.. | 6/9
10 h-m-p 0.0000 0.0000 120.6816 ++ 474.260170 m 0.0000 154 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 +Y 474.260170 0 6.4000 167 | 6/9
12 h-m-p 0.0000 0.0000 0.1755
h-m-p: 5.91933200e-17 2.95966600e-16 1.75490713e-01 474.260170
.. | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 474.260170 m 8.0000 196 | 6/9
14 h-m-p 0.0054 2.6832 0.3063 +++++ 474.260139 m 2.6832 214 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 C 474.260139 0 1.6000 229 | 7/9
16 h-m-p 1.5003 8.0000 0.0000 -C 474.260139 0 0.0938 244
Out..
lnL = -474.260139
245 lfun, 735 eigenQcodon, 2940 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011890 0.032743 0.057738 0.101077 0.082938 0.076232 197.018647 0.910480 0.478500 0.205601 56.152007
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.012224
np = 11
lnL0 = -497.385470
Iterating by ming2
Initial: fx= 497.385470
x= 0.01189 0.03274 0.05774 0.10108 0.08294 0.07623 197.01865 0.91048 0.47850 0.20560 56.15201
1 h-m-p 0.0000 0.0003 84.7114 +++ 494.955045 m 0.0003 17 | 1/11
2 h-m-p 0.0020 0.0509 11.9781 +++ 488.013533 m 0.0509 32 | 2/11
3 h-m-p 0.0000 0.0000 105623.2682 ++ 487.571950 m 0.0000 46 | 3/11
4 h-m-p 0.0002 0.0008 203.5492 ++ 485.471110 m 0.0008 60 | 4/11
5 h-m-p 0.0000 0.0001 2340.3966 ++ 484.007975 m 0.0001 74 | 5/11
6 h-m-p 0.0001 0.0006 530.3453 ++ 481.959664 m 0.0006 88 | 6/11
7 h-m-p 0.1559 8.0000 1.9165 ---------------.. | 6/11
8 h-m-p 0.0000 0.0033 36.5742 +++++ 474.260107 m 0.0033 132 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 474.260107 m 8.0000 146 | 7/11
10 h-m-p 0.0391 8.0000 0.0003 ---Y 474.260107 0 0.0002 167
Out..
lnL = -474.260107
168 lfun, 672 eigenQcodon, 3024 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -474.258884 S = -474.257638 -0.000476
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:02
did 20 / 45 patterns 0:02
did 30 / 45 patterns 0:02
did 40 / 45 patterns 0:02
did 45 / 45 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063477 0.108927 0.072432 0.031208 0.107632 0.034544 197.018699 0.618316 1.677141
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.159278
np = 9
lnL0 = -522.833541
Iterating by ming2
Initial: fx= 522.833541
x= 0.06348 0.10893 0.07243 0.03121 0.10763 0.03454 197.01870 0.61832 1.67714
1 h-m-p 0.0000 0.0003 275.0375 +++ 502.035662 m 0.0003 15 | 1/9
2 h-m-p 0.0083 0.0895 8.1725 -------------.. | 1/9
3 h-m-p 0.0000 0.0000 258.2309 ++ 500.122758 m 0.0000 50 | 2/9
4 h-m-p 0.0012 0.1486 5.2599 -----------.. | 2/9
5 h-m-p 0.0000 0.0003 229.9143 +++ 486.538251 m 0.0003 84 | 3/9
6 h-m-p 0.0143 0.2445 3.5176 -------------.. | 3/9
7 h-m-p 0.0000 0.0001 203.6519 ++ 483.276723 m 0.0001 119 | 4/9
8 h-m-p 0.0066 1.4676 1.9429 ------------.. | 4/9
9 h-m-p 0.0000 0.0003 166.1775 +++ 474.429913 m 0.0003 154 | 5/9
10 h-m-p 0.0229 2.2550 1.6198 -------------.. | 5/9
11 h-m-p 0.0000 0.0000 121.1822 ++ 474.260174 m 0.0000 189 | 6/9
12 h-m-p 0.0925 8.0000 0.0000 Y 474.260174 0 0.0925 201 | 6/9
13 h-m-p 0.7233 8.0000 0.0000 Y 474.260174 0 1.8750 216
Out..
lnL = -474.260174
217 lfun, 2387 eigenQcodon, 13020 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.054850 0.055817 0.051039 0.013251 0.043275 0.074289 197.018699 0.900000 0.813325 1.767054 51.285151
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.024341
np = 11
lnL0 = -490.484978
Iterating by ming2
Initial: fx= 490.484978
x= 0.05485 0.05582 0.05104 0.01325 0.04327 0.07429 197.01870 0.90000 0.81333 1.76705 51.28515
1 h-m-p 0.0000 0.0004 82.2614 +++ 487.556067 m 0.0004 17 | 1/11
2 h-m-p 0.0000 0.0002 438.2600 +YYYCCC 483.347003 5 0.0002 39 | 1/11
3 h-m-p 0.0016 0.0078 7.5175 ++ 483.000672 m 0.0078 53 | 2/11
4 h-m-p 0.0000 0.0001 774.0414 ++ 480.582515 m 0.0001 67 | 3/11
5 h-m-p 0.0002 0.0010 24.0399 ++ 480.191574 m 0.0010 81 | 4/11
6 h-m-p 0.0001 0.0004 97.7472 ++ 477.635906 m 0.0004 95 | 5/11
7 h-m-p 0.0122 0.1586 1.5309 -------------.. | 5/11
8 h-m-p 0.0000 0.0005 78.2899 +++ 474.260126 m 0.0005 135 | 6/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 474.260126 m 8.0000 149 | 6/11
10 h-m-p 0.0160 8.0000 0.0217 ---------N 474.260126 0 0.0000 177 | 6/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 474.260126 m 8.0000 199 | 6/11
12 h-m-p 0.0160 8.0000 0.4101 +++++ 474.260101 m 8.0000 221 | 6/11
13 h-m-p 1.6000 8.0000 0.1575 ++ 474.260100 m 8.0000 240 | 6/11
14 h-m-p 0.6841 8.0000 1.8418 ++ 474.260096 m 8.0000 259 | 6/11
15 h-m-p 0.1842 0.9211 1.2874 ++ 474.260096 m 0.9211 273 | 7/11
16 h-m-p 1.6000 8.0000 0.4538 ++ 474.260096 m 8.0000 287 | 7/11
17 h-m-p 0.3734 1.8671 9.5909 ++ 474.260096 m 1.8671 305 | 7/11
18 h-m-p 0.0000 0.0000 25.7303
h-m-p: 8.35536247e-18 4.17768124e-17 2.57302857e+01 474.260096
.. | 7/11
19 h-m-p 0.0160 8.0000 0.0000 -Y 474.260096 0 0.0010 331
QuantileBeta(0.15, 0.00494, 1.02109) = 3.912775e-162 2000 rounds
| 7/11
20 h-m-p 0.0362 8.0000 0.0000 Y 474.260096 0 0.0163 349
Out..
lnL = -474.260096
350 lfun, 4200 eigenQcodon, 23100 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -474.257477 S = -474.257303 -0.000076
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:12
did 20 / 45 patterns 0:13
did 30 / 45 patterns 0:13
did 40 / 45 patterns 0:13
did 45 / 45 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=121
NC_011896_1_WP_010907500_1_66_MLBR_RS00330 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
NC_002677_1_NP_301175_1_47_hns MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
**************************************************
NC_011896_1_WP_010907500_1_66_MLBR_RS00330 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
NC_002677_1_NP_301175_1_47_hns SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
**************************************************
NC_011896_1_WP_010907500_1_66_MLBR_RS00330 LVIALAIGLLALLLIHQLRRR
NC_002677_1_NP_301175_1_47_hns LVIALAIGLLALLLIHQLRRR
NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065 LVIALAIGLLALLLIHQLRRR
NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250 LVIALAIGLLALLLIHQLRRR
NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335 LVIALAIGLLALLLIHQLRRR
NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350 LVIALAIGLLALLLIHQLRRR
*********************
>NC_011896_1_WP_010907500_1_66_MLBR_RS00330 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA ACTGCGACGTCGC >NC_002677_1_NP_301175_1_47_hns ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA ACTGCGACGTCGC >NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA ACTGCGACGTCGC >NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA ACTGCGACGTCGC >NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA ACTGCGACGTCGC >NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA ACTGCGACGTCGC
>NC_011896_1_WP_010907500_1_66_MLBR_RS00330 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA LVIALAIGLLALLLIHQLRRR >NC_002677_1_NP_301175_1_47_hns MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA LVIALAIGLLALLLIHQLRRR >NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA LVIALAIGLLALLLIHQLRRR >NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA LVIALAIGLLALLLIHQLRRR >NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA LVIALAIGLLALLLIHQLRRR >NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA LVIALAIGLLALLLIHQLRRR
#NEXUS
[ID: 0784610423]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907500_1_66_MLBR_RS00330
NC_002677_1_NP_301175_1_47_hns
NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065
NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250
NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335
NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907500_1_66_MLBR_RS00330,
2 NC_002677_1_NP_301175_1_47_hns,
3 NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065,
4 NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250,
5 NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335,
6 NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06620714,2:0.06893256,3:0.06627319,4:0.07021548,5:0.06890159,6:0.07223117);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06620714,2:0.06893256,3:0.06627319,4:0.07021548,5:0.06890159,6:0.07223117);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -494.78 -498.19
2 -494.74 -498.17
--------------------------------------
TOTAL -494.76 -498.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889218 0.087391 0.367448 1.487694 0.857250 1296.29 1310.85 1.000
r(A<->C){all} 0.161086 0.019627 0.000031 0.444831 0.117743 126.44 175.91 1.009
r(A<->G){all} 0.169192 0.021735 0.000036 0.473826 0.130860 158.82 200.84 1.000
r(A<->T){all} 0.156645 0.018750 0.000042 0.439001 0.117971 193.91 264.16 1.006
r(C<->G){all} 0.171245 0.020922 0.000009 0.457601 0.134262 67.68 130.50 1.000
r(C<->T){all} 0.168779 0.021605 0.000028 0.473602 0.130351 192.97 286.21 1.001
r(G<->T){all} 0.173054 0.020170 0.000216 0.454459 0.138462 207.69 233.47 1.000
pi(A){all} 0.272595 0.000524 0.229999 0.318082 0.273091 1318.38 1364.60 1.000
pi(C){all} 0.310472 0.000589 0.262863 0.357785 0.310329 1180.32 1243.22 1.000
pi(G){all} 0.259478 0.000527 0.214918 0.304800 0.259293 1048.84 1112.37 1.000
pi(T){all} 0.157454 0.000355 0.119373 0.192416 0.156944 1143.22 1322.11 1.000
alpha{1,2} 0.414527 0.230214 0.000241 1.381482 0.242333 1245.02 1294.78 1.000
alpha{3} 0.451641 0.233510 0.000209 1.444267 0.296687 1266.98 1360.12 1.000
pinvar{all} 0.995570 0.000027 0.985767 0.999999 0.997270 1349.19 1425.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/hns/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 121
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 5 5 5 5 5 5 | CGA 2 2 2 2 2 2
CTG 8 8 8 8 8 8 | CCG 5 5 5 5 5 5 | CAG 5 5 5 5 5 5 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 2 2 2 2 2 2
ATC 4 4 4 4 4 4 | ACC 0 0 0 0 0 0 | AAC 4 4 4 4 4 4 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 7 7 7 7 7 7 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 6 6 6 6 6 6 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 1 1 1 1 1 1 | GCC 6 6 6 6 6 6 | GAC 3 3 3 3 3 3 | GGC 1 1 1 1 1 1
GTA 3 3 3 3 3 3 | GCA 6 6 6 6 6 6 | Glu GAA 4 4 4 4 4 4 | GGA 1 1 1 1 1 1
GTG 1 1 1 1 1 1 | GCG 5 5 5 5 5 5 | GAG 2 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907500_1_66_MLBR_RS00330
position 1: T:0.05785 C:0.33058 A:0.23140 G:0.38017
position 2: T:0.21488 C:0.36364 A:0.29752 G:0.12397
position 3: T:0.19835 C:0.23967 A:0.28926 G:0.27273
Average T:0.15702 C:0.31129 A:0.27273 G:0.25895
#2: NC_002677_1_NP_301175_1_47_hns
position 1: T:0.05785 C:0.33058 A:0.23140 G:0.38017
position 2: T:0.21488 C:0.36364 A:0.29752 G:0.12397
position 3: T:0.19835 C:0.23967 A:0.28926 G:0.27273
Average T:0.15702 C:0.31129 A:0.27273 G:0.25895
#3: NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065
position 1: T:0.05785 C:0.33058 A:0.23140 G:0.38017
position 2: T:0.21488 C:0.36364 A:0.29752 G:0.12397
position 3: T:0.19835 C:0.23967 A:0.28926 G:0.27273
Average T:0.15702 C:0.31129 A:0.27273 G:0.25895
#4: NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250
position 1: T:0.05785 C:0.33058 A:0.23140 G:0.38017
position 2: T:0.21488 C:0.36364 A:0.29752 G:0.12397
position 3: T:0.19835 C:0.23967 A:0.28926 G:0.27273
Average T:0.15702 C:0.31129 A:0.27273 G:0.25895
#5: NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335
position 1: T:0.05785 C:0.33058 A:0.23140 G:0.38017
position 2: T:0.21488 C:0.36364 A:0.29752 G:0.12397
position 3: T:0.19835 C:0.23967 A:0.28926 G:0.27273
Average T:0.15702 C:0.31129 A:0.27273 G:0.25895
#6: NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350
position 1: T:0.05785 C:0.33058 A:0.23140 G:0.38017
position 2: T:0.21488 C:0.36364 A:0.29752 G:0.12397
position 3: T:0.19835 C:0.23967 A:0.28926 G:0.27273
Average T:0.15702 C:0.31129 A:0.27273 G:0.25895
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 6 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 0 | Arg R CGT 6
CTC 6 | CCC 18 | CAC 6 | CGC 6
CTA 6 | CCA 12 | Gln Q CAA 30 | CGA 12
CTG 48 | CCG 30 | CAG 30 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 12
ATC 24 | ACC 0 | AAC 24 | AGC 18
ATA 0 | ACA 6 | Lys K AAA 42 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 36 | Asp D GAT 6 | Gly G GGT 18
GTC 6 | GCC 36 | GAC 18 | GGC 6
GTA 18 | GCA 36 | Glu E GAA 24 | GGA 6
GTG 6 | GCG 30 | GAG 12 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.05785 C:0.33058 A:0.23140 G:0.38017
position 2: T:0.21488 C:0.36364 A:0.29752 G:0.12397
position 3: T:0.19835 C:0.23967 A:0.28926 G:0.27273
Average T:0.15702 C:0.31129 A:0.27273 G:0.25895
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -474.260096 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 197.018650 51.285151
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907500_1_66_MLBR_RS00330: 0.000004, NC_002677_1_NP_301175_1_47_hns: 0.000004, NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065: 0.000004, NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250: 0.000004, NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335: 0.000004, NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 197.01865
omega (dN/dS) = 51.28515
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.6 144.4 51.2852 0.0000 0.0000 0.0 0.0
7..2 0.000 218.6 144.4 51.2852 0.0000 0.0000 0.0 0.0
7..3 0.000 218.6 144.4 51.2852 0.0000 0.0000 0.0 0.0
7..4 0.000 218.6 144.4 51.2852 0.0000 0.0000 0.0 0.0
7..5 0.000 218.6 144.4 51.2852 0.0000 0.0000 0.0 0.0
7..6 0.000 218.6 144.4 51.2852 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -474.260139 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 197.018647 0.000010 0.462490
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907500_1_66_MLBR_RS00330: 0.000004, NC_002677_1_NP_301175_1_47_hns: 0.000004, NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065: 0.000004, NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250: 0.000004, NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335: 0.000004, NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 197.01865
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.46249 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.6 144.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 218.6 144.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 218.6 144.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 218.6 144.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 218.6 144.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 218.6 144.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -474.260107 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 197.018699 0.681575 0.235322 0.000001 56.166413
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907500_1_66_MLBR_RS00330: 0.000004, NC_002677_1_NP_301175_1_47_hns: 0.000004, NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065: 0.000004, NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250: 0.000004, NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335: 0.000004, NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 197.01870
MLEs of dN/dS (w) for site classes (K=3)
p: 0.68158 0.23532 0.08310
w: 0.00000 1.00000 56.16641
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.6 144.4 4.9029 0.0000 0.0000 0.0 0.0
7..2 0.000 218.6 144.4 4.9029 0.0000 0.0000 0.0 0.0
7..3 0.000 218.6 144.4 4.9029 0.0000 0.0000 0.0 0.0
7..4 0.000 218.6 144.4 4.9029 0.0000 0.0000 0.0 0.0
7..5 0.000 218.6 144.4 4.9029 0.0000 0.0000 0.0 0.0
7..6 0.000 218.6 144.4 4.9029 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907500_1_66_MLBR_RS00330)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907500_1_66_MLBR_RS00330)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -474.260174 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 197.018699 0.618234 1.677047
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907500_1_66_MLBR_RS00330: 0.000004, NC_002677_1_NP_301175_1_47_hns: 0.000004, NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065: 0.000004, NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250: 0.000004, NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335: 0.000004, NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 197.01870
Parameters in M7 (beta):
p = 0.61823 q = 1.67705
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00439 0.02617 0.06069 0.10670 0.16440 0.23497 0.32085 0.42680 0.56320 0.76407
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.6 144.4 0.2672 0.0000 0.0000 0.0 0.0
7..2 0.000 218.6 144.4 0.2672 0.0000 0.0000 0.0 0.0
7..3 0.000 218.6 144.4 0.2672 0.0000 0.0000 0.0 0.0
7..4 0.000 218.6 144.4 0.2672 0.0000 0.0000 0.0 0.0
7..5 0.000 218.6 144.4 0.2672 0.0000 0.0000 0.0 0.0
7..6 0.000 218.6 144.4 0.2672 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -474.260096 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 197.052739 0.000010 0.005000 1.021089 51.359711
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907500_1_66_MLBR_RS00330: 0.000004, NC_002677_1_NP_301175_1_47_hns: 0.000004, NZ_LVXE01000014_1_WP_010907500_1_512_A3216_RS06065: 0.000004, NZ_LYPH01000018_1_WP_010907500_1_689_A8144_RS03250: 0.000004, NZ_CP029543_1_WP_010907500_1_64_DIJ64_RS00335: 0.000004, NZ_AP014567_1_WP_010907500_1_67_JK2ML_RS00350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 197.05274
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.02109
(p1 = 0.99999) w = 51.35971
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 51.35971
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 218.6 144.4 51.3592 0.0000 0.0000 0.0 0.0
7..2 0.000 218.6 144.4 51.3592 0.0000 0.0000 0.0 0.0
7..3 0.000 218.6 144.4 51.3592 0.0000 0.0000 0.0 0.0
7..4 0.000 218.6 144.4 51.3592 0.0000 0.0000 0.0 0.0
7..5 0.000 218.6 144.4 51.3592 0.0000 0.0000 0.0 0.0
7..6 0.000 218.6 144.4 51.3592 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907500_1_66_MLBR_RS00330)
Pr(w>1) post mean +- SE for w
1 M 1.000** 51.359
2 A 1.000** 51.359
3 D 1.000** 51.359
4 Q 1.000** 51.359
5 Q 1.000** 51.359
6 N 1.000** 51.359
7 P 1.000** 51.359
8 P 1.000** 51.359
9 N 1.000** 51.359
10 S 1.000** 51.359
11 E 1.000** 51.359
12 P 1.000** 51.359
13 D 1.000** 51.359
14 G 1.000** 51.359
15 T 1.000** 51.359
16 S 1.000** 51.359
17 T 1.000** 51.359
18 L 1.000** 51.359
19 P 1.000** 51.359
20 A 1.000** 51.359
21 K 1.000** 51.359
22 K 1.000** 51.359
23 V 1.000** 51.359
24 P 1.000** 51.359
25 A 1.000** 51.359
26 K 1.000** 51.359
27 A 1.000** 51.359
28 A 1.000** 51.359
29 K 1.000** 51.359
30 A 1.000** 51.359
31 P 1.000** 51.359
32 A 1.000** 51.359
33 K 1.000** 51.359
34 K 1.000** 51.359
35 A 1.000** 51.359
36 P 1.000** 51.359
37 P 1.000** 51.359
38 K 1.000** 51.359
39 S 1.000** 51.359
40 P 1.000** 51.359
41 S 1.000** 51.359
42 F 1.000** 51.359
43 A 1.000** 51.359
44 S 1.000** 51.359
45 P 1.000** 51.359
46 Q 1.000** 51.359
47 A 1.000** 51.359
48 A 1.000** 51.359
49 N 1.000** 51.359
50 Q 1.000** 51.359
51 S 1.000** 51.359
52 L 1.000** 51.359
53 G 1.000** 51.359
54 L 1.000** 51.359
55 Q 1.000** 51.359
56 Q 1.000** 51.359
57 R 1.000** 51.359
58 I 1.000** 51.359
59 E 1.000** 51.359
60 T 1.000** 51.359
61 N 1.000** 51.359
62 G 1.000** 51.359
63 Q 1.000** 51.359
64 L 1.000** 51.359
65 D 1.000** 51.359
66 V 1.000** 51.359
67 A 1.000** 51.359
68 K 1.000** 51.359
69 D 1.000** 51.359
70 V 1.000** 51.359
71 A 1.000** 51.359
72 E 1.000** 51.359
73 Q 1.000** 51.359
74 A 1.000** 51.359
75 Q 1.000** 51.359
76 S 1.000** 51.359
77 A 1.000** 51.359
78 V 1.000** 51.359
79 E 1.000** 51.359
80 G 1.000** 51.359
81 A 1.000** 51.359
82 S 1.000** 51.359
83 N 1.000** 51.359
84 P 1.000** 51.359
85 V 1.000** 51.359
86 P 1.000** 51.359
87 N 1.000** 51.359
88 G 1.000** 51.359
89 A 1.000** 51.359
90 E 1.000** 51.359
91 A 1.000** 51.359
92 L 1.000** 51.359
93 E 1.000** 51.359
94 A 1.000** 51.359
95 S 1.000** 51.359
96 N 1.000** 51.359
97 S 1.000** 51.359
98 P 1.000** 51.359
99 V 1.000** 51.359
100 A 1.000** 51.359
101 L 1.000** 51.359
102 V 1.000** 51.359
103 I 1.000** 51.359
104 A 1.000** 51.359
105 L 1.000** 51.359
106 A 1.000** 51.359
107 I 1.000** 51.359
108 G 1.000** 51.359
109 L 1.000** 51.359
110 L 1.000** 51.359
111 A 1.000** 51.359
112 L 1.000** 51.359
113 L 1.000** 51.359
114 L 1.000** 51.359
115 I 1.000** 51.359
116 H 1.000** 51.359
117 Q 1.000** 51.359
118 L 1.000** 51.359
119 R 1.000** 51.359
120 R 1.000** 51.359
121 R 1.000** 51.359
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907500_1_66_MLBR_RS00330)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -474.260139 Model 2: PositiveSelection -474.260107 Model 0: one-ratio -474.260096 Model 7: beta -474.260174 Model 8: beta&w>1 -474.260096 Model 0 vs 1 8.600000001024455E-5 Model 2 vs 1 6.399999995210237E-5 Model 8 vs 7 1.560000000608852E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
