--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:09:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/hns/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -494.78 -498.19
2 -494.74 -498.17
--------------------------------------
TOTAL -494.76 -498.18
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889218 0.087391 0.367448 1.487694 0.857250 1296.29 1310.85 1.000
r(A<->C){all} 0.161086 0.019627 0.000031 0.444831 0.117743 126.44 175.91 1.009
r(A<->G){all} 0.169192 0.021735 0.000036 0.473826 0.130860 158.82 200.84 1.000
r(A<->T){all} 0.156645 0.018750 0.000042 0.439001 0.117971 193.91 264.16 1.006
r(C<->G){all} 0.171245 0.020922 0.000009 0.457601 0.134262 67.68 130.50 1.000
r(C<->T){all} 0.168779 0.021605 0.000028 0.473602 0.130351 192.97 286.21 1.001
r(G<->T){all} 0.173054 0.020170 0.000216 0.454459 0.138462 207.69 233.47 1.000
pi(A){all} 0.272595 0.000524 0.229999 0.318082 0.273091 1318.38 1364.60 1.000
pi(C){all} 0.310472 0.000589 0.262863 0.357785 0.310329 1180.32 1243.22 1.000
pi(G){all} 0.259478 0.000527 0.214918 0.304800 0.259293 1048.84 1112.37 1.000
pi(T){all} 0.157454 0.000355 0.119373 0.192416 0.156944 1143.22 1322.11 1.000
alpha{1,2} 0.414527 0.230214 0.000241 1.381482 0.242333 1245.02 1294.78 1.000
alpha{3} 0.451641 0.233510 0.000209 1.444267 0.296687 1266.98 1360.12 1.000
pinvar{all} 0.995570 0.000027 0.985767 0.999999 0.997270 1349.19 1425.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -474.260139
Model 2: PositiveSelection -474.260107
Model 0: one-ratio -474.260096
Model 7: beta -474.260174
Model 8: beta&w>1 -474.260096
Model 0 vs 1 8.600000001024455E-5
Model 2 vs 1 6.399999995210237E-5
Model 8 vs 7 1.560000000608852E-4
>C1
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C2
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C3
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C4
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C5
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C6
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=121
C1 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C2 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C3 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C4 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C5 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C6 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
**************************************************
C1 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C2 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C3 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C4 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C5 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C6 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
**************************************************
C1 LVIALAIGLLALLLIHQLRRR
C2 LVIALAIGLLALLLIHQLRRR
C3 LVIALAIGLLALLLIHQLRRR
C4 LVIALAIGLLALLLIHQLRRR
C5 LVIALAIGLLALLLIHQLRRR
C6 LVIALAIGLLALLLIHQLRRR
*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 121 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 121 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3630]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3630]--->[3630]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.459 Mb, Max= 30.649 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C2 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C3 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C4 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C5 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
C6 MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
**************************************************
C1 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C2 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C3 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C4 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C5 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
C6 SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
**************************************************
C1 LVIALAIGLLALLLIHQLRRR
C2 LVIALAIGLLALLLIHQLRRR
C3 LVIALAIGLLALLLIHQLRRR
C4 LVIALAIGLLALLLIHQLRRR
C5 LVIALAIGLLALLLIHQLRRR
C6 LVIALAIGLLALLLIHQLRRR
*********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C2 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C3 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C4 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C5 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
C6 ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
**************************************************
C1 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C2 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C3 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C4 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C5 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
C6 ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
**************************************************
C1 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C2 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C3 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C4 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C5 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
C6 AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
**************************************************
C1 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C2 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C3 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C4 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C5 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
C6 TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
**************************************************
C1 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C2 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C3 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C4 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C5 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
C6 TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
**************************************************
C1 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C2 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C3 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C4 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C5 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
C6 CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
**************************************************
C1 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C2 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C3 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C4 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C5 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
C6 CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
**************************************************
C1 ACTGCGACGTCGC
C2 ACTGCGACGTCGC
C3 ACTGCGACGTCGC
C4 ACTGCGACGTCGC
C5 ACTGCGACGTCGC
C6 ACTGCGACGTCGC
*************
>C1
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C2
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C3
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C4
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C5
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C6
ATGGCAGACCAGCAAAATCCACCTAACAGTGAACCCGACGGAACGTCGAC
ACTGCCGGCTAAGAAAGTACCCGCCAAAGCCGCTAAAGCACCGGCCAAAA
AAGCTCCACCTAAAAGCCCTAGTTTCGCATCACCGCAGGCAGCCAACCAA
TCGCTCGGTCTGCAGCAGCGAATCGAAACTAACGGCCAACTTGATGTTGC
TAAAGACGTTGCGGAACAAGCGCAGTCAGCCGTAGAGGGGGCTAGCAATC
CGGTCCCCAACGGTGCTGAGGCGCTGGAAGCGAGCAATTCACCGGTAGCA
CTGGTGATCGCGTTGGCAATCGGTCTACTGGCCCTGCTGCTTATCCACCA
ACTGCGACGTCGC
>C1
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C2
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C3
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C4
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C5
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
>C6
MADQQNPPNSEPDGTSTLPAKKVPAKAAKAPAKKAPPKSPSFASPQAANQ
SLGLQQRIETNGQLDVAKDVAEQAQSAVEGASNPVPNGAEALEASNSPVA
LVIALAIGLLALLLIHQLRRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 363 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792079
Setting output file names to "/data/2res/hns/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 823643415
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0784610423
Seed = 1378701065
Swapseed = 1579792079
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -812.411407 -- -24.965149
Chain 2 -- -812.411407 -- -24.965149
Chain 3 -- -812.411361 -- -24.965149
Chain 4 -- -812.411361 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -812.411361 -- -24.965149
Chain 2 -- -812.411407 -- -24.965149
Chain 3 -- -812.411407 -- -24.965149
Chain 4 -- -812.411407 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-812.411] (-812.411) (-812.411) (-812.411) * [-812.411] (-812.411) (-812.411) (-812.411)
500 -- (-505.342) [-511.110] (-507.299) (-508.923) * (-510.249) (-503.605) (-504.072) [-506.067] -- 0:00:00
1000 -- [-505.762] (-506.410) (-504.440) (-515.438) * (-507.689) (-504.611) [-499.370] (-502.561) -- 0:00:00
1500 -- (-505.006) [-506.611] (-504.855) (-504.890) * (-506.631) [-505.584] (-508.499) (-503.673) -- 0:00:00
2000 -- (-501.323) (-503.393) (-505.121) [-500.371] * (-504.649) (-505.735) [-502.709] (-507.959) -- 0:00:00
2500 -- (-512.695) (-509.282) [-503.514] (-503.371) * (-515.722) (-502.035) (-511.633) [-504.621] -- 0:00:00
3000 -- (-506.526) [-503.315] (-502.306) (-504.687) * (-504.641) [-505.348] (-505.142) (-509.936) -- 0:00:00
3500 -- (-504.603) (-503.357) (-504.082) [-508.148] * [-506.285] (-509.000) (-497.271) (-509.471) -- 0:00:00
4000 -- (-510.841) (-504.128) (-504.278) [-503.991] * (-506.736) (-508.776) [-501.580] (-515.601) -- 0:00:00
4500 -- (-503.478) (-504.948) (-519.013) [-500.941] * (-509.373) [-505.126] (-501.174) (-509.361) -- 0:00:00
5000 -- (-506.943) (-508.571) [-509.899] (-506.202) * (-496.940) (-505.328) [-504.110] (-504.811) -- 0:00:00
Average standard deviation of split frequencies: 0.085710
5500 -- (-514.823) [-508.997] (-515.542) (-507.309) * (-500.495) (-498.950) (-512.624) [-506.058] -- 0:00:00
6000 -- (-506.690) [-502.291] (-510.019) (-503.029) * [-507.392] (-508.950) (-502.643) (-511.771) -- 0:00:00
6500 -- (-503.366) [-499.985] (-519.608) (-500.072) * (-498.354) (-504.326) [-495.406] (-503.489) -- 0:00:00
7000 -- [-501.876] (-503.550) (-512.722) (-511.450) * (-510.475) [-499.475] (-495.245) (-510.103) -- 0:00:00
7500 -- (-503.331) (-505.498) [-496.658] (-508.366) * (-499.916) [-505.803] (-497.671) (-509.334) -- 0:00:00
8000 -- (-508.747) (-513.538) (-495.390) [-506.878] * (-506.256) [-504.729] (-496.375) (-511.794) -- 0:00:00
8500 -- (-503.477) [-506.014] (-494.142) (-510.113) * (-504.255) [-500.859] (-495.275) (-507.513) -- 0:00:00
9000 -- (-503.871) [-506.528] (-496.406) (-505.410) * (-501.839) [-503.977] (-494.924) (-508.711) -- 0:00:00
9500 -- (-506.550) (-507.692) [-494.324] (-504.205) * [-500.803] (-501.516) (-498.492) (-510.612) -- 0:00:00
10000 -- (-508.394) (-514.274) [-493.544] (-501.821) * (-507.575) [-503.135] (-493.851) (-513.068) -- 0:00:00
Average standard deviation of split frequencies: 0.067344
10500 -- (-510.762) [-501.686] (-494.935) (-501.592) * (-498.129) (-515.337) (-496.795) [-504.208] -- 0:00:00
11000 -- [-501.366] (-507.868) (-495.856) (-516.009) * (-506.263) (-509.199) [-495.111] (-502.722) -- 0:00:00
11500 -- (-504.975) (-503.219) [-495.227] (-513.096) * [-501.743] (-500.975) (-493.378) (-505.045) -- 0:00:00
12000 -- (-506.175) (-509.255) [-494.517] (-516.429) * (-503.739) (-496.598) [-494.811] (-512.427) -- 0:00:00
12500 -- [-497.655] (-500.388) (-497.612) (-508.522) * (-511.723) [-503.190] (-495.882) (-509.118) -- 0:01:19
13000 -- [-497.223] (-506.786) (-495.025) (-504.964) * (-499.661) (-501.080) [-497.147] (-506.342) -- 0:01:15
13500 -- [-495.166] (-511.794) (-495.756) (-506.211) * (-505.318) [-501.571] (-495.301) (-507.919) -- 0:01:13
14000 -- (-494.819) (-500.726) (-495.480) [-500.009] * (-510.726) (-499.416) (-498.910) [-500.903] -- 0:01:10
14500 -- (-494.498) (-500.957) (-494.139) [-505.652] * (-511.169) [-507.438] (-494.830) (-503.954) -- 0:01:07
15000 -- (-495.462) (-504.360) (-494.949) [-504.033] * (-512.130) (-506.078) [-497.385] (-506.728) -- 0:01:05
Average standard deviation of split frequencies: 0.061604
15500 -- (-494.794) (-501.458) [-495.308] (-513.839) * (-503.562) (-502.902) (-498.979) [-502.758] -- 0:01:03
16000 -- (-493.635) (-509.681) [-495.106] (-504.690) * (-504.226) (-504.754) (-499.735) [-503.885] -- 0:01:01
16500 -- (-494.720) [-503.649] (-500.312) (-507.045) * [-497.604] (-508.741) (-496.040) (-504.936) -- 0:00:59
17000 -- (-496.253) (-507.605) (-498.126) [-504.344] * (-494.335) [-498.868] (-494.975) (-509.503) -- 0:00:57
17500 -- [-494.860] (-502.641) (-495.139) (-499.330) * (-496.161) (-501.405) [-496.955] (-502.478) -- 0:00:56
18000 -- (-500.017) (-500.227) [-496.017] (-501.885) * (-494.558) [-500.372] (-497.836) (-508.429) -- 0:00:54
18500 -- (-495.392) (-502.558) (-493.744) [-505.726] * (-494.982) [-500.976] (-501.600) (-502.134) -- 0:00:53
19000 -- (-499.261) [-499.218] (-493.777) (-504.558) * (-496.252) (-501.592) [-494.561] (-504.981) -- 0:00:51
19500 -- [-493.571] (-502.189) (-494.929) (-501.686) * (-496.838) [-501.154] (-494.511) (-503.844) -- 0:00:50
20000 -- (-494.079) (-505.585) [-494.010] (-510.340) * (-496.171) [-500.967] (-495.587) (-503.233) -- 0:00:49
Average standard deviation of split frequencies: 0.064404
20500 -- (-502.592) (-506.562) [-494.434] (-500.165) * (-493.357) (-501.494) [-494.693] (-506.365) -- 0:00:47
21000 -- (-495.567) [-500.462] (-495.716) (-500.471) * (-495.019) [-507.187] (-497.176) (-517.446) -- 0:00:46
21500 -- (-495.083) [-504.696] (-495.859) (-503.750) * (-496.306) [-503.731] (-494.619) (-510.780) -- 0:00:45
22000 -- (-494.663) (-500.722) (-494.574) [-499.772] * (-496.810) (-500.768) [-495.433] (-495.161) -- 0:00:44
22500 -- (-494.001) (-502.156) (-498.427) [-507.466] * (-497.719) (-506.995) (-496.365) [-495.600] -- 0:00:43
23000 -- (-496.074) (-505.681) (-497.938) [-504.592] * (-494.668) (-505.443) (-495.144) [-496.805] -- 0:00:42
23500 -- (-496.228) (-502.791) (-494.204) [-504.245] * [-493.923] (-509.561) (-497.958) (-498.195) -- 0:00:41
24000 -- (-499.813) [-501.256] (-498.447) (-510.514) * [-495.046] (-506.849) (-495.539) (-496.611) -- 0:00:40
24500 -- (-502.676) [-506.142] (-495.071) (-507.607) * [-493.634] (-503.378) (-497.711) (-497.715) -- 0:00:39
25000 -- (-494.197) (-501.349) [-494.163] (-501.191) * [-494.407] (-505.552) (-493.448) (-494.115) -- 0:00:39
Average standard deviation of split frequencies: 0.052580
25500 -- (-493.667) [-507.199] (-495.912) (-508.169) * [-493.859] (-501.120) (-494.749) (-495.451) -- 0:00:38
26000 -- [-494.392] (-514.243) (-496.659) (-494.473) * (-493.924) (-505.807) (-494.330) [-496.671] -- 0:00:37
26500 -- [-497.166] (-505.221) (-495.390) (-495.694) * [-496.430] (-506.736) (-494.474) (-496.331) -- 0:00:36
27000 -- (-504.365) (-512.958) (-498.583) [-494.882] * (-494.876) [-499.849] (-494.672) (-493.340) -- 0:00:36
27500 -- (-496.178) (-499.604) [-493.547] (-493.976) * (-494.549) (-501.928) [-494.061] (-494.435) -- 0:01:10
28000 -- (-496.720) (-512.458) (-496.048) [-494.067] * [-497.197] (-512.428) (-501.096) (-496.546) -- 0:01:09
28500 -- (-494.524) (-508.865) (-497.500) [-494.256] * [-496.110] (-511.198) (-498.445) (-494.914) -- 0:01:08
29000 -- [-494.119] (-510.236) (-496.329) (-494.496) * (-494.600) [-503.146] (-498.056) (-495.884) -- 0:01:06
29500 -- (-494.539) (-506.925) (-496.792) [-498.891] * [-496.968] (-502.480) (-496.275) (-496.432) -- 0:01:05
30000 -- [-495.239] (-509.081) (-495.653) (-497.973) * (-496.926) (-511.276) [-496.060] (-496.208) -- 0:01:04
Average standard deviation of split frequencies: 0.049190
30500 -- [-493.423] (-510.385) (-495.488) (-499.753) * (-499.713) (-507.079) [-495.105] (-493.702) -- 0:01:03
31000 -- (-494.180) [-506.768] (-496.909) (-499.597) * (-494.697) [-510.262] (-494.447) (-494.894) -- 0:01:02
31500 -- (-493.800) [-510.333] (-493.633) (-496.369) * (-496.515) [-506.595] (-494.040) (-498.154) -- 0:01:01
32000 -- [-493.762] (-508.432) (-497.472) (-497.322) * [-494.159] (-500.178) (-494.069) (-500.576) -- 0:01:00
32500 -- [-498.239] (-503.699) (-500.785) (-497.099) * [-494.198] (-508.793) (-496.870) (-495.634) -- 0:00:59
33000 -- (-497.555) (-500.143) (-501.204) [-497.097] * [-494.173] (-509.546) (-499.198) (-494.306) -- 0:00:58
33500 -- (-495.282) (-510.777) (-496.316) [-498.493] * (-496.078) (-503.730) (-494.045) [-497.326] -- 0:00:57
34000 -- (-494.377) (-516.621) [-494.501] (-494.364) * (-494.200) (-504.528) [-494.850] (-498.346) -- 0:00:56
34500 -- (-495.311) (-510.667) (-498.565) [-497.975] * (-497.517) (-537.315) (-494.947) [-498.631] -- 0:00:55
35000 -- (-493.986) (-512.165) (-497.017) [-498.032] * (-495.890) (-516.936) [-494.843] (-501.223) -- 0:00:55
Average standard deviation of split frequencies: 0.040593
35500 -- (-494.079) [-506.154] (-498.159) (-496.420) * [-495.973] (-509.272) (-498.706) (-495.822) -- 0:00:54
36000 -- (-494.287) (-500.632) [-497.294] (-496.430) * (-497.596) [-502.275] (-498.009) (-495.841) -- 0:00:53
36500 -- (-494.945) (-512.246) (-496.656) [-494.754] * [-494.682] (-495.970) (-497.473) (-494.199) -- 0:00:52
37000 -- (-494.062) (-502.186) [-495.438] (-494.863) * (-494.218) [-495.312] (-495.089) (-494.557) -- 0:00:52
37500 -- (-495.546) (-504.546) (-497.829) [-499.760] * (-494.248) [-495.426] (-497.073) (-497.754) -- 0:00:51
38000 -- [-494.234] (-501.558) (-496.305) (-494.212) * (-495.499) [-495.757] (-496.312) (-494.744) -- 0:00:50
38500 -- (-500.679) [-500.450] (-497.600) (-494.690) * [-494.048] (-493.317) (-496.817) (-493.622) -- 0:00:49
39000 -- (-503.603) (-508.222) [-494.009] (-496.235) * (-498.178) (-498.088) [-493.804] (-495.513) -- 0:00:49
39500 -- [-496.052] (-511.276) (-496.418) (-497.038) * [-493.254] (-496.708) (-494.157) (-502.126) -- 0:00:48
40000 -- [-495.662] (-499.228) (-501.945) (-499.955) * [-496.254] (-494.031) (-495.880) (-496.977) -- 0:00:48
Average standard deviation of split frequencies: 0.037216
40500 -- (-494.834) [-500.727] (-495.166) (-498.089) * [-495.848] (-494.612) (-495.368) (-493.881) -- 0:00:47
41000 -- (-494.006) (-510.512) (-496.347) [-499.183] * [-494.185] (-496.197) (-494.229) (-497.354) -- 0:00:46
41500 -- (-494.762) [-503.610] (-494.611) (-494.381) * (-493.682) [-494.347] (-497.502) (-494.806) -- 0:01:09
42000 -- (-493.869) (-511.032) [-495.471] (-494.403) * (-494.647) [-494.741] (-494.943) (-499.847) -- 0:01:08
42500 -- (-494.197) (-510.265) (-496.128) [-494.066] * (-497.099) (-495.174) [-495.313] (-498.574) -- 0:01:07
43000 -- (-493.924) [-507.806] (-494.032) (-493.585) * [-493.698] (-495.572) (-496.392) (-494.329) -- 0:01:06
43500 -- (-499.478) [-500.464] (-494.912) (-496.093) * [-498.984] (-496.311) (-493.827) (-495.944) -- 0:01:05
44000 -- (-498.064) (-504.782) (-496.277) [-495.230] * (-495.075) (-495.793) [-494.888] (-497.106) -- 0:01:05
44500 -- (-495.374) (-499.296) (-494.170) [-494.177] * (-495.651) [-496.039] (-494.209) (-493.934) -- 0:01:04
45000 -- (-495.513) (-506.154) (-494.215) [-494.445] * [-499.935] (-499.364) (-496.096) (-496.269) -- 0:01:03
Average standard deviation of split frequencies: 0.034470
45500 -- (-496.563) (-505.454) (-495.220) [-495.944] * [-500.850] (-497.174) (-495.783) (-497.982) -- 0:01:02
46000 -- (-497.348) (-508.087) [-493.377] (-496.261) * (-500.788) [-493.384] (-497.746) (-495.420) -- 0:01:02
46500 -- (-497.734) (-506.296) [-495.075] (-497.088) * (-495.839) (-493.563) (-498.807) [-494.303] -- 0:01:01
47000 -- [-495.177] (-509.671) (-494.691) (-498.296) * [-495.876] (-494.211) (-496.454) (-495.447) -- 0:01:00
47500 -- (-494.780) (-501.478) (-496.269) [-494.734] * (-496.254) (-496.212) (-494.748) [-498.779] -- 0:01:00
48000 -- (-497.330) (-505.959) (-494.345) [-493.719] * (-502.366) (-494.110) [-498.803] (-494.025) -- 0:00:59
48500 -- [-494.192] (-504.403) (-497.591) (-494.203) * (-496.902) (-493.416) [-497.638] (-497.801) -- 0:00:58
49000 -- (-497.100) (-501.423) [-498.397] (-495.965) * (-496.579) (-494.055) (-493.317) [-493.471] -- 0:00:58
49500 -- (-495.759) [-509.561] (-495.523) (-493.687) * (-496.157) (-501.535) [-494.584] (-495.769) -- 0:00:57
50000 -- (-496.338) (-503.719) (-496.724) [-494.111] * (-496.569) [-496.352] (-496.435) (-495.964) -- 0:00:57
Average standard deviation of split frequencies: 0.030238
50500 -- (-497.182) (-507.904) [-498.426] (-496.220) * (-496.006) (-503.004) (-498.131) [-496.167] -- 0:00:56
51000 -- (-496.157) [-503.661] (-494.856) (-495.031) * (-499.178) (-502.153) (-495.317) [-493.409] -- 0:00:55
51500 -- [-494.892] (-511.181) (-495.703) (-494.523) * (-496.626) (-499.933) (-499.040) [-493.555] -- 0:00:55
52000 -- (-498.775) [-504.070] (-495.808) (-495.163) * [-493.857] (-494.691) (-496.757) (-495.924) -- 0:00:54
52500 -- (-497.676) (-503.762) (-494.543) [-497.941] * (-496.009) [-494.469] (-498.851) (-497.288) -- 0:00:54
53000 -- (-494.165) (-509.762) [-494.209] (-495.024) * [-495.369] (-495.273) (-498.709) (-494.463) -- 0:00:53
53500 -- [-496.593] (-503.121) (-494.833) (-495.177) * (-495.111) (-495.015) [-495.998] (-497.846) -- 0:00:53
54000 -- [-494.874] (-515.328) (-493.971) (-496.317) * [-494.356] (-495.705) (-494.321) (-496.782) -- 0:00:52
54500 -- (-495.608) (-495.010) (-498.895) [-495.112] * (-496.998) (-496.113) [-493.376] (-494.427) -- 0:00:52
55000 -- [-497.340] (-494.121) (-496.006) (-495.072) * (-494.639) (-500.438) [-496.326] (-496.530) -- 0:00:51
Average standard deviation of split frequencies: 0.027779
55500 -- (-497.386) (-495.034) (-495.022) [-494.387] * (-497.645) [-495.928] (-494.375) (-497.006) -- 0:00:51
56000 -- (-495.561) (-497.223) (-496.221) [-493.892] * (-495.936) (-494.395) [-494.182] (-500.371) -- 0:01:07
56500 -- (-497.268) (-497.131) [-495.482] (-495.166) * [-496.031] (-494.237) (-494.167) (-499.026) -- 0:01:06
57000 -- (-495.225) (-496.107) (-496.629) [-494.073] * (-495.849) (-493.188) (-493.827) [-494.753] -- 0:01:06
57500 -- (-497.210) [-494.431] (-497.105) (-496.493) * (-496.793) (-496.414) (-498.261) [-494.823] -- 0:01:05
58000 -- (-498.340) (-495.181) (-497.179) [-495.353] * (-497.519) [-494.598] (-496.004) (-495.141) -- 0:01:04
58500 -- [-496.752] (-496.206) (-493.930) (-495.312) * (-496.515) [-494.635] (-495.644) (-496.451) -- 0:01:04
59000 -- (-494.297) (-496.873) (-498.619) [-494.354] * (-497.780) (-493.278) [-496.377] (-498.162) -- 0:01:03
59500 -- (-493.831) (-493.808) (-499.628) [-493.883] * [-500.228] (-493.702) (-494.966) (-494.872) -- 0:01:03
60000 -- (-494.344) [-495.714] (-494.554) (-498.118) * [-497.411] (-495.674) (-496.175) (-498.200) -- 0:01:02
Average standard deviation of split frequencies: 0.028219
60500 -- [-494.520] (-495.563) (-494.049) (-496.516) * [-494.568] (-494.087) (-496.177) (-494.337) -- 0:01:02
61000 -- [-493.738] (-498.085) (-493.512) (-496.675) * (-494.180) (-495.798) [-495.299] (-495.250) -- 0:01:01
61500 -- (-495.709) [-496.944] (-494.890) (-494.393) * (-497.231) (-494.418) [-496.713] (-494.264) -- 0:01:01
62000 -- (-495.838) (-496.129) (-494.171) [-495.897] * (-495.805) (-496.336) [-494.153] (-493.375) -- 0:01:00
62500 -- (-494.146) (-496.340) (-495.046) [-494.361] * (-499.288) (-496.012) [-493.430] (-494.460) -- 0:01:00
63000 -- [-493.960] (-495.500) (-495.462) (-493.301) * (-499.926) [-495.693] (-493.916) (-495.487) -- 0:00:59
63500 -- (-494.031) (-495.449) (-496.158) [-493.478] * (-493.793) (-494.183) (-498.384) [-498.857] -- 0:00:58
64000 -- [-493.999] (-494.897) (-496.672) (-493.510) * [-494.353] (-495.347) (-494.885) (-498.307) -- 0:00:58
64500 -- (-495.110) (-497.957) [-495.595] (-494.206) * [-494.506] (-496.388) (-496.713) (-494.513) -- 0:00:58
65000 -- (-496.847) (-494.783) (-499.566) [-494.991] * (-495.655) (-495.921) [-495.798] (-495.575) -- 0:00:57
Average standard deviation of split frequencies: 0.027890
65500 -- [-494.147] (-497.337) (-499.698) (-497.062) * [-497.823] (-493.670) (-496.478) (-494.949) -- 0:00:57
66000 -- (-495.919) (-494.213) [-494.602] (-494.574) * (-499.983) [-494.963] (-498.372) (-498.102) -- 0:00:56
66500 -- (-495.849) (-493.817) [-494.394] (-498.310) * (-497.568) [-495.730] (-498.089) (-495.163) -- 0:00:56
67000 -- [-493.658] (-493.103) (-494.060) (-495.157) * [-496.571] (-494.936) (-494.772) (-496.660) -- 0:00:55
67500 -- (-502.343) (-497.053) (-495.493) [-499.624] * (-495.983) [-496.479] (-496.472) (-496.298) -- 0:00:55
68000 -- (-499.868) (-494.714) [-495.024] (-500.736) * (-496.410) [-494.210] (-493.948) (-494.978) -- 0:00:54
68500 -- (-504.871) (-494.202) (-496.543) [-495.001] * [-495.619] (-494.341) (-493.262) (-494.705) -- 0:00:54
69000 -- (-494.238) [-494.754] (-497.225) (-495.648) * (-495.565) (-494.251) [-493.524] (-494.740) -- 0:00:53
69500 -- (-495.154) (-497.674) [-495.336] (-499.374) * (-496.430) [-496.730] (-493.272) (-496.726) -- 0:00:53
70000 -- (-496.279) (-496.760) (-496.835) [-498.157] * (-499.402) (-494.366) [-496.192] (-495.221) -- 0:00:53
Average standard deviation of split frequencies: 0.025683
70500 -- (-498.265) (-501.039) (-494.867) [-495.217] * (-496.854) [-495.630] (-495.631) (-494.512) -- 0:00:52
71000 -- (-496.632) [-499.376] (-496.697) (-496.265) * (-499.046) (-494.684) (-495.188) [-494.524] -- 0:01:05
71500 -- (-497.693) [-498.290] (-494.755) (-496.081) * (-501.760) (-494.278) (-498.317) [-495.134] -- 0:01:04
72000 -- (-499.984) [-495.271] (-494.231) (-499.242) * (-495.098) [-496.542] (-496.072) (-498.547) -- 0:01:04
72500 -- (-499.486) (-494.293) (-499.906) [-498.610] * (-494.893) (-499.831) [-497.604] (-497.765) -- 0:01:03
73000 -- (-495.387) [-494.407] (-501.019) (-497.061) * (-495.434) (-500.049) [-498.218] (-497.760) -- 0:01:03
73500 -- [-494.757] (-496.580) (-497.118) (-494.925) * (-494.447) (-496.514) [-495.859] (-495.417) -- 0:01:03
74000 -- (-494.873) (-496.787) [-496.150] (-497.587) * (-493.905) (-497.721) (-498.812) [-495.247] -- 0:01:02
74500 -- (-495.133) [-494.623] (-496.871) (-496.186) * (-497.787) [-496.318] (-496.055) (-494.667) -- 0:01:02
75000 -- [-494.964] (-495.632) (-493.938) (-494.315) * (-496.540) (-494.331) (-501.100) [-495.291] -- 0:01:01
Average standard deviation of split frequencies: 0.023178
75500 -- [-496.967] (-498.901) (-493.448) (-493.695) * (-493.426) (-494.710) (-500.997) [-498.517] -- 0:01:01
76000 -- (-493.831) (-495.105) [-497.004] (-494.037) * [-496.409] (-494.288) (-496.234) (-495.059) -- 0:01:00
76500 -- [-494.255] (-493.950) (-494.555) (-500.702) * (-496.612) (-495.021) [-499.169] (-494.869) -- 0:01:00
77000 -- (-493.977) (-494.621) [-497.027] (-494.550) * (-496.822) (-493.785) (-497.491) [-497.694] -- 0:00:59
77500 -- (-496.448) [-494.073] (-494.613) (-498.524) * (-496.944) (-493.617) [-496.638] (-498.610) -- 0:00:59
78000 -- [-493.659] (-494.082) (-494.248) (-496.971) * (-496.172) (-493.473) [-494.463] (-496.523) -- 0:00:59
78500 -- (-497.220) (-494.689) (-494.007) [-495.033] * (-496.443) (-495.419) (-494.649) [-497.658] -- 0:00:58
79000 -- (-497.809) [-494.265] (-495.367) (-497.162) * (-497.078) (-495.418) [-494.420] (-498.311) -- 0:00:58
79500 -- [-497.755] (-493.731) (-495.049) (-494.778) * [-494.289] (-494.016) (-496.877) (-498.070) -- 0:00:57
80000 -- [-496.919] (-493.686) (-495.037) (-495.842) * (-497.179) (-496.651) [-495.778] (-495.882) -- 0:00:57
Average standard deviation of split frequencies: 0.026947
80500 -- (-497.328) [-495.529] (-494.166) (-493.994) * [-495.832] (-495.330) (-498.239) (-493.243) -- 0:00:57
81000 -- [-496.630] (-494.515) (-496.354) (-495.984) * [-496.390] (-494.650) (-498.566) (-496.080) -- 0:00:56
81500 -- (-495.320) [-494.720] (-497.494) (-493.911) * [-495.592] (-494.550) (-497.118) (-497.134) -- 0:00:56
82000 -- (-497.010) [-493.194] (-496.778) (-495.128) * [-502.665] (-493.983) (-496.808) (-497.727) -- 0:00:55
82500 -- (-494.049) [-493.752] (-494.671) (-495.919) * [-499.075] (-494.483) (-494.251) (-498.659) -- 0:00:55
83000 -- [-494.772] (-493.756) (-493.577) (-497.861) * [-496.587] (-493.994) (-496.475) (-494.076) -- 0:00:55
83500 -- (-494.774) (-497.196) [-494.710] (-493.563) * (-496.614) [-494.585] (-496.518) (-494.551) -- 0:00:54
84000 -- (-496.370) (-496.095) [-494.153] (-493.421) * (-498.500) (-494.482) (-499.695) [-497.202] -- 0:00:54
84500 -- (-498.347) (-497.377) (-496.774) [-494.923] * [-497.687] (-500.022) (-496.407) (-497.111) -- 0:00:54
85000 -- (-495.902) (-495.052) [-494.305] (-494.686) * (-496.670) [-498.914] (-496.056) (-496.740) -- 0:00:53
Average standard deviation of split frequencies: 0.024275
85500 -- [-495.156] (-495.374) (-494.166) (-494.356) * (-496.530) (-496.367) (-495.072) [-495.271] -- 0:01:04
86000 -- [-495.927] (-493.708) (-495.449) (-493.768) * [-495.796] (-494.739) (-495.922) (-493.840) -- 0:01:03
86500 -- (-493.985) [-494.143] (-496.592) (-494.543) * (-494.400) (-493.787) [-494.282] (-494.195) -- 0:01:03
87000 -- (-495.293) (-493.860) [-494.117] (-493.476) * [-494.617] (-494.338) (-494.429) (-497.045) -- 0:01:02
87500 -- (-500.260) [-493.504] (-494.062) (-499.033) * [-496.097] (-495.794) (-495.232) (-497.832) -- 0:01:02
88000 -- (-494.240) [-497.388] (-495.325) (-501.224) * (-495.654) (-496.216) [-494.371] (-497.077) -- 0:01:02
88500 -- [-493.692] (-496.345) (-494.682) (-501.862) * (-495.070) (-497.131) (-495.758) [-497.492] -- 0:01:01
89000 -- (-495.724) [-494.240] (-493.753) (-496.950) * (-494.539) (-499.168) (-496.257) [-496.899] -- 0:01:01
89500 -- (-494.700) (-494.396) (-493.728) [-496.443] * [-495.832] (-503.686) (-494.419) (-494.656) -- 0:01:01
90000 -- (-494.624) [-495.869] (-495.738) (-496.690) * (-495.390) (-494.481) [-498.531] (-495.138) -- 0:01:00
Average standard deviation of split frequencies: 0.019703
90500 -- (-497.833) (-494.645) (-495.326) [-495.972] * (-495.288) (-495.279) [-493.460] (-497.217) -- 0:01:00
91000 -- [-499.400] (-494.373) (-494.192) (-496.883) * (-495.436) (-496.129) [-495.257] (-496.201) -- 0:00:59
91500 -- [-495.863] (-494.734) (-494.834) (-499.033) * (-495.374) (-496.708) [-495.100] (-498.332) -- 0:00:59
92000 -- [-495.779] (-498.172) (-493.681) (-496.877) * (-495.250) (-498.707) [-494.319] (-496.800) -- 0:00:59
92500 -- (-495.738) [-494.974] (-497.496) (-495.647) * (-497.462) [-496.657] (-494.126) (-498.688) -- 0:00:58
93000 -- (-495.926) [-497.208] (-498.091) (-496.631) * (-503.170) (-496.779) [-495.332] (-497.417) -- 0:00:58
93500 -- [-495.304] (-495.183) (-496.566) (-495.165) * (-494.133) [-495.736] (-495.083) (-496.919) -- 0:00:58
94000 -- (-497.578) [-495.069] (-495.117) (-494.599) * (-497.899) [-497.235] (-495.262) (-496.967) -- 0:00:57
94500 -- (-494.978) (-495.463) [-494.699] (-495.509) * (-495.915) [-496.969] (-500.700) (-494.405) -- 0:00:57
95000 -- (-497.225) [-495.453] (-494.458) (-493.533) * [-496.368] (-494.019) (-500.137) (-494.475) -- 0:00:57
Average standard deviation of split frequencies: 0.017732
95500 -- [-494.839] (-497.440) (-497.220) (-494.370) * (-497.677) (-496.773) (-496.960) [-494.153] -- 0:00:56
96000 -- (-495.608) [-495.519] (-494.656) (-496.993) * (-494.737) (-498.285) (-494.208) [-495.597] -- 0:00:56
96500 -- (-498.443) [-493.857] (-495.457) (-497.191) * [-502.824] (-495.576) (-495.746) (-495.450) -- 0:00:56
97000 -- [-494.017] (-495.019) (-495.008) (-498.532) * (-502.487) [-494.821] (-494.105) (-496.640) -- 0:00:55
97500 -- (-493.145) (-494.461) [-495.594] (-494.512) * (-498.727) (-495.545) (-495.337) [-497.003] -- 0:00:55
98000 -- (-494.402) (-495.273) [-495.586] (-494.373) * (-495.831) (-499.135) (-493.827) [-494.467] -- 0:00:55
98500 -- (-494.721) [-495.469] (-497.021) (-495.651) * [-494.781] (-497.249) (-498.233) (-496.020) -- 0:00:54
99000 -- (-493.981) (-494.999) [-496.219] (-495.263) * [-495.904] (-497.243) (-496.824) (-494.520) -- 0:00:54
99500 -- (-496.045) (-496.610) (-495.874) [-496.690] * (-493.879) [-497.025] (-499.836) (-496.093) -- 0:00:54
100000 -- [-495.692] (-493.933) (-496.615) (-494.866) * [-495.697] (-495.160) (-498.568) (-496.274) -- 0:01:02
Average standard deviation of split frequencies: 0.016267
100500 -- (-494.843) (-495.721) (-494.792) [-495.628] * (-496.337) (-494.978) [-496.500] (-493.967) -- 0:01:02
101000 -- [-494.892] (-494.974) (-495.211) (-495.388) * (-497.312) [-497.103] (-494.254) (-494.860) -- 0:01:02
101500 -- [-498.579] (-501.132) (-496.757) (-495.304) * (-495.987) [-497.590] (-493.376) (-494.463) -- 0:01:01
102000 -- (-494.909) (-500.372) (-499.469) [-494.833] * (-494.062) (-496.427) (-496.534) [-494.533] -- 0:01:01
102500 -- [-495.106] (-500.563) (-502.515) (-500.941) * [-494.388] (-494.460) (-498.613) (-496.138) -- 0:01:01
103000 -- [-494.849] (-494.938) (-496.877) (-499.442) * (-495.739) (-497.988) [-495.393] (-493.845) -- 0:01:00
103500 -- (-495.438) [-493.801] (-496.110) (-496.934) * (-494.285) (-496.632) [-499.804] (-494.962) -- 0:01:00
104000 -- (-495.441) (-494.582) (-495.237) [-494.891] * [-498.612] (-496.112) (-498.153) (-493.584) -- 0:01:00
104500 -- (-493.917) (-494.373) (-493.314) [-495.270] * [-494.272] (-494.986) (-499.705) (-494.128) -- 0:00:59
105000 -- [-496.274] (-496.358) (-496.818) (-498.296) * [-495.419] (-497.947) (-496.370) (-495.877) -- 0:00:59
Average standard deviation of split frequencies: 0.015036
105500 -- (-494.380) [-495.401] (-494.022) (-495.164) * (-494.043) [-496.658] (-494.761) (-496.555) -- 0:00:59
106000 -- (-494.743) (-495.730) (-494.222) [-494.698] * [-493.931] (-496.171) (-494.003) (-493.998) -- 0:00:59
106500 -- (-497.723) [-495.649] (-495.378) (-498.686) * [-493.544] (-495.732) (-496.275) (-494.559) -- 0:00:58
107000 -- (-497.599) (-495.494) (-495.969) [-498.929] * (-494.223) [-494.185] (-496.266) (-495.130) -- 0:00:58
107500 -- (-498.493) (-494.707) [-495.045] (-499.051) * (-495.416) (-494.624) (-494.344) [-497.103] -- 0:00:58
108000 -- [-494.807] (-494.513) (-494.303) (-498.571) * (-494.419) (-493.855) (-494.034) [-495.388] -- 0:00:57
108500 -- (-496.318) (-494.703) (-493.742) [-497.308] * (-493.466) (-493.304) [-493.793] (-495.085) -- 0:00:57
109000 -- (-496.391) [-494.453] (-495.844) (-495.259) * [-494.599] (-493.392) (-495.956) (-493.631) -- 0:00:57
109500 -- (-495.210) (-497.388) (-494.754) [-493.628] * [-494.204] (-494.975) (-494.180) (-499.241) -- 0:00:56
110000 -- (-495.468) (-496.366) [-495.830] (-495.768) * (-493.597) (-494.443) [-496.316] (-501.638) -- 0:00:56
Average standard deviation of split frequencies: 0.017678
110500 -- (-499.114) (-494.707) (-494.598) [-494.658] * (-494.820) (-497.733) [-499.398] (-497.060) -- 0:00:56
111000 -- (-493.501) (-496.140) (-493.658) [-495.901] * (-494.319) (-495.676) (-502.490) [-496.687] -- 0:00:56
111500 -- (-495.046) (-494.936) [-498.150] (-495.088) * (-493.970) [-495.488] (-494.097) (-498.887) -- 0:00:55
112000 -- (-494.125) (-495.327) (-495.703) [-496.178] * (-493.903) (-496.443) (-495.612) [-494.307] -- 0:00:55
112500 -- (-495.008) [-494.341] (-493.994) (-496.481) * [-494.519] (-496.708) (-495.000) (-493.515) -- 0:00:55
113000 -- (-495.439) (-495.048) [-494.633] (-498.296) * [-496.326] (-495.290) (-493.697) (-495.271) -- 0:00:54
113500 -- (-494.625) [-499.378] (-495.151) (-494.126) * (-495.895) (-494.574) (-493.369) [-493.303] -- 0:00:54
114000 -- [-494.318] (-496.929) (-496.871) (-494.021) * (-494.154) [-494.522] (-495.591) (-496.089) -- 0:01:02
114500 -- (-493.930) (-494.804) (-500.334) [-494.570] * (-494.065) (-494.225) [-497.567] (-496.911) -- 0:01:01
115000 -- (-495.133) (-493.779) [-493.753] (-494.919) * (-496.210) (-494.249) (-500.284) [-497.737] -- 0:01:01
Average standard deviation of split frequencies: 0.017690
115500 -- (-494.947) (-495.039) (-500.564) [-497.161] * (-499.167) [-494.581] (-496.459) (-497.098) -- 0:01:01
116000 -- (-498.401) (-498.119) [-495.966] (-495.980) * (-496.112) [-498.221] (-496.756) (-495.088) -- 0:01:00
116500 -- (-494.596) (-493.829) (-494.317) [-495.833] * (-497.974) (-494.528) [-494.851] (-497.565) -- 0:01:00
117000 -- (-497.379) (-495.836) (-497.677) [-498.670] * (-498.141) [-494.346] (-494.271) (-499.197) -- 0:01:00
117500 -- (-495.616) (-494.930) (-498.066) [-494.587] * (-498.259) (-497.169) [-497.745] (-493.289) -- 0:01:00
118000 -- (-497.332) [-496.652] (-495.450) (-493.803) * (-497.681) (-495.422) (-496.823) [-493.148] -- 0:00:59
118500 -- (-494.732) [-495.123] (-496.437) (-493.790) * [-497.146] (-494.733) (-496.577) (-494.024) -- 0:00:59
119000 -- (-494.244) (-496.807) (-496.998) [-493.439] * (-495.521) (-494.006) (-499.191) [-495.508] -- 0:00:59
119500 -- (-502.479) (-496.120) (-494.478) [-495.519] * (-497.730) (-494.675) [-495.005] (-496.181) -- 0:00:58
120000 -- (-497.531) (-494.992) (-493.479) [-497.423] * (-497.736) (-496.152) [-494.252] (-495.309) -- 0:00:58
Average standard deviation of split frequencies: 0.016929
120500 -- (-495.520) (-498.142) [-498.753] (-495.505) * (-497.313) [-499.985] (-499.158) (-496.644) -- 0:00:58
121000 -- [-497.247] (-499.230) (-496.768) (-494.328) * [-496.709] (-498.727) (-495.449) (-496.138) -- 0:00:58
121500 -- (-496.923) [-497.652] (-494.379) (-493.827) * (-501.619) (-496.442) [-496.098] (-494.553) -- 0:00:57
122000 -- (-496.404) (-494.091) [-494.336] (-496.840) * (-498.026) [-494.338] (-494.427) (-494.390) -- 0:00:57
122500 -- (-498.407) (-503.066) [-495.107] (-497.505) * (-496.056) (-494.485) (-493.372) [-493.969] -- 0:00:57
123000 -- (-496.538) [-494.849] (-493.821) (-495.893) * [-494.080] (-494.607) (-494.074) (-493.354) -- 0:00:57
123500 -- (-498.382) [-493.120] (-497.124) (-494.733) * (-494.482) (-494.956) (-495.642) [-494.823] -- 0:00:56
124000 -- (-500.474) (-495.371) [-494.697] (-494.525) * (-495.742) (-496.439) [-494.613] (-495.823) -- 0:00:56
124500 -- [-495.982] (-494.259) (-493.847) (-494.408) * (-500.366) (-494.963) (-495.381) [-494.812] -- 0:00:56
125000 -- (-495.263) (-496.713) (-494.823) [-494.842] * [-496.635] (-494.910) (-494.299) (-494.740) -- 0:00:56
Average standard deviation of split frequencies: 0.017667
125500 -- (-495.273) [-494.911] (-500.933) (-495.681) * (-495.687) (-495.689) [-494.003] (-495.411) -- 0:00:55
126000 -- (-495.856) [-494.380] (-497.342) (-496.443) * (-495.923) [-493.864] (-494.537) (-495.563) -- 0:00:55
126500 -- (-497.607) (-494.712) (-497.369) [-494.753] * (-498.161) (-494.805) [-494.547] (-494.112) -- 0:00:55
127000 -- (-497.867) (-495.324) [-494.118] (-494.072) * (-494.190) (-496.102) (-495.490) [-494.953] -- 0:00:54
127500 -- (-494.745) (-494.102) [-494.800] (-495.247) * (-494.757) (-497.430) [-496.880] (-494.929) -- 0:00:54
128000 -- (-495.795) (-495.092) [-494.967] (-494.915) * (-494.170) (-495.419) (-495.420) [-494.661] -- 0:00:54
128500 -- (-499.024) (-495.125) (-493.393) [-493.795] * [-495.623] (-497.089) (-495.499) (-497.963) -- 0:01:01
129000 -- (-499.899) (-494.558) [-494.964] (-495.881) * (-496.275) (-499.688) (-494.959) [-495.885] -- 0:01:00
129500 -- (-496.714) (-495.824) (-498.697) [-495.921] * (-497.976) (-494.554) [-494.662] (-495.682) -- 0:01:00
130000 -- [-495.567] (-497.270) (-497.449) (-494.050) * (-497.449) [-493.651] (-493.891) (-494.031) -- 0:01:00
Average standard deviation of split frequencies: 0.016235
130500 -- [-493.952] (-494.342) (-498.482) (-494.084) * [-494.401] (-498.378) (-495.155) (-496.822) -- 0:00:59
131000 -- (-494.644) (-495.374) [-495.485] (-493.279) * (-493.846) (-499.377) [-493.927] (-498.566) -- 0:00:59
131500 -- (-493.660) (-499.268) (-497.057) [-496.252] * (-498.840) (-497.131) (-500.512) [-497.804] -- 0:00:59
132000 -- [-496.519] (-496.618) (-495.473) (-499.169) * (-498.006) (-494.254) (-495.366) [-496.294] -- 0:00:59
132500 -- (-497.346) (-499.048) (-498.569) [-497.179] * (-497.255) [-495.752] (-496.149) (-496.141) -- 0:00:58
133000 -- [-493.402] (-496.482) (-496.666) (-499.074) * (-495.249) (-495.599) (-495.612) [-493.982] -- 0:00:58
133500 -- [-494.095] (-495.128) (-493.905) (-496.999) * [-495.674] (-496.501) (-497.982) (-495.293) -- 0:00:58
134000 -- (-494.348) (-494.736) [-493.698] (-496.366) * (-498.790) (-496.714) [-494.079] (-496.248) -- 0:00:58
134500 -- [-497.323] (-495.750) (-496.325) (-497.222) * (-497.420) (-498.545) [-494.004] (-497.591) -- 0:00:57
135000 -- [-493.587] (-494.767) (-496.081) (-497.003) * (-495.896) (-501.637) [-494.516] (-494.638) -- 0:00:57
Average standard deviation of split frequencies: 0.014273
135500 -- (-494.056) (-494.645) (-494.897) [-497.328] * (-494.204) (-493.584) [-493.258] (-495.156) -- 0:00:57
136000 -- (-495.391) (-495.854) [-494.713] (-497.204) * (-495.402) [-494.902] (-497.202) (-493.468) -- 0:00:57
136500 -- (-494.832) [-499.392] (-498.077) (-495.381) * (-496.811) (-495.202) [-495.423] (-496.588) -- 0:00:56
137000 -- (-497.482) (-498.454) (-497.639) [-493.412] * [-495.223] (-494.911) (-494.494) (-495.431) -- 0:00:56
137500 -- (-494.761) (-495.942) [-500.036] (-497.456) * [-495.052] (-495.821) (-496.276) (-493.737) -- 0:00:56
138000 -- [-497.168] (-493.981) (-503.193) (-495.580) * (-496.591) [-493.764] (-493.224) (-497.698) -- 0:00:56
138500 -- (-495.582) (-494.589) (-497.141) [-494.929] * (-497.572) (-494.306) [-495.223] (-496.651) -- 0:00:55
139000 -- (-498.808) [-494.680] (-496.471) (-496.978) * (-498.259) (-493.808) (-496.672) [-497.433] -- 0:00:55
139500 -- (-499.614) (-494.556) [-494.312] (-502.726) * [-495.664] (-495.029) (-496.798) (-497.366) -- 0:00:55
140000 -- (-494.575) (-494.596) (-495.287) [-495.079] * (-497.573) [-497.142] (-495.118) (-495.763) -- 0:00:55
Average standard deviation of split frequencies: 0.014033
140500 -- (-495.243) [-493.621] (-496.618) (-495.110) * (-495.912) (-495.423) (-495.976) [-495.460] -- 0:00:55
141000 -- [-494.833] (-494.509) (-499.624) (-494.123) * (-495.539) [-494.208] (-495.993) (-498.587) -- 0:00:54
141500 -- (-496.299) (-496.823) [-496.814] (-498.402) * [-498.011] (-497.382) (-495.197) (-498.746) -- 0:00:54
142000 -- [-496.878] (-496.047) (-494.963) (-499.680) * [-496.282] (-497.629) (-497.358) (-497.815) -- 0:00:54
142500 -- (-494.616) (-497.392) [-495.001] (-497.821) * [-493.646] (-496.029) (-497.010) (-497.195) -- 0:01:00
143000 -- (-495.383) [-494.091] (-494.445) (-500.362) * (-494.480) (-496.188) [-496.005] (-497.601) -- 0:00:59
143500 -- [-494.900] (-494.540) (-497.748) (-494.612) * (-495.840) (-494.637) [-499.251] (-496.073) -- 0:00:59
144000 -- (-493.986) [-494.442] (-498.163) (-495.781) * [-494.199] (-500.272) (-497.987) (-495.006) -- 0:00:59
144500 -- (-498.564) [-495.622] (-495.488) (-494.018) * (-496.282) (-494.143) (-497.250) [-494.327] -- 0:00:59
145000 -- (-497.550) (-495.292) (-493.921) [-498.796] * (-494.028) (-494.432) [-494.636] (-494.346) -- 0:00:58
Average standard deviation of split frequencies: 0.013295
145500 -- [-494.380] (-495.876) (-496.021) (-496.959) * (-496.922) (-496.819) (-495.049) [-495.573] -- 0:00:58
146000 -- [-495.084] (-493.588) (-495.794) (-495.509) * (-496.264) [-495.770] (-496.179) (-495.802) -- 0:00:58
146500 -- (-496.288) (-493.972) [-497.164] (-494.730) * [-497.203] (-495.723) (-494.600) (-496.010) -- 0:00:58
147000 -- [-494.710] (-496.022) (-496.808) (-495.920) * (-495.216) [-498.435] (-494.172) (-499.193) -- 0:00:58
147500 -- (-493.783) [-496.863] (-502.674) (-493.263) * (-495.223) [-494.458] (-497.690) (-497.776) -- 0:00:57
148000 -- (-503.449) [-496.680] (-495.996) (-495.912) * (-497.765) (-497.690) [-497.172] (-497.685) -- 0:00:57
148500 -- [-499.380] (-496.941) (-495.794) (-493.830) * (-496.020) (-496.783) (-495.822) [-494.552] -- 0:00:57
149000 -- (-496.913) (-494.148) [-494.115] (-499.676) * (-495.574) (-497.906) [-495.272] (-502.564) -- 0:00:57
149500 -- [-495.690] (-501.440) (-495.652) (-495.206) * (-498.663) [-495.747] (-493.599) (-496.516) -- 0:00:56
150000 -- (-497.133) (-498.151) (-495.097) [-495.532] * [-496.423] (-498.081) (-495.876) (-496.419) -- 0:00:56
Average standard deviation of split frequencies: 0.014172
150500 -- [-495.518] (-493.411) (-494.896) (-497.661) * (-495.423) (-496.479) [-494.533] (-496.726) -- 0:00:56
151000 -- (-497.200) (-493.513) [-493.797] (-497.235) * (-498.351) (-494.709) (-494.548) [-494.459] -- 0:00:56
151500 -- (-494.492) (-496.463) [-495.030] (-496.266) * (-496.345) (-494.912) (-495.450) [-493.862] -- 0:00:56
152000 -- (-498.711) (-495.854) [-494.636] (-495.686) * [-493.630] (-500.817) (-496.114) (-493.764) -- 0:00:55
152500 -- (-494.501) (-494.235) [-495.163] (-495.520) * [-495.202] (-495.729) (-494.799) (-493.699) -- 0:00:55
153000 -- (-497.426) [-495.902] (-496.223) (-494.736) * (-494.016) (-496.190) (-496.856) [-497.170] -- 0:00:55
153500 -- [-494.210] (-496.847) (-494.634) (-495.034) * (-500.327) [-495.455] (-494.518) (-495.407) -- 0:00:55
154000 -- [-493.487] (-496.999) (-496.667) (-496.673) * [-496.397] (-495.082) (-495.549) (-496.100) -- 0:00:54
154500 -- (-496.415) (-495.649) [-496.086] (-495.682) * (-501.576) (-495.207) (-497.107) [-494.333] -- 0:00:54
155000 -- (-495.440) (-497.322) [-496.941] (-495.873) * [-497.584] (-500.333) (-497.434) (-495.140) -- 0:00:54
Average standard deviation of split frequencies: 0.015676
155500 -- (-499.729) (-495.891) [-496.196] (-497.244) * (-496.752) [-494.771] (-495.873) (-495.864) -- 0:00:54
156000 -- (-498.303) [-494.871] (-494.658) (-496.569) * [-496.159] (-494.707) (-494.773) (-495.475) -- 0:00:54
156500 -- (-495.688) [-494.599] (-494.125) (-497.350) * (-497.080) (-495.965) [-495.604] (-495.405) -- 0:00:53
157000 -- [-494.080] (-494.589) (-494.886) (-493.996) * (-495.418) [-494.576] (-494.027) (-495.898) -- 0:00:53
157500 -- (-495.301) [-494.714] (-495.577) (-494.162) * (-494.187) [-494.428] (-494.843) (-497.993) -- 0:00:53
158000 -- (-495.582) (-496.885) (-495.447) [-498.904] * [-495.377] (-495.213) (-493.657) (-497.855) -- 0:00:53
158500 -- (-495.796) [-494.795] (-497.598) (-497.163) * (-495.102) (-495.298) (-493.934) [-495.492] -- 0:00:58
159000 -- (-493.630) (-494.748) (-495.962) [-494.773] * (-494.972) (-493.716) (-495.951) [-495.639] -- 0:00:58
159500 -- (-494.132) (-494.033) [-493.909] (-495.584) * [-495.831] (-494.888) (-494.826) (-498.895) -- 0:00:57
160000 -- (-497.458) (-493.884) (-496.053) [-493.463] * [-493.435] (-495.675) (-494.915) (-498.441) -- 0:00:57
Average standard deviation of split frequencies: 0.015954
160500 -- (-498.197) (-495.461) (-497.047) [-495.160] * (-498.246) (-495.067) [-497.485] (-499.187) -- 0:00:57
161000 -- (-501.020) [-495.363] (-497.282) (-497.053) * (-498.840) (-494.431) (-494.420) [-497.140] -- 0:00:57
161500 -- [-497.578] (-498.680) (-496.192) (-496.036) * (-497.128) (-496.294) (-495.383) [-499.457] -- 0:00:57
162000 -- [-494.804] (-496.544) (-493.936) (-497.596) * (-495.339) [-494.861] (-494.103) (-493.490) -- 0:00:56
162500 -- (-496.772) (-494.600) (-498.878) [-495.965] * (-497.653) [-493.702] (-495.269) (-493.657) -- 0:00:56
163000 -- [-494.549] (-497.879) (-497.195) (-498.215) * [-498.063] (-496.867) (-496.985) (-494.655) -- 0:00:56
163500 -- [-493.744] (-497.052) (-497.691) (-501.359) * (-495.896) [-495.285] (-494.432) (-495.026) -- 0:00:56
164000 -- (-496.977) (-493.898) [-500.563] (-498.367) * [-494.137] (-496.780) (-496.485) (-494.050) -- 0:00:56
164500 -- [-494.038] (-494.823) (-496.160) (-494.900) * (-494.433) (-497.186) (-494.630) [-498.466] -- 0:00:55
165000 -- [-496.338] (-498.538) (-495.673) (-495.883) * (-494.897) (-495.723) (-496.846) [-494.100] -- 0:00:55
Average standard deviation of split frequencies: 0.015086
165500 -- (-494.032) (-498.682) [-495.322] (-497.755) * [-494.697] (-494.773) (-494.880) (-494.971) -- 0:00:55
166000 -- (-494.323) [-494.061] (-495.951) (-499.779) * (-495.261) (-495.551) (-495.874) [-496.015] -- 0:00:55
166500 -- (-498.074) [-494.245] (-495.192) (-502.675) * (-497.898) (-494.990) [-497.642] (-495.855) -- 0:00:55
167000 -- (-493.918) [-495.983] (-495.717) (-495.913) * (-495.086) (-497.061) [-494.756] (-495.094) -- 0:00:54
167500 -- (-496.214) [-497.158] (-493.722) (-498.990) * (-496.234) (-495.552) [-496.753] (-493.814) -- 0:00:54
168000 -- (-501.913) (-497.506) [-493.369] (-494.145) * (-495.305) (-496.446) (-494.616) [-494.003] -- 0:00:54
168500 -- [-494.869] (-504.804) (-496.897) (-495.855) * (-497.370) (-495.156) [-494.843] (-493.544) -- 0:00:54
169000 -- (-493.477) (-497.561) [-497.137] (-495.591) * (-496.273) [-494.001] (-496.108) (-494.851) -- 0:00:54
169500 -- [-496.159] (-496.100) (-494.805) (-497.697) * (-497.178) (-495.608) [-496.160] (-496.454) -- 0:00:53
170000 -- (-501.145) (-494.904) (-494.003) [-498.188] * [-498.275] (-496.585) (-497.223) (-493.895) -- 0:00:53
Average standard deviation of split frequencies: 0.015192
170500 -- [-496.962] (-494.808) (-494.298) (-499.145) * [-496.829] (-502.023) (-495.675) (-495.325) -- 0:00:53
171000 -- (-498.319) [-494.840] (-494.727) (-497.612) * (-497.564) (-498.035) [-494.189] (-496.599) -- 0:00:53
171500 -- (-496.305) (-493.337) (-494.310) [-499.704] * (-496.015) (-494.452) (-497.459) [-493.516] -- 0:00:53
172000 -- (-493.468) (-498.470) [-495.848] (-495.677) * [-494.785] (-495.762) (-505.988) (-495.408) -- 0:00:52
172500 -- [-494.515] (-494.977) (-495.624) (-495.851) * (-493.853) (-494.512) [-496.252] (-494.834) -- 0:00:52
173000 -- (-495.093) (-495.244) [-495.979] (-494.868) * (-497.607) [-494.398] (-494.696) (-495.363) -- 0:00:52
173500 -- (-494.399) (-496.735) (-493.783) [-497.948] * (-496.658) (-494.649) [-496.095] (-493.934) -- 0:00:52
174000 -- (-494.948) [-493.840] (-496.778) (-502.817) * (-498.329) (-497.407) [-495.531] (-494.369) -- 0:00:52
174500 -- (-496.746) [-494.354] (-495.824) (-505.812) * (-495.776) [-495.227] (-496.686) (-504.412) -- 0:00:52
175000 -- (-494.120) (-494.477) (-494.630) [-493.994] * (-495.424) (-494.884) (-496.361) [-496.149] -- 0:00:51
Average standard deviation of split frequencies: 0.015401
175500 -- (-494.518) (-498.380) (-496.332) [-493.736] * (-493.750) [-495.073] (-496.278) (-497.409) -- 0:00:56
176000 -- (-494.765) [-494.702] (-494.820) (-497.139) * (-493.995) (-495.598) (-496.261) [-498.506] -- 0:00:56
176500 -- (-495.160) (-495.678) [-494.484] (-508.579) * [-493.826] (-496.565) (-494.532) (-493.821) -- 0:00:55
177000 -- (-495.666) [-498.248] (-493.760) (-497.922) * (-494.704) [-493.547] (-498.937) (-493.283) -- 0:00:55
177500 -- (-496.764) [-499.209] (-494.132) (-497.662) * (-493.342) (-495.850) [-494.320] (-495.766) -- 0:00:55
178000 -- (-496.040) (-498.999) (-497.857) [-494.372] * (-494.936) [-495.489] (-493.921) (-496.531) -- 0:00:55
178500 -- (-498.022) [-496.366] (-496.991) (-494.303) * (-495.010) (-495.191) (-496.056) [-494.961] -- 0:00:55
179000 -- (-497.283) (-496.541) (-497.534) [-495.467] * (-496.487) [-496.259] (-495.259) (-495.561) -- 0:00:55
179500 -- (-498.836) (-495.107) (-497.058) [-494.448] * (-499.222) (-494.476) (-494.486) [-495.065] -- 0:00:54
180000 -- (-499.469) (-495.150) (-497.383) [-494.997] * (-497.563) [-495.020] (-495.681) (-494.742) -- 0:00:54
Average standard deviation of split frequencies: 0.014025
180500 -- (-497.079) [-496.690] (-497.101) (-495.099) * [-497.779] (-496.437) (-493.954) (-496.501) -- 0:00:54
181000 -- (-495.900) (-498.245) (-494.546) [-495.982] * [-496.684] (-498.438) (-494.359) (-495.934) -- 0:00:54
181500 -- [-496.262] (-493.872) (-494.189) (-496.240) * [-493.908] (-496.889) (-497.640) (-495.899) -- 0:00:54
182000 -- [-495.269] (-494.271) (-494.702) (-498.723) * [-494.001] (-494.919) (-497.641) (-494.346) -- 0:00:53
182500 -- (-498.681) [-494.213] (-493.463) (-493.343) * (-493.914) [-496.470] (-497.145) (-497.057) -- 0:00:53
183000 -- (-495.084) [-496.840] (-493.413) (-498.094) * (-494.513) (-496.342) [-495.223] (-495.568) -- 0:00:53
183500 -- (-494.182) [-495.276] (-495.616) (-497.582) * (-497.333) (-496.337) [-497.780] (-493.235) -- 0:00:53
184000 -- (-495.283) [-493.773] (-500.231) (-495.308) * (-499.957) (-494.882) (-495.891) [-495.095] -- 0:00:53
184500 -- [-494.163] (-494.842) (-495.578) (-494.991) * (-495.563) [-494.836] (-494.962) (-496.298) -- 0:00:53
185000 -- (-496.887) (-495.083) (-494.951) [-493.609] * (-495.955) [-497.694] (-495.016) (-494.041) -- 0:00:52
Average standard deviation of split frequencies: 0.013269
185500 -- [-494.588] (-497.117) (-494.494) (-495.864) * (-497.727) (-496.090) [-500.021] (-495.044) -- 0:00:52
186000 -- [-497.137] (-498.126) (-495.959) (-494.302) * (-496.188) (-495.099) [-493.639] (-494.417) -- 0:00:52
186500 -- (-497.938) (-495.253) (-496.327) [-494.594] * (-495.881) (-493.867) [-494.306] (-494.163) -- 0:00:52
187000 -- [-500.847] (-494.417) (-495.519) (-493.146) * [-495.517] (-493.701) (-497.437) (-502.470) -- 0:00:52
187500 -- (-497.767) (-495.136) (-495.443) [-494.329] * (-496.903) (-497.810) [-498.987] (-498.433) -- 0:00:52
188000 -- (-495.413) (-494.327) (-495.107) [-494.355] * (-500.739) (-497.080) (-497.151) [-497.800] -- 0:00:51
188500 -- (-495.251) (-493.882) [-497.549] (-497.097) * [-493.523] (-498.101) (-499.081) (-497.183) -- 0:00:51
189000 -- (-494.841) (-493.640) [-496.718] (-496.822) * [-493.608] (-496.295) (-498.023) (-496.276) -- 0:00:51
189500 -- (-497.990) [-494.362] (-495.662) (-495.644) * [-495.934] (-495.759) (-497.439) (-493.596) -- 0:00:51
190000 -- (-497.953) [-494.770] (-496.474) (-494.412) * (-494.666) (-496.242) (-495.417) [-495.081] -- 0:00:55
Average standard deviation of split frequencies: 0.012653
190500 -- (-495.657) (-493.794) [-494.660] (-494.756) * (-496.920) (-496.224) (-495.031) [-493.397] -- 0:00:55
191000 -- (-496.045) (-496.094) (-494.750) [-498.205] * (-499.746) (-495.613) (-500.197) [-497.011] -- 0:00:55
191500 -- (-498.370) (-494.703) (-494.020) [-496.337] * [-496.014] (-495.742) (-494.443) (-495.699) -- 0:00:54
192000 -- [-496.506] (-496.127) (-493.220) (-498.461) * [-495.091] (-496.009) (-497.375) (-497.473) -- 0:00:54
192500 -- (-494.228) (-495.780) (-495.605) [-493.572] * (-494.129) [-494.597] (-495.882) (-496.258) -- 0:00:54
193000 -- [-499.168] (-495.850) (-495.633) (-494.119) * (-494.783) (-500.434) (-495.496) [-496.222] -- 0:00:54
193500 -- [-496.847] (-497.935) (-495.874) (-495.508) * (-495.673) [-494.710] (-498.251) (-495.478) -- 0:00:54
194000 -- [-498.163] (-496.597) (-498.595) (-494.722) * (-496.576) [-495.871] (-499.053) (-497.796) -- 0:00:54
194500 -- [-495.300] (-495.318) (-500.190) (-497.878) * [-495.194] (-498.638) (-500.725) (-496.731) -- 0:00:53
195000 -- (-493.325) (-494.210) (-497.519) [-494.916] * (-497.438) [-496.447] (-500.858) (-493.965) -- 0:00:53
Average standard deviation of split frequencies: 0.011625
195500 -- (-495.074) (-495.292) (-496.950) [-495.657] * (-496.436) [-499.991] (-502.019) (-493.979) -- 0:00:53
196000 -- (-497.270) (-495.399) (-499.403) [-495.711] * [-495.350] (-505.638) (-493.555) (-496.784) -- 0:00:53
196500 -- (-496.686) (-495.248) (-495.522) [-495.237] * (-495.087) (-494.429) (-495.494) [-494.477] -- 0:00:53
197000 -- (-494.684) (-495.405) [-493.881] (-495.840) * (-497.136) (-497.018) (-494.024) [-494.060] -- 0:00:52
197500 -- (-495.572) (-495.353) (-495.575) [-495.773] * (-499.066) (-495.390) (-496.990) [-494.871] -- 0:00:52
198000 -- (-496.942) [-495.900] (-493.911) (-494.123) * [-496.462] (-495.366) (-497.032) (-498.141) -- 0:00:52
198500 -- (-495.465) (-495.273) [-494.831] (-501.452) * (-496.301) (-496.127) (-493.794) [-496.796] -- 0:00:52
199000 -- (-493.613) (-498.943) [-497.342] (-500.727) * (-495.267) (-503.145) (-501.373) [-498.009] -- 0:00:52
199500 -- [-493.905] (-494.794) (-497.291) (-497.416) * (-495.533) [-496.438] (-496.901) (-496.372) -- 0:00:52
200000 -- (-493.465) (-496.952) (-494.654) [-494.685] * (-496.171) (-495.962) [-495.451] (-497.518) -- 0:00:51
Average standard deviation of split frequencies: 0.012333
200500 -- [-495.473] (-496.283) (-494.565) (-496.323) * (-496.334) [-495.385] (-495.004) (-497.439) -- 0:00:51
201000 -- (-495.020) (-496.420) (-494.351) [-494.264] * (-496.350) (-493.921) [-495.628] (-496.363) -- 0:00:51
201500 -- (-494.395) (-495.824) [-493.614] (-499.254) * (-499.604) [-495.700] (-495.056) (-496.386) -- 0:00:51
202000 -- (-497.924) (-497.530) (-496.262) [-495.924] * (-497.501) (-494.892) [-496.402] (-495.027) -- 0:00:51
202500 -- (-494.251) [-499.399] (-495.277) (-496.281) * (-503.168) (-497.387) [-495.317] (-496.105) -- 0:00:51
203000 -- (-493.515) [-496.213] (-495.183) (-497.781) * (-496.336) (-497.428) (-493.632) [-494.654] -- 0:00:51
203500 -- (-493.338) (-495.885) (-493.623) [-497.919] * [-495.553] (-495.796) (-495.115) (-494.895) -- 0:00:50
204000 -- [-493.515] (-496.786) (-495.118) (-495.787) * [-495.541] (-500.013) (-495.849) (-494.246) -- 0:00:50
204500 -- (-494.550) (-497.180) (-495.716) [-496.037] * (-494.491) (-496.297) [-495.318] (-496.222) -- 0:00:50
205000 -- [-494.133] (-495.328) (-493.269) (-497.272) * [-494.023] (-493.868) (-498.439) (-496.752) -- 0:00:50
Average standard deviation of split frequencies: 0.012586
205500 -- (-494.709) [-498.970] (-493.217) (-494.974) * (-500.096) (-495.185) [-500.339] (-496.409) -- 0:00:50
206000 -- (-493.998) (-495.816) (-493.201) [-493.636] * (-497.891) (-494.573) [-497.103] (-494.220) -- 0:00:50
206500 -- (-497.940) (-494.655) (-493.124) [-495.731] * (-495.599) [-496.881] (-494.588) (-493.185) -- 0:00:49
207000 -- (-495.264) [-494.167] (-493.470) (-499.292) * [-495.801] (-496.864) (-493.920) (-495.187) -- 0:00:53
207500 -- (-497.216) (-497.586) [-496.196] (-496.532) * [-497.549] (-495.509) (-494.822) (-495.498) -- 0:00:53
208000 -- [-496.074] (-500.177) (-498.277) (-493.968) * (-495.223) [-493.991] (-494.761) (-494.339) -- 0:00:53
208500 -- (-496.993) (-495.085) [-494.104] (-494.174) * [-495.918] (-493.926) (-495.207) (-495.903) -- 0:00:53
209000 -- (-499.530) [-494.698] (-498.372) (-497.131) * [-496.568] (-493.617) (-498.270) (-496.576) -- 0:00:52
209500 -- (-497.093) (-498.036) (-500.138) [-495.558] * (-494.393) (-496.854) (-496.459) [-497.477] -- 0:00:52
210000 -- (-495.409) (-495.664) (-496.002) [-499.830] * (-497.396) (-494.109) [-495.925] (-493.777) -- 0:00:52
Average standard deviation of split frequencies: 0.013985
210500 -- [-495.195] (-494.941) (-497.347) (-497.315) * (-496.566) [-494.072] (-498.369) (-494.865) -- 0:00:52
211000 -- (-497.156) (-494.377) [-496.686] (-498.310) * (-500.808) (-497.037) (-495.485) [-495.401] -- 0:00:52
211500 -- (-494.519) (-498.712) (-499.976) [-497.093] * (-496.328) (-494.161) [-493.836] (-495.358) -- 0:00:52
212000 -- (-494.862) (-496.746) [-496.445] (-495.786) * (-496.080) (-495.429) (-493.737) [-499.321] -- 0:00:52
212500 -- (-495.820) [-494.202] (-495.044) (-496.410) * [-495.744] (-496.945) (-493.781) (-499.948) -- 0:00:51
213000 -- (-494.599) [-496.627] (-497.080) (-494.883) * (-499.752) (-494.841) (-493.939) [-495.781] -- 0:00:51
213500 -- (-498.584) [-494.365] (-499.788) (-495.843) * (-495.063) (-495.874) [-495.267] (-493.993) -- 0:00:51
214000 -- (-496.720) (-495.149) (-496.656) [-496.119] * (-496.846) (-494.931) (-498.748) [-496.062] -- 0:00:51
214500 -- (-494.003) (-496.312) [-494.523] (-495.277) * (-496.730) (-496.861) (-497.878) [-496.326] -- 0:00:51
215000 -- [-497.019] (-494.764) (-497.946) (-495.989) * (-501.060) (-497.058) (-493.740) [-495.688] -- 0:00:51
Average standard deviation of split frequencies: 0.013777
215500 -- (-494.807) [-495.805] (-494.591) (-494.626) * (-502.511) [-495.612] (-501.336) (-495.400) -- 0:00:50
216000 -- (-494.868) (-495.658) (-495.108) [-494.226] * (-495.223) [-496.092] (-498.705) (-493.670) -- 0:00:50
216500 -- (-494.433) (-495.684) [-495.835] (-493.331) * (-497.490) [-497.971] (-497.136) (-494.697) -- 0:00:50
217000 -- (-495.778) (-495.655) [-499.103] (-495.292) * [-502.444] (-495.121) (-493.863) (-494.409) -- 0:00:50
217500 -- (-499.232) (-500.270) (-498.912) [-495.883] * [-493.955] (-493.616) (-496.745) (-496.083) -- 0:00:50
218000 -- [-496.724] (-497.401) (-494.730) (-494.206) * (-495.087) (-494.546) [-495.372] (-494.334) -- 0:00:50
218500 -- (-501.907) (-495.765) [-496.625] (-495.034) * (-496.368) (-496.056) [-495.312] (-495.826) -- 0:00:50
219000 -- [-495.607] (-497.612) (-494.190) (-500.238) * [-495.089] (-494.925) (-493.567) (-495.051) -- 0:00:49
219500 -- (-499.713) [-496.159] (-496.830) (-497.183) * (-497.990) (-498.873) (-494.924) [-495.853] -- 0:00:49
220000 -- (-494.089) (-499.383) [-496.093] (-495.083) * (-496.450) (-496.152) (-497.768) [-495.314] -- 0:00:49
Average standard deviation of split frequencies: 0.014099
220500 -- (-494.087) (-498.767) (-497.830) [-497.106] * (-497.811) [-495.600] (-496.035) (-496.517) -- 0:00:49
221000 -- (-494.428) (-493.988) (-498.687) [-495.705] * [-494.918] (-497.408) (-495.097) (-496.069) -- 0:00:52
221500 -- (-495.032) (-498.487) [-494.529] (-502.404) * (-494.730) [-498.511] (-496.876) (-495.350) -- 0:00:52
222000 -- (-497.451) [-500.580] (-495.336) (-502.174) * (-494.997) (-498.045) [-498.104] (-498.298) -- 0:00:52
222500 -- [-494.198] (-501.268) (-494.551) (-495.060) * [-494.814] (-496.647) (-497.799) (-495.186) -- 0:00:52
223000 -- (-495.440) (-502.997) (-493.534) [-494.245] * (-494.946) (-495.037) [-495.932] (-497.644) -- 0:00:52
223500 -- [-493.665] (-498.294) (-495.437) (-495.505) * [-495.364] (-494.241) (-495.798) (-498.688) -- 0:00:52
224000 -- (-495.765) [-497.372] (-495.130) (-498.533) * (-495.470) [-497.562] (-495.030) (-497.525) -- 0:00:51
224500 -- [-495.823] (-498.033) (-496.448) (-494.108) * (-495.143) (-497.115) [-496.392] (-497.293) -- 0:00:51
225000 -- (-494.886) [-494.083] (-494.422) (-494.715) * (-495.381) (-494.102) [-495.460] (-497.610) -- 0:00:51
Average standard deviation of split frequencies: 0.015435
225500 -- (-498.605) (-493.374) [-493.957] (-495.465) * (-497.292) (-494.810) (-494.540) [-495.470] -- 0:00:51
226000 -- (-501.851) (-496.166) [-494.332] (-495.295) * (-502.140) (-498.259) [-495.568] (-493.964) -- 0:00:51
226500 -- (-495.184) [-494.340] (-496.527) (-496.002) * (-501.857) (-496.368) [-494.390] (-499.151) -- 0:00:51
227000 -- [-499.103] (-497.191) (-494.670) (-496.578) * (-499.763) [-499.154] (-494.371) (-495.255) -- 0:00:51
227500 -- (-494.834) (-497.939) [-497.836] (-495.154) * (-493.415) (-494.746) (-496.531) [-494.001] -- 0:00:50
228000 -- (-494.027) [-493.428] (-494.500) (-500.338) * (-495.086) [-496.754] (-501.864) (-496.765) -- 0:00:50
228500 -- (-494.547) (-498.040) [-495.079] (-495.754) * (-498.532) (-495.982) (-501.275) [-497.320] -- 0:00:50
229000 -- (-493.559) (-496.591) [-494.430] (-502.408) * (-495.985) (-497.071) [-495.173] (-496.507) -- 0:00:50
229500 -- [-494.916] (-498.743) (-498.160) (-501.090) * (-495.306) (-495.967) [-493.877] (-495.513) -- 0:00:50
230000 -- (-494.480) (-498.340) [-494.711] (-499.603) * (-497.050) [-493.324] (-493.372) (-495.264) -- 0:00:50
Average standard deviation of split frequencies: 0.015532
230500 -- [-493.507] (-494.259) (-494.342) (-495.848) * (-496.876) (-497.891) (-494.403) [-494.962] -- 0:00:50
231000 -- (-493.581) (-494.848) [-495.135] (-494.394) * (-496.096) (-499.098) [-494.770] (-497.744) -- 0:00:49
231500 -- (-499.439) (-495.435) [-493.905] (-495.526) * (-495.709) (-493.561) (-494.846) [-495.440] -- 0:00:49
232000 -- (-496.003) (-501.577) (-494.115) [-494.168] * (-497.531) [-494.823] (-498.090) (-494.248) -- 0:00:49
232500 -- (-500.457) [-493.919] (-494.476) (-494.431) * (-495.969) (-496.853) [-497.854] (-496.976) -- 0:00:49
233000 -- (-494.370) [-496.363] (-494.982) (-497.119) * [-495.058] (-496.493) (-496.176) (-496.078) -- 0:00:49
233500 -- (-495.516) [-500.018] (-494.770) (-496.553) * (-493.628) (-496.302) (-494.253) [-493.521] -- 0:00:49
234000 -- (-494.647) (-495.557) [-494.132] (-494.471) * (-495.257) (-495.059) [-494.126] (-502.662) -- 0:00:52
234500 -- (-496.766) (-494.528) [-494.254] (-494.251) * (-496.964) (-496.920) (-497.530) [-496.854] -- 0:00:52
235000 -- (-494.511) (-496.694) [-493.724] (-498.287) * (-496.006) (-498.044) [-495.113] (-496.873) -- 0:00:52
Average standard deviation of split frequencies: 0.015713
235500 -- [-493.488] (-496.146) (-494.122) (-495.985) * [-494.350] (-496.891) (-496.614) (-497.797) -- 0:00:51
236000 -- [-494.847] (-495.790) (-494.749) (-495.276) * (-494.910) (-493.907) [-497.485] (-495.858) -- 0:00:51
236500 -- [-497.657] (-495.438) (-496.605) (-495.698) * (-496.637) [-494.617] (-493.506) (-496.400) -- 0:00:51
237000 -- (-494.768) [-497.794] (-495.767) (-497.721) * (-497.036) [-495.146] (-496.266) (-496.004) -- 0:00:51
237500 -- (-496.447) (-496.538) (-494.860) [-496.671] * [-495.595] (-495.752) (-498.826) (-494.029) -- 0:00:51
238000 -- (-495.815) (-498.391) [-494.317] (-494.883) * [-499.013] (-495.459) (-495.643) (-497.283) -- 0:00:51
238500 -- (-496.191) (-494.538) (-494.295) [-494.346] * (-495.399) (-494.513) [-494.341] (-494.785) -- 0:00:51
239000 -- [-495.327] (-495.063) (-495.421) (-497.166) * [-494.084] (-493.430) (-494.113) (-499.224) -- 0:00:50
239500 -- (-496.041) [-495.823] (-495.494) (-497.052) * [-494.997] (-496.061) (-495.996) (-497.340) -- 0:00:50
240000 -- (-496.725) (-496.845) [-494.084] (-497.385) * (-495.362) (-496.525) (-494.232) [-497.917] -- 0:00:50
Average standard deviation of split frequencies: 0.015801
240500 -- (-497.591) [-494.465] (-496.371) (-495.119) * [-494.560] (-495.318) (-494.342) (-495.540) -- 0:00:50
241000 -- (-501.800) [-494.186] (-496.689) (-498.959) * (-497.091) (-500.824) (-495.871) [-494.533] -- 0:00:50
241500 -- (-498.256) [-495.547] (-495.900) (-495.039) * [-497.414] (-494.772) (-493.891) (-496.155) -- 0:00:50
242000 -- (-495.254) (-494.264) (-495.055) [-498.442] * (-499.526) (-496.103) (-496.449) [-494.058] -- 0:00:50
242500 -- (-493.329) (-496.013) (-493.955) [-498.616] * [-493.747] (-499.670) (-497.479) (-496.161) -- 0:00:49
243000 -- (-497.210) (-498.145) [-495.913] (-496.564) * (-495.964) (-498.233) [-494.583] (-498.676) -- 0:00:49
243500 -- [-495.580] (-495.695) (-494.371) (-494.634) * (-495.300) (-495.586) (-496.247) [-497.881] -- 0:00:49
244000 -- [-495.670] (-494.263) (-495.850) (-497.159) * (-499.131) (-495.840) (-498.456) [-496.391] -- 0:00:49
244500 -- [-494.954] (-493.245) (-496.111) (-494.843) * (-499.617) (-495.388) (-494.552) [-494.993] -- 0:00:49
245000 -- (-494.628) [-497.458] (-497.903) (-494.578) * (-496.994) [-495.481] (-494.716) (-494.559) -- 0:00:49
Average standard deviation of split frequencies: 0.016352
245500 -- [-494.017] (-494.828) (-497.203) (-497.417) * (-499.301) (-494.170) [-495.432] (-496.331) -- 0:00:49
246000 -- (-497.961) (-496.061) (-497.879) [-495.427] * (-497.254) (-497.639) (-494.213) [-494.450] -- 0:00:49
246500 -- [-497.584] (-495.233) (-497.439) (-494.725) * (-493.845) [-496.047] (-501.511) (-494.782) -- 0:00:48
247000 -- (-493.444) (-497.436) (-498.089) [-494.308] * (-494.635) (-498.910) (-497.588) [-494.834] -- 0:00:48
247500 -- [-500.047] (-496.264) (-494.186) (-495.305) * (-498.445) (-494.516) (-497.763) [-496.639] -- 0:00:51
248000 -- (-496.508) (-495.523) (-496.214) [-495.251] * (-498.268) [-494.901] (-493.966) (-495.711) -- 0:00:51
248500 -- (-494.557) (-500.020) (-494.096) [-495.861] * [-493.667] (-497.809) (-494.223) (-495.289) -- 0:00:51
249000 -- (-495.014) (-494.663) (-493.737) [-494.033] * (-495.414) (-497.508) (-494.526) [-497.885] -- 0:00:51
249500 -- [-495.071] (-496.716) (-493.845) (-496.233) * [-493.780] (-496.467) (-493.158) (-496.180) -- 0:00:51
250000 -- [-493.436] (-495.578) (-493.597) (-497.102) * (-496.462) [-495.356] (-494.065) (-498.032) -- 0:00:51
Average standard deviation of split frequencies: 0.015922
250500 -- [-495.395] (-498.191) (-494.396) (-497.984) * (-493.405) (-496.688) [-494.402] (-494.840) -- 0:00:50
251000 -- (-495.340) (-496.114) [-494.595] (-498.097) * (-493.653) [-495.786] (-495.080) (-494.021) -- 0:00:50
251500 -- (-497.786) (-497.750) (-494.454) [-495.542] * (-497.757) (-494.082) (-495.937) [-494.583] -- 0:00:50
252000 -- (-495.934) (-502.009) (-495.609) [-496.404] * (-495.190) (-494.444) (-496.058) [-494.730] -- 0:00:50
252500 -- [-493.740] (-501.038) (-495.810) (-495.355) * (-495.808) (-494.965) (-498.311) [-496.021] -- 0:00:50
253000 -- [-496.194] (-497.422) (-495.355) (-495.935) * [-495.773] (-495.248) (-494.819) (-496.256) -- 0:00:50
253500 -- (-499.884) (-497.267) (-496.068) [-494.131] * (-498.973) [-495.691] (-495.335) (-493.799) -- 0:00:50
254000 -- [-493.784] (-500.033) (-499.620) (-494.082) * (-498.661) (-499.238) [-494.446] (-493.839) -- 0:00:49
254500 -- (-493.210) (-495.291) [-495.272] (-496.602) * (-496.888) [-496.613] (-494.482) (-493.197) -- 0:00:49
255000 -- (-494.408) (-497.686) [-496.151] (-495.479) * [-494.233] (-495.256) (-493.840) (-499.425) -- 0:00:49
Average standard deviation of split frequencies: 0.016082
255500 -- (-497.445) (-494.897) (-494.647) [-496.367] * [-494.609] (-497.915) (-493.778) (-494.683) -- 0:00:49
256000 -- [-496.461] (-497.208) (-495.929) (-496.944) * [-493.692] (-496.387) (-494.073) (-495.851) -- 0:00:49
256500 -- (-494.031) (-493.615) [-495.280] (-497.008) * (-499.029) [-494.473] (-494.621) (-494.376) -- 0:00:49
257000 -- (-497.313) [-499.264] (-495.426) (-503.766) * [-496.668] (-497.364) (-494.951) (-497.012) -- 0:00:49
257500 -- (-493.591) [-496.169] (-497.340) (-498.845) * (-494.930) (-496.619) (-494.427) [-497.823] -- 0:00:49
258000 -- (-496.627) (-495.037) [-494.261] (-494.050) * (-493.515) [-497.183] (-496.806) (-495.199) -- 0:00:48
258500 -- [-493.845] (-495.258) (-495.674) (-496.022) * (-497.357) [-493.411] (-497.509) (-496.740) -- 0:00:48
259000 -- [-493.922] (-496.569) (-494.022) (-495.159) * (-495.865) [-498.576] (-494.833) (-497.495) -- 0:00:48
259500 -- (-493.497) (-502.898) (-495.011) [-495.757] * (-495.363) (-495.120) (-494.691) [-494.872] -- 0:00:48
260000 -- [-493.461] (-495.018) (-493.927) (-498.623) * (-498.186) [-495.117] (-494.394) (-496.736) -- 0:00:48
Average standard deviation of split frequencies: 0.017120
260500 -- (-494.652) (-494.958) (-494.751) [-499.808] * (-500.061) (-494.573) (-498.368) [-494.007] -- 0:00:48
261000 -- (-496.070) (-496.648) [-494.174] (-497.470) * (-496.270) (-495.021) [-494.971] (-494.790) -- 0:00:48
261500 -- (-499.075) (-500.339) (-496.411) [-494.227] * (-499.837) (-497.533) (-495.874) [-496.639] -- 0:00:48
262000 -- [-500.366] (-498.683) (-494.421) (-498.767) * (-507.176) [-494.191] (-495.549) (-499.405) -- 0:00:47
262500 -- (-497.028) (-500.688) (-497.957) [-497.287] * (-500.888) [-498.829] (-494.115) (-495.360) -- 0:00:47
263000 -- [-494.360] (-493.831) (-495.957) (-501.357) * (-497.791) (-498.401) (-498.425) [-495.266] -- 0:00:47
263500 -- (-496.026) (-494.898) [-493.672] (-500.170) * (-493.913) (-494.550) (-495.328) [-495.358] -- 0:00:47
264000 -- (-496.326) (-497.627) [-493.188] (-493.468) * (-494.984) (-494.528) (-496.452) [-495.642] -- 0:00:47
264500 -- (-500.182) (-496.579) (-494.724) [-494.289] * (-495.084) (-493.819) (-494.202) [-495.640] -- 0:00:50
265000 -- (-497.569) (-494.538) (-498.327) [-494.155] * [-494.770] (-495.381) (-494.379) (-496.841) -- 0:00:49
Average standard deviation of split frequencies: 0.019051
265500 -- (-497.566) (-495.807) (-493.785) [-498.541] * (-497.801) [-496.392] (-497.437) (-496.105) -- 0:00:49
266000 -- (-494.498) (-498.334) [-495.010] (-494.790) * (-498.217) (-495.668) (-494.762) [-493.790] -- 0:00:49
266500 -- [-495.254] (-496.609) (-500.667) (-496.988) * (-496.462) (-495.050) (-493.846) [-494.488] -- 0:00:49
267000 -- (-495.837) [-494.728] (-495.531) (-498.570) * [-494.595] (-494.206) (-495.424) (-494.786) -- 0:00:49
267500 -- (-498.367) (-499.712) [-495.687] (-499.375) * (-500.574) (-496.922) (-495.777) [-495.633] -- 0:00:49
268000 -- (-495.455) (-494.122) [-499.402] (-495.064) * [-495.613] (-494.636) (-501.153) (-495.237) -- 0:00:49
268500 -- (-499.827) [-495.567] (-497.538) (-493.939) * (-494.937) [-496.729] (-500.669) (-495.312) -- 0:00:49
269000 -- [-494.886] (-494.836) (-496.226) (-494.657) * (-495.295) [-496.164] (-495.725) (-495.787) -- 0:00:48
269500 -- (-495.289) (-498.843) [-494.188] (-494.558) * (-495.936) (-499.635) (-496.815) [-495.052] -- 0:00:48
270000 -- [-495.638] (-496.535) (-493.922) (-495.340) * [-495.742] (-494.812) (-498.072) (-495.123) -- 0:00:48
Average standard deviation of split frequencies: 0.019158
270500 -- (-495.063) [-493.806] (-494.188) (-493.623) * (-495.637) (-495.198) (-498.512) [-494.850] -- 0:00:48
271000 -- (-493.920) [-494.371] (-499.433) (-496.936) * (-494.043) (-494.728) [-495.148] (-495.966) -- 0:00:48
271500 -- (-497.996) [-494.878] (-500.302) (-495.264) * (-496.220) [-497.528] (-495.149) (-494.942) -- 0:00:48
272000 -- (-495.633) [-494.189] (-496.913) (-494.895) * [-497.938] (-493.975) (-494.226) (-495.503) -- 0:00:48
272500 -- (-493.371) (-495.420) [-495.341] (-496.093) * (-500.169) (-494.700) (-496.130) [-494.581] -- 0:00:48
273000 -- (-495.219) (-494.982) (-496.387) [-493.659] * (-495.367) (-500.382) (-499.079) [-494.591] -- 0:00:47
273500 -- [-494.063] (-494.843) (-501.288) (-496.000) * [-494.011] (-495.126) (-496.634) (-495.026) -- 0:00:47
274000 -- (-494.797) (-496.967) (-495.966) [-500.539] * (-496.573) (-495.425) [-495.452] (-495.786) -- 0:00:47
274500 -- (-497.254) [-497.034] (-496.383) (-500.506) * (-498.401) (-499.862) (-496.497) [-495.853] -- 0:00:47
275000 -- [-495.502] (-493.703) (-497.859) (-499.172) * [-495.402] (-495.945) (-497.143) (-499.781) -- 0:00:47
Average standard deviation of split frequencies: 0.018468
275500 -- (-494.006) (-494.186) (-499.389) [-494.286] * [-494.435] (-494.664) (-494.339) (-501.446) -- 0:00:47
276000 -- (-494.310) (-495.187) (-494.426) [-497.001] * [-495.238] (-495.627) (-493.253) (-503.994) -- 0:00:47
276500 -- [-493.592] (-493.724) (-494.830) (-494.633) * [-494.061] (-495.895) (-494.253) (-495.479) -- 0:00:47
277000 -- [-493.339] (-495.102) (-494.142) (-495.492) * [-496.615] (-495.352) (-503.555) (-496.937) -- 0:00:46
277500 -- (-496.521) (-497.092) (-493.856) [-500.904] * (-501.274) (-495.392) [-502.650] (-494.797) -- 0:00:46
278000 -- (-495.520) [-496.204] (-493.758) (-499.736) * (-496.101) [-493.903] (-495.193) (-495.385) -- 0:00:46
278500 -- (-493.568) [-497.814] (-493.806) (-495.030) * (-495.604) (-497.091) (-497.627) [-493.482] -- 0:00:46
279000 -- (-493.638) [-495.306] (-496.184) (-494.709) * [-497.004] (-496.263) (-494.380) (-493.704) -- 0:00:46
279500 -- (-495.796) [-499.699] (-493.923) (-497.643) * (-494.233) (-495.680) [-500.523] (-497.316) -- 0:00:46
280000 -- (-494.201) (-499.390) [-495.255] (-499.012) * (-496.775) (-496.099) (-494.065) [-498.350] -- 0:00:46
Average standard deviation of split frequencies: 0.018580
280500 -- (-496.479) (-494.031) [-495.030] (-494.215) * (-496.747) (-496.497) [-498.278] (-499.720) -- 0:00:46
281000 -- (-496.940) (-497.049) (-498.578) [-495.788] * (-495.545) [-494.596] (-494.673) (-500.671) -- 0:00:46
281500 -- (-497.741) [-493.662] (-497.485) (-495.461) * [-495.910] (-496.919) (-495.210) (-499.527) -- 0:00:48
282000 -- (-494.947) (-496.416) (-497.598) [-495.060] * (-493.846) (-495.667) (-498.614) [-493.806] -- 0:00:48
282500 -- (-496.335) (-498.268) (-496.539) [-493.454] * (-494.265) (-497.114) [-494.508] (-495.268) -- 0:00:48
283000 -- [-497.379] (-495.087) (-496.929) (-496.466) * (-494.035) (-498.055) [-494.690] (-493.419) -- 0:00:48
283500 -- (-497.907) (-496.415) (-495.838) [-496.834] * (-496.045) [-496.081] (-500.384) (-495.382) -- 0:00:48
284000 -- (-500.055) (-494.366) [-496.364] (-496.986) * (-496.078) (-495.216) (-495.704) [-496.443] -- 0:00:47
284500 -- (-493.547) (-495.130) [-494.942] (-495.901) * (-494.754) (-499.544) [-494.110] (-497.608) -- 0:00:47
285000 -- (-497.019) (-494.964) [-493.567] (-496.127) * [-497.835] (-496.168) (-495.294) (-494.918) -- 0:00:47
Average standard deviation of split frequencies: 0.018234
285500 -- [-494.250] (-497.096) (-495.475) (-493.402) * (-496.469) [-496.535] (-494.232) (-496.758) -- 0:00:47
286000 -- [-493.878] (-494.727) (-495.742) (-494.313) * (-495.842) (-496.996) (-496.246) [-497.894] -- 0:00:47
286500 -- (-494.611) (-493.894) [-494.443] (-497.164) * (-497.332) (-499.535) (-494.015) [-494.739] -- 0:00:47
287000 -- [-494.041] (-496.452) (-494.498) (-493.515) * (-496.333) [-499.773] (-500.811) (-495.631) -- 0:00:47
287500 -- (-494.404) (-494.946) (-499.166) [-495.194] * (-499.725) (-493.621) [-496.874] (-494.313) -- 0:00:47
288000 -- (-497.830) (-497.678) (-497.040) [-494.352] * (-493.513) (-494.099) (-494.092) [-495.222] -- 0:00:46
288500 -- (-497.834) (-494.951) (-494.744) [-494.277] * (-496.252) [-494.520] (-495.619) (-495.306) -- 0:00:46
289000 -- (-494.896) (-495.612) [-494.154] (-496.647) * (-497.045) (-495.798) [-498.074] (-501.956) -- 0:00:46
289500 -- (-493.594) (-494.646) [-495.281] (-497.024) * (-496.294) (-496.019) (-498.813) [-495.527] -- 0:00:46
290000 -- (-495.221) (-496.654) (-498.007) [-496.989] * [-495.701] (-498.295) (-494.978) (-494.634) -- 0:00:46
Average standard deviation of split frequencies: 0.017434
290500 -- (-493.568) (-494.049) [-495.973] (-496.967) * (-495.647) (-495.703) (-494.389) [-497.649] -- 0:00:46
291000 -- (-493.822) [-494.541] (-496.674) (-495.660) * (-495.405) (-494.733) [-495.026] (-496.546) -- 0:00:46
291500 -- (-496.166) (-498.235) [-494.711] (-497.596) * [-496.977] (-494.740) (-494.111) (-495.748) -- 0:00:46
292000 -- [-494.707] (-495.341) (-499.324) (-495.492) * (-495.865) [-493.844] (-495.006) (-498.505) -- 0:00:46
292500 -- (-495.410) (-494.426) [-496.911] (-495.862) * (-494.769) (-494.780) [-499.961] (-496.122) -- 0:00:45
293000 -- [-495.432] (-498.206) (-495.053) (-496.003) * (-494.534) (-498.575) [-494.541] (-496.092) -- 0:00:45
293500 -- (-495.746) (-495.293) [-495.521] (-495.892) * (-494.145) (-493.712) [-495.087] (-494.254) -- 0:00:45
294000 -- (-494.288) [-495.319] (-494.555) (-494.752) * (-493.843) [-493.935] (-494.760) (-496.660) -- 0:00:45
294500 -- (-494.203) (-497.813) (-500.673) [-494.097] * (-496.073) [-494.765] (-495.495) (-497.953) -- 0:00:45
295000 -- (-496.289) (-493.671) [-493.448] (-494.422) * (-495.145) (-496.401) [-496.177] (-497.969) -- 0:00:45
Average standard deviation of split frequencies: 0.016457
295500 -- (-498.915) (-494.886) (-493.588) [-496.829] * (-494.104) (-495.326) [-493.948] (-496.840) -- 0:00:45
296000 -- [-500.427] (-500.090) (-495.003) (-497.530) * (-499.365) (-500.268) [-495.498] (-497.234) -- 0:00:45
296500 -- (-494.636) [-494.167] (-494.619) (-495.474) * (-498.756) (-497.448) [-496.377] (-495.602) -- 0:00:45
297000 -- (-497.903) (-495.939) (-495.336) [-496.281] * (-497.800) [-499.843] (-493.907) (-493.521) -- 0:00:44
297500 -- (-494.106) (-494.190) [-494.944] (-499.047) * (-493.725) (-498.608) (-493.985) [-494.176] -- 0:00:44
298000 -- (-496.288) (-495.285) [-493.458] (-499.937) * (-503.602) [-499.242] (-494.435) (-497.410) -- 0:00:44
298500 -- (-493.427) [-494.507] (-493.487) (-495.130) * (-495.765) (-497.666) (-495.237) [-497.005] -- 0:00:47
299000 -- (-493.692) [-494.459] (-493.555) (-496.796) * (-494.585) (-495.857) (-493.842) [-495.136] -- 0:00:46
299500 -- (-501.293) [-494.993] (-494.993) (-496.455) * (-497.078) (-495.040) [-495.748] (-496.908) -- 0:00:46
300000 -- (-496.546) (-497.330) (-494.699) [-495.705] * (-494.218) [-494.390] (-499.653) (-495.125) -- 0:00:46
Average standard deviation of split frequencies: 0.016561
300500 -- (-500.701) (-497.658) [-494.247] (-494.037) * (-497.217) [-495.151] (-498.112) (-493.780) -- 0:00:46
301000 -- (-496.779) (-495.564) [-494.862] (-498.455) * (-497.766) [-496.029] (-496.400) (-493.985) -- 0:00:46
301500 -- (-494.208) (-494.613) (-497.843) [-497.085] * (-495.947) (-496.371) [-496.294] (-494.848) -- 0:00:46
302000 -- (-494.232) (-496.929) (-497.832) [-495.177] * [-496.459] (-496.950) (-499.537) (-495.392) -- 0:00:46
302500 -- (-496.965) [-495.662] (-498.014) (-495.395) * (-494.830) (-493.299) [-496.168] (-494.651) -- 0:00:46
303000 -- (-496.665) (-495.060) [-495.204] (-494.604) * (-498.033) (-494.659) [-493.553] (-497.030) -- 0:00:46
303500 -- [-499.430] (-496.903) (-494.419) (-494.948) * (-496.495) (-495.968) [-495.303] (-496.403) -- 0:00:45
304000 -- (-499.665) (-499.496) (-494.935) [-495.205] * (-494.141) (-495.940) (-494.334) [-494.182] -- 0:00:45
304500 -- [-497.274] (-499.147) (-494.597) (-496.918) * [-495.257] (-495.612) (-497.882) (-495.444) -- 0:00:45
305000 -- (-495.176) (-493.812) [-494.207] (-494.391) * (-495.592) (-495.954) [-494.927] (-497.478) -- 0:00:45
Average standard deviation of split frequencies: 0.016272
305500 -- (-495.018) (-494.514) (-496.141) [-496.296] * (-499.024) (-495.087) (-494.225) [-494.661] -- 0:00:45
306000 -- (-495.583) [-494.370] (-496.334) (-496.690) * (-494.838) [-499.327] (-496.308) (-495.756) -- 0:00:45
306500 -- (-496.056) (-494.595) [-493.851] (-495.161) * (-495.508) (-497.501) [-495.194] (-496.752) -- 0:00:45
307000 -- [-496.486] (-493.948) (-497.849) (-495.817) * (-494.679) (-496.743) (-498.063) [-497.841] -- 0:00:45
307500 -- (-495.194) (-495.707) (-498.149) [-495.379] * [-495.149] (-495.529) (-498.934) (-498.917) -- 0:00:45
308000 -- (-498.051) [-493.904] (-494.786) (-494.572) * [-493.719] (-493.734) (-495.022) (-497.001) -- 0:00:44
308500 -- (-494.940) (-495.155) [-502.654] (-495.775) * (-496.388) [-493.612] (-495.326) (-498.120) -- 0:00:44
309000 -- (-493.727) (-496.851) [-494.159] (-494.377) * (-494.489) [-494.705] (-494.864) (-497.946) -- 0:00:44
309500 -- (-494.664) [-496.065] (-495.723) (-501.295) * (-494.929) (-494.226) (-493.855) [-495.189] -- 0:00:44
310000 -- (-497.739) (-496.710) (-493.948) [-501.277] * (-493.920) [-496.182] (-493.895) (-496.251) -- 0:00:44
Average standard deviation of split frequencies: 0.016502
310500 -- [-494.838] (-496.687) (-494.377) (-495.602) * [-495.527] (-495.109) (-494.548) (-494.083) -- 0:00:44
311000 -- (-494.274) (-497.679) (-495.658) [-495.047] * (-498.353) [-495.909] (-493.692) (-494.347) -- 0:00:44
311500 -- [-495.106] (-495.390) (-499.398) (-496.687) * (-498.147) (-494.626) (-495.472) [-494.695] -- 0:00:44
312000 -- (-497.272) (-495.033) [-497.566] (-495.729) * (-494.440) (-494.447) (-496.283) [-495.218] -- 0:00:44
312500 -- [-497.045] (-494.801) (-496.080) (-493.736) * (-497.909) (-496.989) [-494.546] (-501.021) -- 0:00:44
313000 -- (-498.493) (-494.150) [-497.332] (-494.314) * (-500.342) (-494.075) [-494.854] (-495.001) -- 0:00:43
313500 -- [-495.427] (-496.095) (-496.360) (-494.318) * (-494.817) [-496.595] (-495.822) (-493.314) -- 0:00:45
314000 -- (-498.100) [-494.499] (-495.722) (-495.490) * (-494.403) (-495.429) (-496.514) [-495.670] -- 0:00:45
314500 -- [-496.196] (-493.798) (-495.839) (-494.983) * (-495.638) [-494.509] (-497.265) (-493.787) -- 0:00:45
315000 -- (-494.594) (-494.011) [-497.365] (-494.232) * (-494.982) (-495.448) (-498.998) [-495.262] -- 0:00:45
Average standard deviation of split frequencies: 0.015104
315500 -- [-495.212] (-495.307) (-495.207) (-494.363) * (-494.747) [-495.481] (-499.098) (-494.231) -- 0:00:45
316000 -- (-496.219) [-494.117] (-494.856) (-495.050) * [-493.920] (-497.290) (-498.192) (-498.436) -- 0:00:45
316500 -- [-495.334] (-493.830) (-495.215) (-497.184) * (-495.562) [-495.999] (-495.646) (-495.518) -- 0:00:45
317000 -- (-495.060) (-494.071) (-493.595) [-495.652] * (-495.463) [-496.383] (-494.655) (-495.807) -- 0:00:45
317500 -- [-493.839] (-497.979) (-494.247) (-494.910) * (-495.433) [-499.959] (-497.588) (-496.316) -- 0:00:45
318000 -- (-495.292) [-494.447] (-495.877) (-500.018) * (-493.935) (-495.742) [-495.691] (-494.368) -- 0:00:45
318500 -- (-495.415) (-495.122) [-496.976] (-495.536) * (-498.814) (-496.392) (-493.558) [-500.189] -- 0:00:44
319000 -- (-493.442) (-494.349) [-497.071] (-494.690) * (-495.298) (-497.192) [-497.818] (-495.031) -- 0:00:44
319500 -- (-494.998) [-493.296] (-494.815) (-494.832) * (-495.279) (-494.726) (-493.844) [-493.599] -- 0:00:44
320000 -- (-495.181) [-494.933] (-496.098) (-493.851) * (-495.539) [-495.001] (-495.790) (-494.506) -- 0:00:44
Average standard deviation of split frequencies: 0.014793
320500 -- (-497.902) (-496.547) (-500.465) [-495.028] * [-496.810] (-494.336) (-495.716) (-493.680) -- 0:00:44
321000 -- (-498.074) [-498.402] (-496.722) (-494.187) * (-495.467) (-494.877) (-494.336) [-495.056] -- 0:00:44
321500 -- [-495.578] (-495.430) (-497.174) (-496.681) * (-494.201) (-498.308) [-495.816] (-494.605) -- 0:00:44
322000 -- (-497.575) (-497.111) (-494.841) [-497.569] * (-497.966) (-496.726) [-495.341] (-498.245) -- 0:00:44
322500 -- (-497.341) (-494.292) (-496.334) [-496.173] * (-497.200) (-495.870) [-494.828] (-494.548) -- 0:00:44
323000 -- (-493.769) [-496.546] (-494.350) (-495.111) * (-494.015) [-495.563] (-494.576) (-494.441) -- 0:00:44
323500 -- (-495.677) [-494.895] (-494.355) (-494.777) * (-494.655) (-494.958) [-497.429] (-493.762) -- 0:00:43
324000 -- (-496.525) (-494.324) [-493.826] (-496.934) * (-494.844) (-496.870) [-495.016] (-495.454) -- 0:00:43
324500 -- [-495.732] (-494.993) (-496.384) (-498.467) * [-494.941] (-495.839) (-497.666) (-494.867) -- 0:00:43
325000 -- [-495.920] (-497.140) (-496.565) (-494.365) * [-497.889] (-494.147) (-496.509) (-493.618) -- 0:00:43
Average standard deviation of split frequencies: 0.015056
325500 -- (-496.679) [-494.318] (-499.144) (-494.579) * (-495.060) [-496.591] (-493.940) (-495.470) -- 0:00:43
326000 -- (-494.901) (-499.266) [-497.677] (-496.058) * [-494.444] (-497.633) (-493.968) (-496.659) -- 0:00:43
326500 -- [-495.044] (-498.478) (-504.654) (-497.880) * (-495.371) (-498.992) [-496.584] (-495.449) -- 0:00:43
327000 -- (-495.099) [-495.149] (-496.938) (-495.641) * (-493.849) (-497.556) (-494.321) [-494.959] -- 0:00:43
327500 -- (-495.132) (-494.675) (-498.964) [-495.952] * (-495.965) [-494.728] (-495.727) (-496.051) -- 0:00:43
328000 -- [-494.918] (-495.044) (-494.043) (-494.662) * [-495.509] (-494.029) (-494.736) (-495.386) -- 0:00:43
328500 -- [-497.772] (-495.155) (-494.464) (-494.785) * (-495.327) (-502.148) [-495.075] (-496.266) -- 0:00:42
329000 -- [-495.493] (-494.576) (-496.482) (-496.010) * (-494.956) (-497.769) [-498.136] (-495.555) -- 0:00:42
329500 -- (-496.667) (-494.588) (-496.316) [-494.568] * [-495.152] (-496.217) (-494.529) (-494.288) -- 0:00:42
330000 -- (-494.848) (-496.175) (-496.274) [-494.584] * [-495.574] (-496.762) (-497.726) (-493.595) -- 0:00:42
Average standard deviation of split frequencies: 0.013753
330500 -- (-493.770) (-498.565) [-493.934] (-498.921) * (-495.177) (-494.736) [-496.938] (-497.592) -- 0:00:44
331000 -- [-495.001] (-497.897) (-494.854) (-494.302) * (-495.271) (-495.385) (-497.115) [-495.788] -- 0:00:44
331500 -- (-495.923) [-496.294] (-498.798) (-494.681) * [-495.602] (-496.796) (-496.456) (-493.728) -- 0:00:44
332000 -- [-494.115] (-496.216) (-501.299) (-498.528) * (-497.182) (-494.688) [-495.110] (-495.975) -- 0:00:44
332500 -- [-495.355] (-498.671) (-500.407) (-500.616) * (-497.265) [-494.287] (-496.558) (-494.000) -- 0:00:44
333000 -- (-493.758) (-495.030) [-496.028] (-498.232) * (-498.745) [-495.140] (-498.206) (-494.099) -- 0:00:44
333500 -- (-495.399) (-493.424) (-493.958) [-496.471] * (-495.749) (-496.358) [-493.401] (-496.631) -- 0:00:43
334000 -- (-494.395) [-494.255] (-498.476) (-494.095) * (-496.432) (-493.999) [-494.145] (-496.529) -- 0:00:43
334500 -- (-494.244) (-495.160) (-496.447) [-493.295] * (-493.896) (-497.175) [-493.989] (-493.819) -- 0:00:43
335000 -- (-494.036) (-493.422) (-494.023) [-495.668] * (-496.048) (-493.841) (-493.694) [-494.526] -- 0:00:43
Average standard deviation of split frequencies: 0.013767
335500 -- (-493.906) (-493.397) [-494.020] (-495.563) * (-495.510) (-494.140) [-493.532] (-495.404) -- 0:00:43
336000 -- [-495.055] (-494.584) (-493.719) (-497.135) * (-495.589) [-495.302] (-496.869) (-493.899) -- 0:00:43
336500 -- [-495.254] (-493.735) (-493.826) (-494.328) * (-493.911) (-494.884) [-494.186] (-497.895) -- 0:00:43
337000 -- (-493.437) [-497.985] (-493.881) (-495.844) * [-497.083] (-497.494) (-495.173) (-494.104) -- 0:00:43
337500 -- (-496.660) (-494.965) [-498.180] (-494.414) * [-493.466] (-498.737) (-495.237) (-495.464) -- 0:00:43
338000 -- (-498.661) (-494.032) (-494.301) [-494.604] * (-493.858) (-496.429) (-497.046) [-494.255] -- 0:00:43
338500 -- (-495.360) (-497.194) (-496.893) [-496.674] * (-500.718) [-494.594] (-495.286) (-498.484) -- 0:00:42
339000 -- (-497.214) (-496.591) [-496.172] (-495.237) * (-493.339) (-497.168) (-495.626) [-499.352] -- 0:00:42
339500 -- (-499.125) (-495.698) (-493.929) [-494.761] * (-497.167) (-496.764) (-497.297) [-494.973] -- 0:00:42
340000 -- (-493.770) [-496.154] (-498.775) (-497.121) * (-496.849) [-494.370] (-493.817) (-493.782) -- 0:00:42
Average standard deviation of split frequencies: 0.012800
340500 -- (-495.398) (-495.511) [-496.473] (-495.116) * (-495.605) (-494.213) (-497.207) [-496.430] -- 0:00:42
341000 -- (-495.555) [-494.823] (-495.090) (-496.843) * (-494.498) [-496.067] (-493.980) (-498.092) -- 0:00:42
341500 -- (-494.408) (-501.163) [-495.957] (-495.278) * (-494.916) [-494.973] (-493.933) (-499.365) -- 0:00:42
342000 -- (-495.649) (-494.293) (-494.543) [-493.559] * (-495.086) (-493.267) [-496.245] (-497.042) -- 0:00:42
342500 -- (-496.542) (-495.527) [-495.877] (-497.032) * (-498.330) [-493.755] (-495.076) (-494.895) -- 0:00:42
343000 -- (-495.659) (-494.964) [-494.524] (-496.105) * (-497.745) (-494.529) [-493.889] (-493.371) -- 0:00:42
343500 -- (-495.789) (-493.458) [-496.609] (-496.610) * (-498.020) (-497.418) [-493.500] (-493.498) -- 0:00:42
344000 -- (-496.498) [-493.534] (-496.091) (-497.711) * (-495.911) (-496.008) (-496.578) [-494.337] -- 0:00:41
344500 -- (-495.867) (-494.362) [-500.946] (-500.216) * (-494.952) (-501.347) [-495.883] (-494.776) -- 0:00:41
345000 -- [-494.044] (-493.726) (-497.639) (-494.619) * [-494.311] (-496.675) (-495.827) (-497.113) -- 0:00:41
Average standard deviation of split frequencies: 0.011325
345500 -- (-493.546) (-493.820) [-494.825] (-496.180) * (-498.142) (-498.122) (-501.531) [-494.398] -- 0:00:41
346000 -- (-494.952) [-493.361] (-494.456) (-495.097) * (-496.475) [-495.168] (-497.552) (-494.992) -- 0:00:41
346500 -- [-494.465] (-500.241) (-494.691) (-494.187) * (-493.868) (-496.995) (-496.074) [-494.849] -- 0:00:41
347000 -- (-494.513) [-497.001] (-493.367) (-493.814) * [-494.527] (-503.330) (-495.116) (-499.243) -- 0:00:41
347500 -- (-495.351) (-494.153) (-495.685) [-496.784] * (-495.659) (-497.141) (-493.973) [-496.618] -- 0:00:41
348000 -- (-497.685) (-498.613) (-496.915) [-496.730] * (-499.430) (-495.108) [-498.804] (-496.495) -- 0:00:43
348500 -- (-494.771) [-496.648] (-497.716) (-494.462) * [-501.726] (-497.100) (-496.381) (-496.795) -- 0:00:42
349000 -- (-497.403) [-494.802] (-497.432) (-494.462) * (-495.924) [-497.293] (-499.839) (-496.421) -- 0:00:42
349500 -- [-496.021] (-494.785) (-499.915) (-494.077) * [-495.230] (-495.676) (-495.189) (-495.254) -- 0:00:42
350000 -- (-497.222) (-493.694) [-494.695] (-496.551) * [-494.982] (-495.256) (-495.493) (-497.600) -- 0:00:42
Average standard deviation of split frequencies: 0.011595
350500 -- [-496.360] (-494.182) (-498.030) (-496.412) * (-494.928) (-496.027) [-497.579] (-494.197) -- 0:00:42
351000 -- (-494.896) (-494.032) [-497.944] (-499.915) * (-495.482) (-494.904) (-495.479) [-497.484] -- 0:00:42
351500 -- (-493.659) (-498.547) [-496.653] (-495.597) * (-494.353) [-493.522] (-495.014) (-496.531) -- 0:00:42
352000 -- (-493.808) (-496.658) [-493.707] (-495.709) * (-497.763) [-494.832] (-496.249) (-497.204) -- 0:00:42
352500 -- (-498.419) (-500.398) [-495.454] (-497.596) * [-495.436] (-494.803) (-494.727) (-497.732) -- 0:00:42
353000 -- (-494.879) (-502.600) (-499.670) [-496.820] * (-495.206) [-493.660] (-494.999) (-495.770) -- 0:00:42
353500 -- (-495.039) [-498.490] (-497.812) (-496.781) * [-494.112] (-493.452) (-495.890) (-496.099) -- 0:00:42
354000 -- [-495.482] (-498.445) (-496.190) (-494.742) * (-495.983) (-493.208) [-498.518] (-495.786) -- 0:00:41
354500 -- (-497.481) [-494.097] (-496.733) (-496.966) * (-494.896) (-494.026) (-495.000) [-499.304] -- 0:00:41
355000 -- (-498.773) (-497.851) (-494.780) [-493.865] * [-495.268] (-494.997) (-495.992) (-493.800) -- 0:00:41
Average standard deviation of split frequencies: 0.012745
355500 -- (-500.638) (-498.301) (-495.319) [-496.612] * (-498.069) (-495.153) (-494.299) [-494.841] -- 0:00:41
356000 -- [-495.801] (-495.873) (-495.993) (-496.371) * (-496.911) (-494.736) [-493.851] (-495.691) -- 0:00:41
356500 -- (-495.472) (-500.498) [-497.776] (-494.359) * [-493.892] (-494.397) (-499.122) (-496.274) -- 0:00:41
357000 -- (-496.128) (-501.995) (-495.378) [-495.660] * (-495.366) [-494.376] (-494.696) (-495.975) -- 0:00:41
357500 -- [-495.458] (-496.322) (-494.365) (-496.223) * (-496.786) [-498.447] (-494.866) (-497.560) -- 0:00:41
358000 -- (-494.236) [-497.081] (-495.884) (-496.016) * [-494.139] (-495.949) (-494.130) (-494.327) -- 0:00:41
358500 -- (-496.491) (-498.208) [-497.042] (-495.763) * (-494.709) (-494.873) [-493.351] (-494.140) -- 0:00:41
359000 -- (-499.204) (-494.802) [-496.286] (-498.492) * (-495.630) (-493.542) (-494.189) [-498.183] -- 0:00:41
359500 -- (-495.117) (-494.402) (-497.256) [-498.045] * (-497.967) (-493.823) [-495.602] (-493.889) -- 0:00:40
360000 -- [-496.107] (-497.135) (-498.382) (-495.402) * (-494.946) (-494.887) [-495.762] (-495.539) -- 0:00:40
Average standard deviation of split frequencies: 0.012253
360500 -- (-494.859) (-493.575) (-496.359) [-494.844] * (-494.311) (-496.851) [-493.972] (-498.039) -- 0:00:40
361000 -- (-494.705) [-499.067] (-495.000) (-494.585) * (-495.463) (-497.685) [-493.762] (-494.027) -- 0:00:40
361500 -- (-494.014) [-494.120] (-498.232) (-495.099) * [-496.437] (-494.465) (-497.944) (-498.618) -- 0:00:40
362000 -- (-496.910) [-496.396] (-496.033) (-494.737) * [-498.645] (-494.673) (-497.283) (-496.635) -- 0:00:40
362500 -- [-495.685] (-497.471) (-495.309) (-496.903) * (-496.664) (-497.527) [-494.053] (-494.792) -- 0:00:40
363000 -- [-498.187] (-495.646) (-493.702) (-499.497) * (-494.164) [-495.663] (-495.642) (-496.714) -- 0:00:40
363500 -- (-495.293) [-495.342] (-494.963) (-495.914) * (-495.389) [-494.658] (-495.412) (-495.112) -- 0:00:40
364000 -- [-496.385] (-496.441) (-495.446) (-493.506) * [-494.722] (-494.217) (-494.931) (-496.118) -- 0:00:40
364500 -- (-494.381) (-497.851) (-495.497) [-493.882] * [-494.737] (-495.025) (-495.134) (-495.836) -- 0:00:40
365000 -- (-497.848) (-498.727) (-497.213) [-499.471] * (-494.533) (-495.670) [-497.460] (-495.980) -- 0:00:41
Average standard deviation of split frequencies: 0.011109
365500 -- [-495.735] (-495.408) (-496.268) (-497.338) * (-494.586) [-495.097] (-495.604) (-494.275) -- 0:00:41
366000 -- (-496.354) (-498.134) (-496.885) [-494.290] * [-497.648] (-495.121) (-498.584) (-496.575) -- 0:00:41
366500 -- (-495.728) (-499.159) (-496.645) [-494.298] * (-495.620) (-494.147) (-494.425) [-494.915] -- 0:00:41
367000 -- (-496.173) [-496.611] (-500.503) (-495.212) * [-494.193] (-497.193) (-495.420) (-495.546) -- 0:00:41
367500 -- [-494.382] (-493.787) (-494.888) (-495.148) * (-495.596) (-497.474) [-495.383] (-495.050) -- 0:00:41
368000 -- (-498.439) (-494.655) [-495.966] (-497.370) * (-496.611) (-497.072) (-498.549) [-496.424] -- 0:00:41
368500 -- (-500.599) [-493.377] (-495.832) (-498.434) * [-495.210] (-494.342) (-495.776) (-496.076) -- 0:00:41
369000 -- (-495.380) (-493.808) [-493.978] (-496.446) * (-494.469) (-495.965) [-496.128] (-494.482) -- 0:00:41
369500 -- (-496.656) (-496.155) [-493.550] (-494.038) * (-496.257) (-494.367) (-498.362) [-494.782] -- 0:00:40
370000 -- [-495.184] (-493.938) (-495.755) (-495.061) * (-496.556) (-494.879) [-497.442] (-495.537) -- 0:00:40
Average standard deviation of split frequencies: 0.010492
370500 -- (-494.936) (-496.778) (-501.121) [-496.211] * (-494.382) (-495.337) (-493.712) [-494.292] -- 0:00:40
371000 -- (-493.664) (-498.054) [-497.030] (-496.652) * (-494.605) [-494.792] (-495.311) (-494.426) -- 0:00:40
371500 -- [-494.373] (-497.952) (-496.561) (-494.109) * [-494.575] (-495.585) (-499.282) (-494.417) -- 0:00:40
372000 -- (-494.777) (-495.696) (-493.212) [-497.690] * (-495.043) (-495.833) (-497.279) [-496.480] -- 0:00:40
372500 -- [-495.378] (-495.360) (-495.287) (-496.544) * (-494.255) (-498.434) (-496.614) [-493.725] -- 0:00:40
373000 -- (-498.828) (-497.520) (-497.089) [-495.779] * (-496.730) [-494.399] (-500.726) (-495.433) -- 0:00:40
373500 -- [-496.484] (-497.319) (-494.302) (-496.474) * (-498.751) [-497.855] (-494.286) (-493.928) -- 0:00:40
374000 -- [-499.237] (-501.468) (-497.781) (-496.295) * (-496.079) (-495.932) [-496.586] (-495.034) -- 0:00:40
374500 -- [-494.616] (-495.217) (-496.783) (-495.030) * (-496.458) (-495.048) [-497.945] (-494.243) -- 0:00:40
375000 -- (-498.491) (-495.853) (-495.066) [-498.070] * (-493.751) (-494.311) [-496.870] (-494.021) -- 0:00:40
Average standard deviation of split frequencies: 0.010108
375500 -- (-495.512) (-494.501) (-494.527) [-494.927] * (-495.765) (-496.929) [-497.060] (-499.015) -- 0:00:39
376000 -- (-496.981) [-495.368] (-494.640) (-493.635) * (-496.838) (-495.289) [-494.379] (-500.148) -- 0:00:39
376500 -- [-496.059] (-496.065) (-496.895) (-493.980) * [-493.559] (-495.608) (-497.798) (-497.518) -- 0:00:39
377000 -- (-495.344) [-496.210] (-496.306) (-496.902) * (-497.958) (-496.714) (-498.174) [-493.536] -- 0:00:39
377500 -- (-495.280) (-497.120) (-494.316) [-497.879] * (-496.207) [-496.680] (-495.533) (-495.724) -- 0:00:39
378000 -- [-494.444] (-496.384) (-498.238) (-494.268) * (-500.973) [-495.277] (-493.880) (-494.760) -- 0:00:39
378500 -- (-495.026) (-496.609) (-497.426) [-494.250] * (-500.745) (-500.649) (-495.796) [-497.504] -- 0:00:39
379000 -- (-494.620) (-495.822) (-495.296) [-498.837] * (-498.214) (-495.450) [-495.144] (-500.098) -- 0:00:39
379500 -- (-495.784) (-495.802) [-494.613] (-498.497) * (-499.826) [-496.201] (-496.173) (-500.073) -- 0:00:39
380000 -- (-497.097) (-496.355) (-495.868) [-496.379] * (-496.179) [-493.914] (-498.168) (-495.021) -- 0:00:39
Average standard deviation of split frequencies: 0.010449
380500 -- (-496.114) (-494.071) (-497.050) [-494.276] * (-495.282) (-494.795) [-498.825] (-495.060) -- 0:00:39
381000 -- [-494.907] (-497.347) (-495.780) (-494.245) * (-493.801) (-499.313) (-499.815) [-494.845] -- 0:00:38
381500 -- (-495.037) (-499.957) (-495.882) [-497.368] * (-499.285) (-501.908) [-495.392] (-495.736) -- 0:00:38
382000 -- [-496.743] (-498.305) (-496.497) (-495.574) * [-495.782] (-493.811) (-496.876) (-495.179) -- 0:00:40
382500 -- [-494.317] (-499.164) (-494.516) (-494.303) * [-495.488] (-494.147) (-496.689) (-493.771) -- 0:00:40
383000 -- (-496.254) (-494.505) (-497.873) [-493.845] * (-497.418) (-497.165) [-497.377] (-498.636) -- 0:00:40
383500 -- (-493.542) (-497.910) (-495.984) [-495.946] * (-497.980) [-494.595] (-497.439) (-496.642) -- 0:00:40
384000 -- [-493.208] (-503.780) (-494.130) (-495.026) * (-497.365) (-496.961) [-495.819] (-494.492) -- 0:00:40
384500 -- (-493.925) [-495.031] (-494.287) (-496.955) * (-496.434) [-494.729] (-493.852) (-497.040) -- 0:00:40
385000 -- (-494.565) (-496.429) (-498.155) [-495.156] * (-494.353) (-494.726) (-495.411) [-495.980] -- 0:00:39
Average standard deviation of split frequencies: 0.011297
385500 -- (-494.339) [-495.035] (-496.324) (-494.084) * (-493.330) (-497.273) [-494.665] (-496.502) -- 0:00:39
386000 -- (-496.273) [-494.436] (-499.680) (-494.527) * [-495.718] (-493.717) (-496.818) (-497.144) -- 0:00:39
386500 -- [-494.136] (-494.790) (-502.448) (-496.157) * (-496.510) (-493.588) (-494.628) [-496.821] -- 0:00:39
387000 -- (-496.240) (-496.437) (-498.914) [-493.470] * (-495.331) [-495.497] (-500.039) (-494.153) -- 0:00:39
387500 -- (-496.796) (-495.463) [-495.562] (-495.985) * [-498.233] (-495.909) (-497.324) (-494.388) -- 0:00:39
388000 -- (-499.557) (-494.935) [-494.324] (-493.200) * (-495.609) (-495.563) [-493.666] (-497.585) -- 0:00:39
388500 -- (-499.141) (-494.992) (-497.134) [-494.692] * (-494.254) [-494.527] (-495.659) (-494.784) -- 0:00:39
389000 -- (-499.742) [-494.588] (-499.745) (-494.000) * (-494.695) (-498.368) (-501.499) [-493.928] -- 0:00:39
389500 -- [-494.435] (-495.436) (-496.266) (-493.624) * (-496.381) (-495.505) (-494.367) [-495.035] -- 0:00:39
390000 -- [-494.482] (-495.942) (-498.094) (-495.642) * [-495.597] (-496.451) (-494.367) (-495.262) -- 0:00:39
Average standard deviation of split frequencies: 0.011539
390500 -- [-495.164] (-500.662) (-494.241) (-498.586) * [-496.180] (-495.803) (-497.199) (-497.356) -- 0:00:39
391000 -- (-494.128) (-496.683) [-494.207] (-496.676) * [-497.420] (-494.372) (-496.285) (-494.862) -- 0:00:38
391500 -- (-495.548) (-499.412) [-493.815] (-496.445) * (-493.825) [-495.179] (-497.245) (-499.082) -- 0:00:38
392000 -- [-494.984] (-496.153) (-495.886) (-494.534) * (-496.794) [-496.718] (-494.006) (-496.026) -- 0:00:38
392500 -- (-498.715) [-497.558] (-499.548) (-499.125) * [-496.645] (-494.085) (-495.365) (-495.226) -- 0:00:38
393000 -- (-495.327) [-493.127] (-493.949) (-494.521) * (-494.285) (-494.211) (-495.421) [-495.194] -- 0:00:38
393500 -- [-494.739] (-495.673) (-495.723) (-494.015) * (-494.150) (-495.118) [-495.727] (-494.609) -- 0:00:38
394000 -- [-494.690] (-493.207) (-497.845) (-493.886) * (-495.064) (-493.445) [-495.471] (-494.619) -- 0:00:38
394500 -- (-494.394) [-494.928] (-496.802) (-499.203) * [-493.349] (-496.979) (-495.365) (-495.847) -- 0:00:38
395000 -- (-495.479) [-495.938] (-495.051) (-495.964) * [-495.913] (-494.063) (-494.079) (-499.929) -- 0:00:38
Average standard deviation of split frequencies: 0.011904
395500 -- [-496.242] (-495.992) (-495.571) (-494.273) * (-496.035) (-493.725) [-494.947] (-499.105) -- 0:00:38
396000 -- [-495.176] (-497.547) (-498.803) (-496.479) * (-499.495) (-493.591) (-497.164) [-499.709] -- 0:00:38
396500 -- (-494.729) [-494.990] (-495.428) (-500.646) * (-497.042) [-493.955] (-495.264) (-500.083) -- 0:00:38
397000 -- [-494.150] (-497.593) (-495.427) (-499.224) * (-496.269) (-495.807) [-501.664] (-495.132) -- 0:00:37
397500 -- (-494.094) [-494.830] (-496.642) (-498.787) * [-494.783] (-498.599) (-498.449) (-493.759) -- 0:00:37
398000 -- (-495.481) (-497.905) [-494.845] (-496.257) * [-495.686] (-497.294) (-500.357) (-496.626) -- 0:00:37
398500 -- [-495.046] (-494.092) (-499.618) (-495.799) * [-494.457] (-498.638) (-496.225) (-495.323) -- 0:00:37
399000 -- (-495.163) (-495.325) [-495.095] (-495.777) * (-495.953) [-495.377] (-497.989) (-494.948) -- 0:00:37
399500 -- (-499.411) [-496.197] (-496.077) (-494.176) * (-494.089) [-497.015] (-495.469) (-496.349) -- 0:00:39
400000 -- [-496.444] (-501.570) (-495.148) (-495.347) * (-496.894) (-494.104) [-495.179] (-496.346) -- 0:00:39
Average standard deviation of split frequencies: 0.012574
400500 -- [-494.523] (-496.104) (-497.349) (-494.901) * (-498.691) (-497.493) [-494.851] (-498.869) -- 0:00:38
401000 -- (-494.276) (-496.896) [-496.231] (-496.263) * [-498.880] (-495.742) (-495.261) (-495.617) -- 0:00:38
401500 -- (-496.171) (-498.561) [-493.988] (-497.419) * (-497.000) (-495.346) [-494.678] (-495.682) -- 0:00:38
402000 -- (-495.826) [-497.279] (-493.712) (-494.676) * (-496.625) [-495.948] (-494.025) (-496.234) -- 0:00:38
402500 -- (-494.887) (-494.184) (-497.787) [-496.688] * [-494.472] (-496.569) (-495.132) (-497.986) -- 0:00:38
403000 -- [-494.194] (-493.231) (-497.201) (-494.197) * [-497.792] (-494.818) (-497.183) (-494.193) -- 0:00:38
403500 -- (-498.646) (-495.627) (-495.634) [-495.653] * (-499.698) [-493.842] (-495.241) (-495.490) -- 0:00:38
404000 -- (-500.724) [-493.914] (-499.964) (-495.940) * (-495.687) [-495.862] (-494.824) (-495.671) -- 0:00:38
404500 -- [-496.501] (-495.912) (-497.202) (-494.646) * [-493.822] (-494.503) (-495.646) (-497.264) -- 0:00:38
405000 -- [-496.549] (-494.451) (-496.535) (-494.430) * [-494.347] (-495.810) (-495.381) (-494.035) -- 0:00:38
Average standard deviation of split frequencies: 0.011756
405500 -- (-495.392) [-495.385] (-493.155) (-495.211) * (-495.139) [-494.060] (-494.940) (-497.966) -- 0:00:38
406000 -- (-497.013) (-496.530) (-495.304) [-493.931] * [-495.666] (-497.430) (-494.503) (-496.266) -- 0:00:38
406500 -- (-496.747) (-496.298) [-495.866] (-496.740) * (-495.375) (-494.002) [-496.336] (-499.495) -- 0:00:37
407000 -- (-494.413) (-496.691) [-497.151] (-499.757) * [-495.168] (-493.824) (-499.182) (-494.253) -- 0:00:37
407500 -- (-496.255) (-494.954) [-493.903] (-496.875) * (-495.095) (-493.224) (-506.253) [-494.210] -- 0:00:37
408000 -- (-495.440) [-495.816] (-497.314) (-495.090) * (-494.100) [-495.980] (-499.110) (-495.651) -- 0:00:37
408500 -- (-495.272) (-496.388) (-496.255) [-493.867] * (-505.654) (-496.962) (-495.359) [-493.999] -- 0:00:37
409000 -- (-499.898) [-496.927] (-494.448) (-494.322) * (-497.026) (-495.589) [-495.202] (-501.818) -- 0:00:37
409500 -- [-494.244] (-495.163) (-494.449) (-494.844) * (-494.054) (-498.290) (-494.228) [-498.555] -- 0:00:37
410000 -- [-497.477] (-496.732) (-495.989) (-494.706) * [-496.491] (-496.195) (-497.529) (-497.264) -- 0:00:37
Average standard deviation of split frequencies: 0.011049
410500 -- (-497.453) (-496.905) (-493.408) [-494.590] * (-496.480) (-493.988) [-494.841] (-496.640) -- 0:00:37
411000 -- [-493.698] (-497.190) (-498.522) (-498.160) * (-499.653) [-493.352] (-497.372) (-498.708) -- 0:00:37
411500 -- (-495.624) (-497.237) (-498.684) [-494.696] * [-495.445] (-493.756) (-497.046) (-494.481) -- 0:00:37
412000 -- (-495.539) (-493.693) [-497.208] (-493.805) * [-495.010] (-494.060) (-499.629) (-494.240) -- 0:00:37
412500 -- [-495.036] (-495.564) (-505.006) (-493.847) * (-496.871) [-495.374] (-495.564) (-494.351) -- 0:00:37
413000 -- (-497.940) [-494.315] (-497.266) (-493.841) * (-498.747) (-499.260) (-493.826) [-493.623] -- 0:00:36
413500 -- (-494.191) (-495.160) (-493.698) [-494.659] * (-495.348) (-494.572) [-493.861] (-493.816) -- 0:00:36
414000 -- (-497.141) (-497.130) (-496.827) [-494.077] * (-496.046) [-496.306] (-496.611) (-494.110) -- 0:00:36
414500 -- (-496.579) (-500.753) [-494.659] (-494.524) * (-494.980) [-494.211] (-498.921) (-494.015) -- 0:00:36
415000 -- (-495.050) [-494.587] (-493.344) (-494.535) * (-497.101) (-493.319) [-495.168] (-495.277) -- 0:00:36
Average standard deviation of split frequencies: 0.010694
415500 -- (-494.777) [-493.841] (-493.800) (-497.705) * [-495.560] (-498.829) (-494.188) (-494.622) -- 0:00:36
416000 -- (-494.097) [-493.324] (-494.175) (-494.524) * (-494.057) [-493.571] (-493.911) (-493.558) -- 0:00:37
416500 -- [-495.336] (-497.623) (-495.038) (-493.724) * [-493.365] (-493.773) (-495.038) (-494.018) -- 0:00:37
417000 -- [-494.074] (-495.890) (-495.331) (-493.417) * [-494.698] (-495.572) (-496.928) (-497.438) -- 0:00:37
417500 -- [-495.075] (-494.838) (-496.524) (-494.843) * (-498.059) (-493.529) (-496.455) [-495.053] -- 0:00:37
418000 -- (-496.019) [-494.619] (-498.725) (-497.573) * [-494.926] (-493.688) (-495.288) (-498.503) -- 0:00:37
418500 -- (-495.433) [-493.807] (-497.973) (-495.230) * (-493.604) [-494.555] (-496.435) (-494.735) -- 0:00:37
419000 -- (-498.880) (-493.724) [-496.188] (-497.909) * (-496.076) (-496.527) (-497.774) [-497.987] -- 0:00:37
419500 -- [-498.992] (-496.820) (-497.642) (-496.088) * (-494.870) (-495.886) [-495.168] (-494.049) -- 0:00:37
420000 -- (-495.203) (-495.216) [-494.282] (-494.641) * (-497.138) (-495.096) (-497.613) [-494.875] -- 0:00:37
Average standard deviation of split frequencies: 0.010436
420500 -- (-496.244) (-495.229) [-498.624] (-493.886) * (-494.771) (-497.161) (-494.703) [-497.864] -- 0:00:37
421000 -- [-493.821] (-497.067) (-494.735) (-493.740) * (-497.859) (-496.612) [-494.317] (-498.305) -- 0:00:37
421500 -- (-494.574) [-494.676] (-497.585) (-496.523) * (-495.667) (-495.237) (-493.308) [-495.344] -- 0:00:37
422000 -- (-494.070) [-496.922] (-494.689) (-494.485) * (-494.926) (-494.134) [-493.546] (-495.787) -- 0:00:36
422500 -- (-497.318) [-496.652] (-495.064) (-499.280) * (-495.143) (-497.438) [-495.409] (-494.867) -- 0:00:36
423000 -- (-496.668) (-501.302) (-501.826) [-495.674] * (-495.243) (-494.163) [-496.453] (-494.786) -- 0:00:36
423500 -- (-496.180) (-498.297) (-494.108) [-495.340] * (-496.673) [-493.796] (-495.514) (-496.085) -- 0:00:36
424000 -- (-502.143) (-497.640) (-495.418) [-496.344] * (-495.175) [-495.692] (-495.230) (-494.405) -- 0:00:36
424500 -- (-494.327) (-495.679) [-495.577] (-495.806) * (-496.082) [-496.730] (-497.350) (-494.576) -- 0:00:36
425000 -- [-494.660] (-497.650) (-494.930) (-495.741) * (-495.853) [-495.107] (-501.034) (-494.161) -- 0:00:36
Average standard deviation of split frequencies: 0.010513
425500 -- (-494.792) [-495.665] (-494.946) (-493.784) * (-493.570) [-495.096] (-493.660) (-494.275) -- 0:00:36
426000 -- (-497.207) [-495.249] (-497.664) (-497.320) * [-493.428] (-494.008) (-495.757) (-496.429) -- 0:00:36
426500 -- (-496.396) (-495.679) (-494.011) [-494.843] * [-494.917] (-497.434) (-496.017) (-494.549) -- 0:00:36
427000 -- [-495.484] (-496.652) (-493.419) (-496.664) * [-495.342] (-496.826) (-495.579) (-495.337) -- 0:00:36
427500 -- (-496.454) (-496.488) [-498.300] (-495.998) * (-494.286) [-497.685] (-495.733) (-494.864) -- 0:00:36
428000 -- [-493.960] (-493.848) (-493.530) (-494.277) * [-496.651] (-497.916) (-495.171) (-494.267) -- 0:00:36
428500 -- (-494.299) (-494.143) (-496.084) [-496.315] * (-494.620) (-496.200) [-495.584] (-498.421) -- 0:00:36
429000 -- (-495.519) [-494.319] (-495.972) (-495.694) * (-495.236) (-494.931) [-493.408] (-499.707) -- 0:00:35
429500 -- (-494.071) (-495.294) [-493.563] (-498.458) * [-495.707] (-497.633) (-493.281) (-496.264) -- 0:00:35
430000 -- (-494.854) (-500.242) (-493.609) [-495.582] * (-495.112) [-496.149] (-498.650) (-497.512) -- 0:00:35
Average standard deviation of split frequencies: 0.010262
430500 -- (-498.267) (-496.634) (-495.418) [-493.944] * (-496.088) (-500.063) (-496.383) [-494.757] -- 0:00:35
431000 -- (-499.490) (-493.709) [-493.896] (-496.250) * [-495.565] (-496.170) (-500.899) (-495.425) -- 0:00:35
431500 -- (-503.208) (-493.943) (-500.315) [-493.678] * (-494.390) (-494.573) (-496.696) [-493.392] -- 0:00:35
432000 -- (-494.095) (-493.951) (-496.261) [-494.454] * (-494.277) (-495.235) (-498.153) [-494.121] -- 0:00:35
432500 -- (-495.217) [-494.946] (-494.164) (-494.543) * (-500.462) (-495.983) (-499.483) [-495.601] -- 0:00:35
433000 -- (-496.280) [-497.094] (-496.170) (-496.084) * (-496.332) [-493.975] (-494.928) (-495.104) -- 0:00:35
433500 -- (-494.484) (-494.640) [-495.861] (-495.299) * (-495.610) [-493.967] (-498.125) (-497.766) -- 0:00:36
434000 -- (-495.195) [-493.916] (-496.495) (-494.856) * (-496.494) (-494.140) (-496.565) [-495.834] -- 0:00:36
434500 -- [-494.210] (-494.279) (-494.954) (-496.139) * (-494.369) [-494.445] (-495.393) (-493.955) -- 0:00:36
435000 -- (-495.432) (-495.455) [-497.577] (-497.225) * (-494.935) [-494.955] (-496.206) (-495.355) -- 0:00:36
Average standard deviation of split frequencies: 0.009731
435500 -- (-497.700) [-493.991] (-496.931) (-494.235) * (-494.058) (-495.263) (-494.043) [-495.380] -- 0:00:36
436000 -- (-493.582) (-497.722) (-494.659) [-495.794] * (-494.036) (-498.903) (-493.391) [-495.326] -- 0:00:36
436500 -- (-496.264) (-497.597) (-494.655) [-497.984] * [-494.909] (-495.015) (-493.212) (-499.470) -- 0:00:36
437000 -- (-497.439) [-500.776] (-495.402) (-496.441) * [-495.152] (-493.982) (-496.076) (-501.221) -- 0:00:36
437500 -- [-495.538] (-494.660) (-496.407) (-493.314) * [-493.690] (-499.072) (-494.263) (-497.571) -- 0:00:36
438000 -- (-494.716) (-496.776) [-495.220] (-494.759) * (-495.946) [-494.161] (-498.618) (-497.687) -- 0:00:35
438500 -- [-494.904] (-494.476) (-494.800) (-497.260) * (-496.195) [-497.186] (-494.898) (-494.715) -- 0:00:35
439000 -- [-493.342] (-495.094) (-494.357) (-494.826) * (-495.803) (-494.474) [-496.117] (-495.406) -- 0:00:35
439500 -- (-494.424) [-494.837] (-495.422) (-494.809) * (-495.919) (-495.440) [-494.985] (-493.861) -- 0:00:35
440000 -- [-498.370] (-495.959) (-494.568) (-496.460) * (-494.691) [-499.317] (-501.806) (-495.238) -- 0:00:35
Average standard deviation of split frequencies: 0.010198
440500 -- (-494.498) (-497.058) (-495.754) [-495.710] * (-497.394) [-498.171] (-496.323) (-495.842) -- 0:00:35
441000 -- [-495.551] (-495.548) (-500.669) (-494.014) * [-495.461] (-494.947) (-497.596) (-494.258) -- 0:00:35
441500 -- [-494.660] (-498.038) (-495.471) (-496.918) * (-497.336) (-494.273) [-495.640] (-499.598) -- 0:00:35
442000 -- (-494.704) (-494.707) (-495.443) [-495.738] * (-497.395) [-495.430] (-493.951) (-498.176) -- 0:00:35
442500 -- (-497.223) [-499.305] (-497.811) (-494.503) * (-495.996) (-497.170) [-497.184] (-494.771) -- 0:00:35
443000 -- (-494.365) [-497.376] (-498.102) (-494.223) * [-496.234] (-494.949) (-494.636) (-494.544) -- 0:00:35
443500 -- [-494.713] (-496.959) (-498.959) (-495.427) * (-497.176) [-495.886] (-493.971) (-495.107) -- 0:00:35
444000 -- (-496.458) (-495.217) [-494.861] (-497.321) * (-496.454) [-495.165] (-496.390) (-494.443) -- 0:00:35
444500 -- (-495.923) (-496.062) (-496.441) [-494.098] * (-495.070) (-495.569) (-494.350) [-493.359] -- 0:00:34
445000 -- (-497.072) (-493.993) [-496.994] (-497.685) * (-497.495) (-494.687) (-494.630) [-495.307] -- 0:00:34
Average standard deviation of split frequencies: 0.009654
445500 -- (-501.753) [-493.997] (-494.799) (-500.075) * (-495.977) (-497.190) [-496.322] (-494.931) -- 0:00:34
446000 -- (-496.543) (-494.965) [-495.038] (-499.363) * (-493.950) [-495.791] (-496.288) (-496.999) -- 0:00:34
446500 -- (-494.904) (-495.592) (-495.948) [-494.469] * (-497.130) (-497.758) [-495.672] (-496.803) -- 0:00:34
447000 -- (-494.649) (-497.984) (-495.733) [-496.468] * (-499.024) [-500.394] (-496.063) (-496.385) -- 0:00:34
447500 -- (-496.157) (-496.617) (-494.789) [-495.937] * [-494.812] (-496.262) (-497.471) (-498.215) -- 0:00:34
448000 -- [-493.821] (-493.736) (-496.346) (-497.248) * [-493.793] (-494.438) (-497.662) (-502.676) -- 0:00:34
448500 -- (-493.512) [-493.946] (-494.288) (-493.990) * (-494.289) (-497.405) [-496.775] (-497.347) -- 0:00:34
449000 -- (-493.482) (-495.158) [-495.869] (-497.732) * (-501.424) (-494.441) [-493.978] (-496.578) -- 0:00:34
449500 -- (-493.388) (-494.550) (-495.567) [-494.283] * [-496.204] (-495.489) (-494.716) (-497.480) -- 0:00:34
450000 -- (-493.988) [-494.614] (-499.873) (-498.871) * [-498.049] (-499.253) (-496.277) (-495.808) -- 0:00:34
Average standard deviation of split frequencies: 0.009623
450500 -- [-494.523] (-497.291) (-494.288) (-496.402) * (-496.603) (-496.439) [-493.626] (-496.417) -- 0:00:35
451000 -- (-495.755) [-496.556] (-493.384) (-495.788) * [-496.062] (-497.079) (-493.751) (-494.742) -- 0:00:35
451500 -- [-495.407] (-494.249) (-495.653) (-495.218) * [-497.281] (-494.196) (-498.795) (-496.162) -- 0:00:35
452000 -- (-495.426) (-497.515) (-497.833) [-495.439] * (-498.918) [-493.243] (-495.250) (-498.003) -- 0:00:35
452500 -- (-495.498) [-494.924] (-494.770) (-497.124) * (-497.197) (-498.564) (-497.987) [-493.713] -- 0:00:35
453000 -- (-498.987) (-494.825) (-493.595) [-498.543] * [-494.849] (-498.401) (-494.493) (-493.942) -- 0:00:35
453500 -- (-495.013) [-496.252] (-493.417) (-496.440) * (-495.916) [-494.693] (-494.872) (-496.109) -- 0:00:34
454000 -- (-496.284) (-493.471) (-493.444) [-495.221] * (-495.559) (-494.828) [-495.359] (-497.062) -- 0:00:34
454500 -- (-504.450) [-497.846] (-495.745) (-495.638) * (-495.010) (-494.894) (-499.615) [-495.842] -- 0:00:34
455000 -- (-498.035) [-494.372] (-494.558) (-495.508) * (-494.416) [-493.975] (-496.686) (-495.786) -- 0:00:34
Average standard deviation of split frequencies: 0.008546
455500 -- (-497.048) (-494.885) [-496.378] (-497.224) * [-493.706] (-495.279) (-496.072) (-495.995) -- 0:00:34
456000 -- (-495.797) [-493.457] (-496.830) (-493.867) * (-494.280) (-495.135) [-496.535] (-494.419) -- 0:00:34
456500 -- (-496.227) (-497.362) [-494.630] (-495.436) * (-494.841) [-495.461] (-496.433) (-497.583) -- 0:00:34
457000 -- (-494.031) [-497.061] (-494.137) (-494.223) * (-497.546) (-493.340) [-495.301] (-497.612) -- 0:00:34
457500 -- (-494.394) (-493.948) (-495.833) [-493.713] * (-497.788) [-494.327] (-496.976) (-494.797) -- 0:00:34
458000 -- (-495.183) [-493.869] (-497.038) (-495.282) * (-496.088) (-495.653) (-494.329) [-494.381] -- 0:00:34
458500 -- (-495.805) (-495.244) (-494.518) [-493.879] * (-494.091) [-495.829] (-494.248) (-494.918) -- 0:00:34
459000 -- (-494.660) (-494.457) [-496.693] (-497.583) * (-497.569) [-495.797] (-496.531) (-498.411) -- 0:00:34
459500 -- (-495.666) (-495.072) [-495.920] (-493.728) * [-496.561] (-496.547) (-495.636) (-495.711) -- 0:00:34
460000 -- (-505.180) [-500.791] (-497.310) (-495.540) * (-499.285) (-494.144) (-503.094) [-493.342] -- 0:00:34
Average standard deviation of split frequencies: 0.010169
460500 -- [-494.322] (-501.891) (-495.755) (-494.335) * (-495.111) (-494.629) (-496.465) [-493.904] -- 0:00:33
461000 -- (-494.714) [-495.649] (-493.779) (-500.642) * [-496.821] (-494.700) (-498.236) (-497.858) -- 0:00:33
461500 -- (-495.866) (-496.711) [-494.668] (-496.817) * (-496.255) (-494.042) [-494.284] (-495.479) -- 0:00:33
462000 -- (-496.093) (-498.326) (-493.707) [-493.743] * [-496.915] (-495.043) (-496.431) (-496.020) -- 0:00:33
462500 -- (-495.058) [-493.979] (-494.242) (-495.178) * (-494.069) [-494.543] (-497.569) (-494.307) -- 0:00:33
463000 -- (-495.543) (-494.804) [-493.392] (-494.968) * [-495.347] (-497.300) (-496.382) (-497.565) -- 0:00:33
463500 -- (-495.948) (-495.277) [-495.286] (-495.531) * (-502.037) (-496.703) (-495.306) [-495.612] -- 0:00:33
464000 -- (-493.501) [-495.986] (-496.416) (-495.437) * (-494.316) (-496.298) [-495.103] (-500.278) -- 0:00:33
464500 -- (-493.868) (-502.506) (-494.876) [-494.996] * (-494.625) (-495.642) (-498.276) [-498.543] -- 0:00:33
465000 -- [-493.668] (-499.685) (-495.486) (-500.558) * (-500.517) [-495.431] (-495.340) (-496.052) -- 0:00:33
Average standard deviation of split frequencies: 0.011380
465500 -- (-493.403) (-493.811) [-496.134] (-498.246) * (-496.406) (-495.048) (-493.152) [-494.161] -- 0:00:33
466000 -- (-497.008) (-493.739) [-495.683] (-494.736) * (-499.097) (-496.347) [-493.476] (-497.056) -- 0:00:33
466500 -- [-493.776] (-493.554) (-496.404) (-495.386) * (-499.151) [-494.407] (-494.226) (-495.119) -- 0:00:33
467000 -- (-494.213) (-495.189) [-495.021] (-494.541) * (-494.585) (-493.781) [-494.042] (-493.815) -- 0:00:34
467500 -- (-495.657) (-497.299) [-496.905] (-499.395) * (-495.389) [-496.546] (-493.772) (-495.155) -- 0:00:34
468000 -- (-498.251) (-494.181) [-494.015] (-499.510) * [-494.617] (-496.668) (-493.961) (-495.385) -- 0:00:34
468500 -- (-497.809) (-494.174) [-496.262] (-497.083) * [-493.171] (-494.375) (-495.972) (-497.604) -- 0:00:34
469000 -- (-502.259) (-495.253) (-494.452) [-495.620] * (-496.591) (-495.786) [-497.960] (-498.841) -- 0:00:33
469500 -- (-495.502) (-493.931) [-498.448] (-496.268) * (-496.360) (-495.003) [-497.191] (-494.338) -- 0:00:33
470000 -- (-494.005) [-493.467] (-493.313) (-497.624) * (-497.554) [-495.454] (-495.730) (-495.057) -- 0:00:33
Average standard deviation of split frequencies: 0.010955
470500 -- (-497.673) (-494.101) [-493.901] (-496.733) * (-497.162) [-495.172] (-496.121) (-495.970) -- 0:00:33
471000 -- (-494.083) (-494.518) (-494.257) [-496.747] * (-493.668) [-496.692] (-495.695) (-496.990) -- 0:00:33
471500 -- (-501.899) (-496.904) [-495.521] (-496.204) * (-494.785) (-495.896) (-501.455) [-497.035] -- 0:00:33
472000 -- (-498.629) (-500.729) (-494.683) [-494.521] * (-494.116) (-496.568) (-496.071) [-494.140] -- 0:00:33
472500 -- (-497.726) (-496.227) (-493.820) [-494.376] * [-496.654] (-495.538) (-495.570) (-496.255) -- 0:00:33
473000 -- (-496.013) [-495.790] (-493.869) (-495.022) * (-495.274) (-494.705) (-496.181) [-494.587] -- 0:00:33
473500 -- [-494.754] (-496.470) (-494.265) (-495.264) * (-494.232) (-495.947) [-496.139] (-497.503) -- 0:00:33
474000 -- [-496.889] (-497.702) (-494.311) (-494.561) * (-495.127) (-497.678) (-497.927) [-494.879] -- 0:00:33
474500 -- [-494.813] (-497.188) (-496.182) (-493.550) * (-494.801) (-495.740) [-498.412] (-495.895) -- 0:00:33
475000 -- (-500.592) (-493.383) [-493.934] (-496.113) * [-494.577] (-504.080) (-494.381) (-497.134) -- 0:00:33
Average standard deviation of split frequencies: 0.011637
475500 -- (-496.427) [-497.621] (-494.192) (-495.711) * (-495.107) (-496.466) (-495.579) [-494.499] -- 0:00:33
476000 -- (-496.799) (-498.078) [-494.204] (-494.192) * (-494.820) [-494.800] (-494.167) (-494.086) -- 0:00:33
476500 -- [-497.284] (-498.425) (-496.045) (-494.824) * (-496.028) (-494.816) [-496.576] (-494.349) -- 0:00:32
477000 -- (-495.382) [-494.831] (-496.029) (-495.554) * (-497.317) [-495.034] (-493.732) (-495.269) -- 0:00:32
477500 -- (-495.618) [-494.317] (-493.704) (-497.027) * (-500.934) (-496.355) [-493.299] (-496.174) -- 0:00:32
478000 -- (-495.766) (-495.815) [-494.882] (-495.729) * (-495.020) [-499.754] (-494.186) (-498.954) -- 0:00:32
478500 -- (-494.635) (-493.848) [-499.165] (-495.979) * [-495.110] (-498.420) (-494.529) (-495.827) -- 0:00:32
479000 -- (-495.970) [-493.513] (-496.295) (-497.339) * (-493.839) [-494.551] (-495.652) (-494.442) -- 0:00:32
479500 -- (-495.078) [-495.182] (-493.257) (-494.650) * (-498.070) (-496.649) [-495.511] (-494.106) -- 0:00:32
480000 -- [-499.090] (-494.851) (-497.474) (-497.179) * (-503.207) (-495.473) [-494.649] (-503.573) -- 0:00:32
Average standard deviation of split frequencies: 0.011095
480500 -- (-499.410) (-494.287) (-494.881) [-496.624] * [-498.126] (-499.529) (-499.768) (-505.925) -- 0:00:32
481000 -- (-495.443) [-493.551] (-495.990) (-500.353) * (-501.766) (-498.662) [-499.680] (-496.390) -- 0:00:32
481500 -- [-495.051] (-495.943) (-498.061) (-495.400) * (-498.096) (-495.942) [-497.365] (-494.638) -- 0:00:32
482000 -- [-499.087] (-495.595) (-499.279) (-498.239) * (-499.715) [-494.643] (-494.267) (-495.457) -- 0:00:32
482500 -- (-497.041) (-494.532) (-496.562) [-497.889] * (-499.640) (-494.272) (-494.868) [-494.433] -- 0:00:32
483000 -- (-499.738) (-494.505) (-493.936) [-496.350] * [-498.844] (-493.970) (-497.425) (-493.515) -- 0:00:33
483500 -- (-497.826) [-493.476] (-494.953) (-498.497) * [-493.781] (-494.686) (-494.362) (-494.216) -- 0:00:33
484000 -- (-495.897) (-495.071) (-493.986) [-496.163] * [-495.259] (-494.100) (-494.851) (-495.451) -- 0:00:33
484500 -- (-494.755) (-496.503) (-493.768) [-498.096] * (-496.075) [-494.604] (-494.506) (-497.807) -- 0:00:32
485000 -- (-493.778) (-495.882) [-498.562] (-496.271) * (-500.199) [-494.738] (-493.752) (-496.230) -- 0:00:32
Average standard deviation of split frequencies: 0.011276
485500 -- [-495.052] (-494.973) (-502.118) (-499.309) * (-498.756) [-497.273] (-494.522) (-497.180) -- 0:00:32
486000 -- (-494.378) [-494.998] (-494.631) (-496.103) * (-498.666) [-495.014] (-498.038) (-495.774) -- 0:00:32
486500 -- (-496.276) [-494.027] (-496.877) (-496.095) * (-495.668) [-493.739] (-493.911) (-494.617) -- 0:00:32
487000 -- (-495.319) [-494.136] (-495.025) (-501.371) * (-493.891) [-493.959] (-495.729) (-494.620) -- 0:00:32
487500 -- (-494.108) (-497.346) [-498.031] (-497.722) * (-495.374) [-495.318] (-496.450) (-495.044) -- 0:00:32
488000 -- [-496.458] (-495.881) (-496.688) (-496.608) * (-493.514) (-497.867) [-494.244] (-496.350) -- 0:00:32
488500 -- (-496.361) [-493.948] (-495.240) (-494.448) * (-498.893) (-496.744) (-496.683) [-493.899] -- 0:00:32
489000 -- (-495.350) [-495.303] (-495.155) (-497.424) * [-494.650] (-498.688) (-498.429) (-495.744) -- 0:00:32
489500 -- [-496.695] (-497.084) (-496.997) (-495.038) * [-498.433] (-495.677) (-496.028) (-494.400) -- 0:00:32
490000 -- (-494.145) (-495.304) (-503.687) [-494.405] * (-496.148) (-495.640) [-494.001] (-495.433) -- 0:00:32
Average standard deviation of split frequencies: 0.011889
490500 -- (-493.402) [-496.008] (-499.840) (-493.307) * (-495.142) (-494.411) (-496.419) [-494.392] -- 0:00:32
491000 -- (-496.268) [-495.059] (-503.332) (-493.949) * (-495.096) (-501.357) (-494.145) [-494.437] -- 0:00:32
491500 -- [-494.206] (-496.452) (-495.072) (-494.937) * [-495.211] (-494.034) (-493.943) (-493.764) -- 0:00:32
492000 -- (-494.873) (-495.184) (-499.164) [-496.283] * (-496.161) (-502.448) [-493.686] (-495.535) -- 0:00:32
492500 -- [-495.517] (-498.042) (-494.030) (-498.518) * (-495.032) (-495.824) (-497.892) [-496.220] -- 0:00:31
493000 -- [-495.546] (-495.924) (-494.306) (-501.372) * (-494.398) (-494.160) [-493.672] (-495.036) -- 0:00:31
493500 -- (-494.592) (-495.819) [-497.099] (-495.264) * (-495.897) [-494.528] (-494.289) (-500.534) -- 0:00:31
494000 -- [-496.765] (-495.590) (-497.309) (-495.191) * [-496.455] (-497.354) (-494.215) (-495.310) -- 0:00:31
494500 -- (-494.568) (-496.794) [-494.887] (-495.663) * (-494.888) [-497.169] (-494.075) (-495.433) -- 0:00:31
495000 -- (-493.463) [-493.853] (-496.185) (-497.091) * (-494.852) (-494.169) [-493.736] (-496.248) -- 0:00:31
Average standard deviation of split frequencies: 0.011880
495500 -- (-494.082) [-494.228] (-498.370) (-498.270) * (-495.625) [-493.565] (-495.539) (-496.349) -- 0:00:31
496000 -- (-496.319) (-496.922) (-497.653) [-496.495] * (-497.224) [-493.207] (-495.988) (-495.050) -- 0:00:31
496500 -- (-500.802) [-494.042] (-495.832) (-497.987) * (-496.577) (-494.342) (-493.757) [-495.892] -- 0:00:31
497000 -- (-494.559) [-493.745] (-496.248) (-499.055) * (-495.094) (-498.676) (-499.367) [-495.978] -- 0:00:31
497500 -- (-494.727) [-493.850] (-497.226) (-498.557) * (-494.185) (-500.601) [-493.779] (-494.584) -- 0:00:31
498000 -- (-494.203) (-493.682) [-493.534] (-495.626) * (-500.098) (-496.146) (-499.233) [-495.583] -- 0:00:31
498500 -- (-496.224) (-494.390) (-496.732) [-497.815] * [-497.288] (-495.924) (-495.697) (-495.182) -- 0:00:31
499000 -- (-495.941) [-494.966] (-497.569) (-496.981) * (-496.516) (-494.512) [-494.528] (-495.082) -- 0:00:31
499500 -- [-496.911] (-497.353) (-494.954) (-495.750) * [-495.375] (-494.761) (-494.380) (-494.451) -- 0:00:31
500000 -- (-496.007) (-496.854) [-494.638] (-503.336) * (-493.855) (-494.779) [-494.006] (-493.915) -- 0:00:32
Average standard deviation of split frequencies: 0.012593
500500 -- (-493.803) [-494.611] (-495.350) (-510.318) * (-498.270) [-493.942] (-496.156) (-496.558) -- 0:00:31
501000 -- (-494.460) (-498.168) [-493.896] (-507.033) * (-494.109) (-493.710) [-496.201] (-495.501) -- 0:00:31
501500 -- (-498.163) (-500.426) [-495.940] (-498.288) * (-495.048) [-493.641] (-495.464) (-494.763) -- 0:00:31
502000 -- [-493.567] (-495.736) (-494.180) (-498.374) * [-494.613] (-494.646) (-493.868) (-496.858) -- 0:00:31
502500 -- (-497.766) (-496.450) (-494.286) [-497.123] * (-496.067) (-496.239) [-495.101] (-494.794) -- 0:00:31
503000 -- [-495.425] (-495.510) (-496.024) (-496.924) * (-495.766) (-494.674) [-495.346] (-495.768) -- 0:00:31
503500 -- (-496.096) (-494.047) [-495.132] (-493.196) * (-493.882) (-494.618) (-493.617) [-496.958] -- 0:00:31
504000 -- [-498.666] (-493.704) (-495.642) (-494.769) * (-497.857) (-494.524) [-493.696] (-496.610) -- 0:00:31
504500 -- (-497.937) (-494.229) (-494.320) [-495.004] * (-494.107) [-495.749] (-496.778) (-496.609) -- 0:00:31
505000 -- (-494.383) (-493.773) (-496.590) [-496.283] * (-497.966) [-495.878] (-494.400) (-495.290) -- 0:00:31
Average standard deviation of split frequencies: 0.012330
505500 -- [-498.150] (-496.283) (-499.515) (-494.144) * (-501.474) (-496.042) [-495.310] (-495.422) -- 0:00:31
506000 -- (-501.464) [-494.224] (-495.769) (-494.723) * (-495.617) (-497.634) [-499.908] (-494.385) -- 0:00:31
506500 -- (-495.391) [-493.994] (-493.834) (-501.233) * [-494.486] (-498.033) (-494.978) (-496.296) -- 0:00:31
507000 -- (-500.037) [-498.676] (-495.525) (-499.394) * [-495.134] (-495.943) (-496.565) (-495.151) -- 0:00:31
507500 -- (-495.835) (-495.927) (-493.828) [-494.612] * (-497.279) [-494.124] (-496.592) (-498.011) -- 0:00:31
508000 -- [-495.122] (-494.445) (-493.145) (-495.489) * (-494.361) (-495.309) [-494.076] (-496.120) -- 0:00:30
508500 -- (-495.151) (-494.881) (-493.793) [-496.392] * (-493.894) [-497.783] (-495.774) (-500.070) -- 0:00:30
509000 -- (-495.751) (-496.570) [-494.768] (-503.766) * (-494.101) (-495.729) [-497.482] (-495.944) -- 0:00:30
509500 -- (-496.650) (-496.157) (-495.675) [-498.524] * (-496.799) [-498.900] (-496.868) (-494.391) -- 0:00:30
510000 -- (-494.246) (-496.706) [-495.059] (-494.630) * (-495.890) (-497.093) [-493.850] (-496.964) -- 0:00:30
Average standard deviation of split frequencies: 0.012635
510500 -- (-495.731) (-495.414) (-496.410) [-494.848] * (-498.752) (-496.133) (-496.843) [-495.165] -- 0:00:30
511000 -- (-497.094) (-501.514) (-498.523) [-494.388] * (-494.621) (-496.501) [-494.385] (-497.669) -- 0:00:30
511500 -- (-496.940) (-499.719) [-495.162] (-497.694) * (-493.895) (-495.303) (-494.283) [-493.560] -- 0:00:30
512000 -- (-495.474) (-496.801) (-501.321) [-495.115] * (-496.258) (-493.838) [-494.800] (-498.848) -- 0:00:30
512500 -- [-495.677] (-500.700) (-495.632) (-494.692) * (-494.838) (-494.173) (-498.671) [-500.906] -- 0:00:30
513000 -- (-493.884) (-501.214) (-496.772) [-494.255] * (-496.733) (-496.646) [-500.469] (-494.476) -- 0:00:30
513500 -- (-497.974) (-500.529) [-494.278] (-493.495) * (-493.901) [-499.706] (-495.498) (-494.100) -- 0:00:30
514000 -- (-494.480) (-494.646) [-494.500] (-494.725) * (-495.207) [-496.311] (-498.712) (-494.197) -- 0:00:30
514500 -- [-496.856] (-494.799) (-500.574) (-494.931) * (-494.602) (-497.062) [-493.639] (-496.565) -- 0:00:30
515000 -- (-495.753) (-494.248) [-496.176] (-497.796) * (-493.245) [-494.919] (-494.475) (-495.202) -- 0:00:30
Average standard deviation of split frequencies: 0.012676
515500 -- (-495.033) (-494.752) [-493.537] (-493.255) * [-494.923] (-496.477) (-493.947) (-494.649) -- 0:00:30
516000 -- (-494.042) (-495.467) [-494.664] (-493.283) * [-495.070] (-497.089) (-494.437) (-497.982) -- 0:00:30
516500 -- [-498.036] (-495.965) (-496.560) (-494.301) * (-495.294) (-498.256) [-495.188] (-493.782) -- 0:00:29
517000 -- (-497.590) (-499.284) (-494.894) [-494.140] * [-496.245] (-495.867) (-495.213) (-496.024) -- 0:00:30
517500 -- (-498.309) [-493.486] (-495.515) (-495.027) * [-495.287] (-494.374) (-494.753) (-500.834) -- 0:00:30
518000 -- (-501.666) (-494.018) (-496.611) [-494.224] * [-493.727] (-497.541) (-496.177) (-496.872) -- 0:00:30
518500 -- (-498.200) (-495.380) (-495.392) [-494.267] * (-496.352) [-498.401] (-495.399) (-497.089) -- 0:00:30
519000 -- (-500.852) [-494.600] (-495.490) (-495.681) * (-499.104) (-494.472) (-497.200) [-494.622] -- 0:00:30
519500 -- [-494.244] (-495.487) (-496.292) (-496.242) * (-497.935) [-494.229] (-494.230) (-495.807) -- 0:00:30
520000 -- (-494.830) [-495.895] (-496.049) (-495.265) * (-495.605) (-496.365) [-498.129] (-494.242) -- 0:00:30
Average standard deviation of split frequencies: 0.012392
520500 -- [-496.428] (-495.682) (-499.108) (-494.073) * (-495.590) [-495.488] (-493.638) (-497.282) -- 0:00:30
521000 -- [-496.210] (-497.199) (-496.406) (-497.304) * [-498.471] (-494.985) (-496.427) (-494.789) -- 0:00:30
521500 -- (-496.651) (-503.438) [-495.146] (-495.854) * (-498.147) (-496.048) (-494.987) [-498.713] -- 0:00:30
522000 -- (-496.691) (-496.572) (-495.395) [-496.916] * [-498.908] (-500.948) (-494.637) (-496.855) -- 0:00:30
522500 -- (-495.142) (-499.505) [-497.185] (-494.877) * [-493.503] (-493.892) (-494.993) (-493.579) -- 0:00:30
523000 -- (-495.678) (-500.262) [-494.860] (-493.521) * [-496.579] (-496.642) (-495.967) (-497.989) -- 0:00:30
523500 -- (-495.259) [-494.751] (-495.154) (-495.407) * (-495.336) (-497.952) (-494.316) [-501.810] -- 0:00:30
524000 -- (-494.772) (-495.980) [-494.374] (-499.413) * [-495.683] (-495.702) (-494.490) (-500.049) -- 0:00:29
524500 -- (-495.710) (-498.419) (-495.084) [-496.787] * [-494.876] (-493.923) (-494.518) (-493.543) -- 0:00:29
525000 -- [-495.577] (-496.068) (-496.055) (-494.966) * (-493.937) [-498.215] (-496.219) (-494.681) -- 0:00:29
Average standard deviation of split frequencies: 0.012827
525500 -- (-493.792) (-495.949) [-495.146] (-494.130) * [-494.028] (-498.713) (-497.621) (-496.017) -- 0:00:29
526000 -- (-495.877) (-494.594) [-497.709] (-496.439) * [-495.814] (-494.596) (-494.623) (-494.090) -- 0:00:29
526500 -- [-493.283] (-495.427) (-494.448) (-495.170) * (-495.910) [-495.117] (-496.892) (-496.896) -- 0:00:29
527000 -- [-493.820] (-493.368) (-494.936) (-496.354) * [-495.029] (-495.892) (-496.057) (-496.613) -- 0:00:29
527500 -- [-494.422] (-495.494) (-500.872) (-494.666) * (-496.142) [-495.204] (-493.991) (-495.633) -- 0:00:29
528000 -- (-495.869) (-496.057) (-497.375) [-494.329] * (-497.060) (-497.561) [-496.274] (-493.488) -- 0:00:29
528500 -- (-498.153) [-493.820] (-497.226) (-496.144) * (-495.385) (-493.378) [-496.250] (-495.716) -- 0:00:29
529000 -- (-494.046) [-498.933] (-497.753) (-495.401) * [-495.142] (-494.077) (-498.151) (-494.096) -- 0:00:29
529500 -- (-502.061) (-494.156) (-498.847) [-493.893] * (-495.921) (-493.815) (-493.561) [-493.125] -- 0:00:29
530000 -- (-495.756) (-495.883) [-495.643] (-496.238) * (-496.452) (-496.959) (-497.018) [-493.949] -- 0:00:29
Average standard deviation of split frequencies: 0.012200
530500 -- (-495.843) [-494.148] (-494.217) (-496.661) * (-495.247) (-498.936) [-495.453] (-494.140) -- 0:00:29
531000 -- (-501.807) [-494.145] (-493.558) (-494.807) * (-496.512) (-496.794) (-493.787) [-493.769] -- 0:00:29
531500 -- (-494.717) (-493.895) (-493.916) [-497.007] * (-495.841) (-500.754) [-493.661] (-497.409) -- 0:00:29
532000 -- (-494.248) (-493.650) (-493.949) [-496.511] * (-494.997) (-503.982) [-494.274] (-495.028) -- 0:00:29
532500 -- [-496.080] (-495.454) (-500.089) (-498.475) * (-497.006) [-495.069] (-495.600) (-494.980) -- 0:00:28
533000 -- (-497.600) [-498.314] (-495.649) (-494.250) * (-495.809) (-493.834) [-496.036] (-497.029) -- 0:00:28
533500 -- (-494.556) (-497.897) (-493.955) [-493.723] * (-494.056) [-495.330] (-495.307) (-499.420) -- 0:00:28
534000 -- (-493.746) (-497.853) [-494.287] (-498.313) * (-495.624) [-494.326] (-493.541) (-496.373) -- 0:00:28
534500 -- [-494.439] (-498.943) (-494.131) (-496.372) * (-495.601) [-495.538] (-493.939) (-496.232) -- 0:00:29
535000 -- (-494.480) (-498.102) [-494.140] (-494.955) * [-494.609] (-497.885) (-493.941) (-496.928) -- 0:00:29
Average standard deviation of split frequencies: 0.012643
535500 -- (-494.039) (-494.641) (-500.021) [-496.079] * (-498.597) (-496.712) (-495.032) [-495.774] -- 0:00:29
536000 -- [-497.185] (-497.443) (-497.805) (-497.122) * (-498.134) (-497.222) [-493.406] (-494.930) -- 0:00:29
536500 -- (-494.163) [-494.802] (-496.206) (-496.686) * [-494.894] (-497.194) (-498.230) (-493.337) -- 0:00:29
537000 -- [-495.327] (-495.039) (-497.382) (-496.797) * (-494.007) [-494.962] (-495.019) (-496.183) -- 0:00:29
537500 -- (-493.391) [-494.910] (-497.349) (-496.319) * (-496.092) (-494.817) [-494.282] (-498.119) -- 0:00:29
538000 -- (-495.338) [-497.511] (-496.496) (-497.678) * (-493.675) (-500.420) [-495.234] (-494.872) -- 0:00:29
538500 -- [-498.314] (-495.554) (-497.173) (-499.486) * [-494.109] (-495.962) (-498.295) (-494.208) -- 0:00:29
539000 -- (-495.155) [-496.547] (-496.882) (-496.370) * (-494.047) [-494.916] (-497.079) (-493.697) -- 0:00:29
539500 -- (-494.057) [-495.159] (-497.247) (-496.288) * (-496.623) (-497.360) [-496.672] (-493.734) -- 0:00:29
540000 -- [-495.713] (-494.507) (-503.220) (-499.703) * (-497.096) (-494.760) [-496.376] (-494.208) -- 0:00:28
Average standard deviation of split frequencies: 0.012323
540500 -- (-493.687) (-497.036) (-497.645) [-495.264] * [-494.826] (-498.526) (-496.686) (-494.889) -- 0:00:28
541000 -- (-493.821) (-494.466) (-500.023) [-496.970] * (-496.695) [-496.867] (-496.071) (-495.090) -- 0:00:28
541500 -- (-493.890) (-496.514) [-496.224] (-495.840) * (-496.043) (-494.909) [-497.106] (-494.787) -- 0:00:28
542000 -- (-493.514) (-498.849) (-495.638) [-495.802] * (-496.432) (-496.678) (-497.106) [-494.324] -- 0:00:28
542500 -- [-493.917] (-496.660) (-496.816) (-495.383) * [-495.452] (-495.819) (-495.483) (-495.623) -- 0:00:28
543000 -- (-495.344) (-494.601) (-496.158) [-496.396] * (-495.837) (-496.102) [-494.212] (-496.043) -- 0:00:28
543500 -- (-494.330) (-494.565) (-498.190) [-499.287] * (-495.445) [-494.407] (-496.317) (-500.312) -- 0:00:28
544000 -- (-497.975) (-494.452) (-496.436) [-494.652] * (-494.359) (-494.256) [-496.476] (-496.703) -- 0:00:28
544500 -- (-494.228) (-496.881) [-494.777] (-496.169) * (-495.086) (-495.384) [-494.090] (-495.778) -- 0:00:28
545000 -- [-494.431] (-498.296) (-495.548) (-494.551) * (-496.667) (-496.354) [-494.490] (-496.136) -- 0:00:28
Average standard deviation of split frequencies: 0.012573
545500 -- (-496.104) (-498.394) [-497.177] (-494.401) * (-496.976) [-494.111] (-495.521) (-497.868) -- 0:00:28
546000 -- (-494.690) (-500.622) (-495.922) [-499.367] * (-497.699) [-496.025] (-493.989) (-495.212) -- 0:00:28
546500 -- [-495.675] (-495.950) (-496.143) (-497.036) * (-497.498) (-495.360) [-499.687] (-494.850) -- 0:00:28
547000 -- (-496.381) [-498.845] (-495.458) (-498.638) * (-495.525) (-497.438) (-496.164) [-493.331] -- 0:00:28
547500 -- [-494.905] (-494.171) (-496.460) (-497.582) * [-494.989] (-498.028) (-494.232) (-494.615) -- 0:00:28
548000 -- [-494.732] (-501.774) (-497.180) (-498.431) * (-494.725) (-497.373) (-495.964) [-498.092] -- 0:00:28
548500 -- (-496.474) (-498.647) (-497.448) [-493.923] * (-494.076) (-494.830) [-494.384] (-496.593) -- 0:00:27
549000 -- (-494.789) [-495.522] (-497.158) (-494.718) * (-495.592) (-495.546) (-494.982) [-495.206] -- 0:00:27
549500 -- (-497.386) [-497.691] (-497.966) (-493.515) * (-497.577) [-493.702] (-496.919) (-495.244) -- 0:00:27
550000 -- (-498.469) (-494.856) (-497.204) [-496.499] * (-499.222) [-493.869] (-496.051) (-496.245) -- 0:00:27
Average standard deviation of split frequencies: 0.011871
550500 -- (-495.685) (-496.345) (-494.398) [-494.160] * [-497.105] (-495.294) (-495.442) (-496.706) -- 0:00:27
551000 -- (-496.178) (-495.482) [-494.969] (-497.857) * [-494.286] (-494.012) (-496.655) (-496.722) -- 0:00:27
551500 -- [-495.562] (-495.603) (-496.050) (-494.996) * (-493.857) [-495.155] (-497.085) (-494.336) -- 0:00:28
552000 -- (-498.444) (-496.318) (-499.165) [-496.327] * (-496.878) [-494.999] (-498.059) (-497.049) -- 0:00:28
552500 -- (-495.560) (-495.127) (-497.335) [-496.470] * (-495.365) (-495.923) (-497.466) [-495.737] -- 0:00:28
553000 -- [-493.598] (-495.203) (-495.478) (-496.701) * (-500.128) (-497.159) [-496.384] (-498.221) -- 0:00:28
553500 -- [-494.209] (-496.071) (-495.742) (-494.974) * (-500.674) [-497.165] (-498.809) (-495.079) -- 0:00:28
554000 -- (-497.226) [-494.555] (-494.853) (-494.859) * (-495.690) (-493.930) [-495.746] (-493.579) -- 0:00:28
554500 -- (-495.629) [-497.028] (-493.905) (-498.987) * (-495.553) [-494.594] (-495.291) (-495.575) -- 0:00:28
555000 -- (-496.235) (-499.076) (-494.630) [-497.530] * (-495.903) (-494.111) (-495.549) [-493.993] -- 0:00:28
Average standard deviation of split frequencies: 0.012241
555500 -- (-496.035) (-498.140) [-495.142] (-503.037) * [-497.598] (-497.712) (-497.026) (-493.475) -- 0:00:28
556000 -- (-495.023) [-493.921] (-495.378) (-496.414) * [-494.139] (-493.412) (-495.305) (-499.368) -- 0:00:27
556500 -- (-493.659) [-494.753] (-494.613) (-494.925) * (-493.908) (-494.967) (-497.810) [-494.807] -- 0:00:27
557000 -- (-494.456) (-498.843) (-496.356) [-495.299] * (-495.771) (-495.882) (-494.214) [-497.462] -- 0:00:27
557500 -- (-495.073) (-500.407) [-497.631] (-499.089) * (-498.161) (-496.761) [-493.543] (-496.869) -- 0:00:27
558000 -- (-493.566) (-495.736) (-494.922) [-495.619] * (-494.100) (-498.263) [-497.192] (-494.285) -- 0:00:27
558500 -- (-495.050) (-493.827) [-496.546] (-495.853) * [-494.586] (-495.451) (-497.414) (-499.783) -- 0:00:27
559000 -- (-498.441) (-494.548) (-494.957) [-497.415] * (-494.783) (-495.466) [-493.883] (-494.525) -- 0:00:27
559500 -- [-496.395] (-494.632) (-495.496) (-498.024) * [-495.622] (-495.914) (-496.089) (-494.408) -- 0:00:27
560000 -- [-495.715] (-499.984) (-500.556) (-497.279) * (-495.029) (-494.821) [-495.233] (-494.264) -- 0:00:27
Average standard deviation of split frequencies: 0.011267
560500 -- (-498.170) [-495.303] (-493.680) (-494.648) * (-496.671) [-494.313] (-499.160) (-496.230) -- 0:00:27
561000 -- (-495.453) (-495.117) (-495.517) [-495.395] * [-495.798] (-496.089) (-493.368) (-499.257) -- 0:00:27
561500 -- (-496.748) (-497.613) [-497.659] (-498.974) * [-494.350] (-495.623) (-497.258) (-498.412) -- 0:00:27
562000 -- (-495.525) (-496.574) (-493.533) [-493.787] * (-494.426) (-494.975) (-497.675) [-495.605] -- 0:00:27
562500 -- (-496.901) (-498.383) [-494.303] (-494.971) * (-495.430) [-494.982] (-495.723) (-495.818) -- 0:00:27
563000 -- (-498.257) [-495.463] (-496.997) (-496.632) * (-498.706) [-494.777] (-495.908) (-499.087) -- 0:00:27
563500 -- (-494.317) [-496.949] (-495.955) (-495.412) * [-496.001] (-501.161) (-498.474) (-494.810) -- 0:00:27
564000 -- [-494.388] (-498.095) (-495.127) (-494.401) * (-494.779) (-494.512) [-497.127] (-495.452) -- 0:00:27
564500 -- [-495.717] (-493.405) (-498.560) (-494.408) * (-498.192) [-494.357] (-494.345) (-496.397) -- 0:00:27
565000 -- [-495.313] (-493.396) (-497.614) (-494.639) * (-496.736) (-496.112) [-494.870] (-495.332) -- 0:00:26
Average standard deviation of split frequencies: 0.010661
565500 -- (-494.922) (-495.772) (-494.889) [-495.386] * [-494.075] (-494.052) (-494.674) (-496.491) -- 0:00:26
566000 -- (-496.451) (-496.212) [-499.933] (-493.813) * (-496.906) (-494.585) (-495.545) [-496.743] -- 0:00:26
566500 -- (-496.612) (-494.433) [-493.549] (-496.733) * (-495.714) (-501.225) (-497.916) [-494.877] -- 0:00:26
567000 -- [-494.263] (-495.518) (-494.750) (-495.616) * (-495.156) (-499.244) [-495.263] (-495.696) -- 0:00:26
567500 -- [-495.438] (-494.174) (-496.731) (-495.042) * (-495.333) (-494.209) (-494.182) [-495.222] -- 0:00:26
568000 -- [-496.086] (-497.549) (-495.363) (-495.514) * [-493.978] (-501.865) (-496.985) (-496.377) -- 0:00:26
568500 -- (-499.821) (-497.555) (-499.106) [-495.210] * [-494.605] (-497.832) (-498.323) (-495.964) -- 0:00:27
569000 -- (-495.606) (-497.069) (-495.665) [-497.085] * (-494.391) (-495.758) (-494.275) [-494.688] -- 0:00:27
569500 -- (-494.158) [-495.170] (-495.512) (-496.393) * (-496.380) [-495.719] (-495.419) (-494.268) -- 0:00:27
570000 -- (-494.969) [-495.113] (-495.962) (-494.107) * (-497.561) (-494.086) [-498.069] (-497.814) -- 0:00:27
Average standard deviation of split frequencies: 0.010518
570500 -- (-498.922) [-495.103] (-495.118) (-493.989) * (-495.171) [-493.319] (-502.547) (-497.110) -- 0:00:27
571000 -- (-495.980) (-497.815) [-495.989] (-494.109) * (-495.629) (-493.438) (-497.633) [-497.595] -- 0:00:27
571500 -- [-494.147] (-500.435) (-498.519) (-494.583) * [-493.180] (-495.116) (-496.695) (-494.702) -- 0:00:26
572000 -- (-495.086) (-499.466) (-494.777) [-494.864] * [-493.983] (-495.977) (-498.015) (-495.070) -- 0:00:26
572500 -- (-496.876) (-498.929) [-493.530] (-493.733) * (-496.696) (-493.925) [-493.915] (-495.947) -- 0:00:26
573000 -- (-497.301) (-494.117) (-495.587) [-493.889] * (-496.430) [-494.809] (-496.156) (-494.987) -- 0:00:26
573500 -- (-495.345) [-494.412] (-493.845) (-499.929) * (-496.958) (-495.222) (-494.751) [-494.583] -- 0:00:26
574000 -- (-495.786) (-496.602) [-501.384] (-494.638) * (-495.392) (-499.007) [-493.520] (-495.637) -- 0:00:26
574500 -- (-497.816) (-496.358) (-496.731) [-498.748] * [-495.518] (-497.608) (-498.258) (-497.826) -- 0:00:26
575000 -- (-503.729) [-493.955] (-497.358) (-495.331) * [-496.140] (-496.505) (-495.763) (-496.616) -- 0:00:26
Average standard deviation of split frequencies: 0.009930
575500 -- (-495.988) [-496.504] (-494.944) (-497.721) * (-495.858) (-494.235) (-494.287) [-494.034] -- 0:00:26
576000 -- (-495.693) (-496.532) [-495.512] (-496.103) * (-495.960) (-497.065) (-496.220) [-495.339] -- 0:00:26
576500 -- (-501.888) [-494.625] (-494.469) (-494.935) * [-494.665] (-498.453) (-494.601) (-496.575) -- 0:00:26
577000 -- (-496.285) [-494.073] (-495.330) (-496.024) * (-496.196) (-494.442) [-495.160] (-497.761) -- 0:00:26
577500 -- (-495.666) (-494.725) [-494.321] (-496.111) * (-500.023) [-494.166] (-495.052) (-495.078) -- 0:00:26
578000 -- [-494.548] (-495.756) (-496.718) (-496.757) * (-493.786) [-494.274] (-497.418) (-493.793) -- 0:00:26
578500 -- [-493.740] (-494.717) (-496.707) (-496.372) * (-500.435) (-497.350) [-496.989] (-494.939) -- 0:00:26
579000 -- (-495.407) (-502.073) (-496.330) [-495.278] * (-495.622) (-494.610) (-501.307) [-495.931] -- 0:00:26
579500 -- (-495.291) [-496.371] (-494.952) (-495.718) * (-495.884) (-494.777) [-494.166] (-495.481) -- 0:00:26
580000 -- [-496.902] (-502.519) (-494.556) (-495.769) * (-495.047) [-494.793] (-496.267) (-494.394) -- 0:00:26
Average standard deviation of split frequencies: 0.009526
580500 -- [-499.643] (-494.565) (-496.846) (-496.220) * (-495.540) [-495.482] (-497.009) (-497.018) -- 0:00:26
581000 -- (-495.929) [-495.459] (-496.809) (-494.116) * [-500.558] (-496.193) (-500.411) (-498.444) -- 0:00:25
581500 -- (-497.517) (-494.796) [-498.322] (-493.402) * (-497.586) (-495.046) (-496.883) [-495.831] -- 0:00:25
582000 -- [-496.111] (-494.641) (-495.120) (-498.927) * (-494.583) (-494.659) (-495.696) [-495.580] -- 0:00:25
582500 -- (-497.583) (-496.049) [-493.948] (-495.976) * [-495.064] (-498.450) (-500.274) (-496.232) -- 0:00:25
583000 -- (-499.462) [-497.901] (-494.347) (-500.247) * (-496.239) [-497.016] (-496.851) (-494.111) -- 0:00:25
583500 -- (-502.209) (-498.218) [-493.745] (-500.124) * (-498.946) (-498.738) [-494.149] (-493.938) -- 0:00:25
584000 -- [-494.243] (-494.735) (-499.494) (-493.807) * (-501.045) (-495.486) [-494.381] (-495.722) -- 0:00:25
584500 -- [-493.733] (-494.630) (-502.032) (-497.114) * [-494.240] (-497.390) (-497.376) (-497.758) -- 0:00:25
585000 -- (-496.022) (-496.340) [-496.833] (-494.263) * (-494.076) (-497.667) [-493.198] (-500.439) -- 0:00:25
Average standard deviation of split frequencies: 0.009854
585500 -- (-495.612) (-494.033) [-494.761] (-494.477) * (-496.190) (-496.635) (-493.751) [-495.485] -- 0:00:26
586000 -- (-498.486) (-493.973) (-493.693) [-495.668] * (-497.921) (-495.953) (-496.552) [-495.775] -- 0:00:26
586500 -- [-495.438] (-496.383) (-493.162) (-496.187) * [-494.266] (-494.043) (-495.877) (-499.516) -- 0:00:26
587000 -- (-497.097) (-496.355) [-498.663] (-495.074) * (-495.352) [-494.877] (-498.114) (-495.035) -- 0:00:26
587500 -- (-496.061) (-494.658) (-500.104) [-495.410] * (-496.092) [-497.322] (-493.954) (-495.322) -- 0:00:25
588000 -- [-495.143] (-496.029) (-495.955) (-494.580) * [-498.041] (-494.014) (-497.214) (-495.441) -- 0:00:25
588500 -- [-493.873] (-494.641) (-496.562) (-495.460) * (-500.428) (-494.010) (-495.148) [-493.568] -- 0:00:25
589000 -- (-495.993) (-493.687) (-494.939) [-494.850] * (-497.591) (-494.181) [-494.552] (-496.226) -- 0:00:25
589500 -- (-494.738) [-494.085] (-493.966) (-495.501) * (-496.557) [-494.695] (-495.730) (-495.688) -- 0:00:25
590000 -- (-494.841) (-495.996) (-494.882) [-493.887] * (-494.859) (-494.760) [-495.544] (-496.206) -- 0:00:25
Average standard deviation of split frequencies: 0.009524
590500 -- (-495.780) (-495.204) [-497.137] (-498.574) * (-499.955) [-493.524] (-497.732) (-494.358) -- 0:00:25
591000 -- [-496.341] (-496.697) (-496.944) (-497.093) * [-494.715] (-495.938) (-494.261) (-496.389) -- 0:00:25
591500 -- [-497.194] (-497.114) (-498.555) (-494.603) * (-493.726) (-494.531) [-493.762] (-493.523) -- 0:00:25
592000 -- [-494.551] (-495.845) (-496.295) (-494.131) * (-493.892) [-496.036] (-494.721) (-497.053) -- 0:00:25
592500 -- [-496.213] (-495.623) (-498.339) (-493.730) * (-495.569) (-494.063) [-499.073] (-496.241) -- 0:00:25
593000 -- (-494.808) [-499.367] (-494.295) (-496.499) * [-496.157] (-497.808) (-503.579) (-498.393) -- 0:00:25
593500 -- [-495.310] (-494.295) (-495.328) (-496.189) * [-497.914] (-499.412) (-495.702) (-496.775) -- 0:00:25
594000 -- (-494.903) (-497.027) (-496.698) [-498.945] * (-505.407) (-494.576) (-494.022) [-494.939] -- 0:00:25
594500 -- (-495.573) (-496.596) [-495.213] (-495.882) * (-494.205) (-494.677) [-496.064] (-494.815) -- 0:00:25
595000 -- (-494.822) (-493.582) [-495.087] (-494.748) * [-496.021] (-494.421) (-495.696) (-496.945) -- 0:00:25
Average standard deviation of split frequencies: 0.009590
595500 -- (-499.653) [-495.984] (-494.610) (-496.966) * (-496.755) (-496.320) [-496.394] (-500.160) -- 0:00:25
596000 -- [-496.303] (-502.510) (-497.886) (-493.968) * (-495.872) (-496.820) (-494.477) [-495.165] -- 0:00:25
596500 -- [-498.528] (-498.418) (-493.737) (-493.477) * (-495.036) (-494.723) [-498.992] (-493.671) -- 0:00:25
597000 -- (-498.320) (-498.730) [-493.812] (-494.419) * (-496.317) (-499.200) (-495.895) [-495.768] -- 0:00:24
597500 -- [-497.128] (-498.102) (-496.028) (-495.635) * (-496.861) [-497.084] (-497.160) (-494.827) -- 0:00:24
598000 -- (-495.496) (-494.285) (-493.494) [-494.581] * [-494.598] (-494.779) (-496.235) (-494.748) -- 0:00:24
598500 -- (-496.047) (-493.809) [-493.937] (-494.859) * (-494.689) (-496.893) (-495.785) [-494.553] -- 0:00:24
599000 -- (-496.520) [-494.015] (-495.443) (-497.554) * [-494.430] (-496.530) (-495.460) (-494.605) -- 0:00:24
599500 -- [-496.740] (-498.086) (-494.851) (-494.637) * (-495.107) (-497.269) [-503.503] (-496.637) -- 0:00:24
600000 -- (-494.512) [-495.157] (-495.531) (-495.685) * (-496.691) (-494.766) (-501.473) [-498.653] -- 0:00:24
Average standard deviation of split frequencies: 0.009418
600500 -- (-493.283) (-496.693) [-495.925] (-493.732) * (-498.346) [-494.213] (-498.054) (-495.066) -- 0:00:24
601000 -- (-494.486) (-494.953) [-496.539] (-495.706) * (-498.524) (-494.147) [-496.402] (-494.131) -- 0:00:24
601500 -- (-497.010) (-495.630) [-494.596] (-495.224) * (-494.051) [-493.961] (-496.120) (-494.901) -- 0:00:24
602000 -- (-498.671) (-496.825) (-497.657) [-494.467] * (-493.961) (-495.201) (-495.159) [-494.675] -- 0:00:25
602500 -- (-496.313) [-495.950] (-495.537) (-495.885) * (-493.714) (-495.318) [-493.778] (-495.461) -- 0:00:25
603000 -- (-494.541) (-494.521) [-496.122] (-496.839) * (-494.777) [-498.253] (-493.728) (-495.244) -- 0:00:25
603500 -- (-493.830) (-494.900) (-495.084) [-496.245] * (-496.450) (-496.434) (-495.026) [-494.644] -- 0:00:24
604000 -- [-496.365] (-495.198) (-493.906) (-495.817) * (-495.720) (-494.397) (-494.755) [-494.271] -- 0:00:24
604500 -- (-496.263) (-493.389) [-494.452] (-495.410) * (-495.099) [-494.830] (-493.981) (-494.206) -- 0:00:24
605000 -- (-496.188) (-496.646) (-495.399) [-493.402] * [-494.007] (-499.304) (-495.099) (-500.828) -- 0:00:24
Average standard deviation of split frequencies: 0.009043
605500 -- [-496.069] (-496.620) (-495.460) (-493.250) * (-493.708) (-496.791) [-496.446] (-500.843) -- 0:00:24
606000 -- [-495.805] (-494.854) (-494.863) (-494.031) * [-494.472] (-494.049) (-493.758) (-498.110) -- 0:00:24
606500 -- (-498.550) [-497.995] (-493.805) (-495.575) * [-493.615] (-495.598) (-499.407) (-506.217) -- 0:00:24
607000 -- (-495.873) (-495.902) [-495.498] (-495.202) * (-496.989) [-495.597] (-496.336) (-501.878) -- 0:00:24
607500 -- (-495.914) (-498.525) (-499.063) [-496.327] * (-494.839) [-498.572] (-493.761) (-497.318) -- 0:00:24
608000 -- [-494.761] (-493.510) (-493.698) (-495.608) * (-494.442) (-495.076) [-495.094] (-495.555) -- 0:00:24
608500 -- (-494.288) [-496.700] (-497.854) (-495.434) * [-498.304] (-495.993) (-496.912) (-494.764) -- 0:00:24
609000 -- (-503.374) (-495.359) (-495.471) [-493.885] * (-496.752) (-498.087) [-502.905] (-494.895) -- 0:00:24
609500 -- (-495.963) [-499.024] (-496.353) (-493.911) * [-495.137] (-494.824) (-497.261) (-500.250) -- 0:00:24
610000 -- (-494.800) [-494.899] (-495.673) (-495.521) * (-498.062) (-493.324) (-494.909) [-494.579] -- 0:00:24
Average standard deviation of split frequencies: 0.009456
610500 -- (-494.933) (-494.568) (-495.511) [-496.812] * (-496.213) (-495.416) (-496.167) [-496.315] -- 0:00:24
611000 -- [-493.895] (-493.895) (-494.840) (-497.020) * (-495.691) [-493.937] (-497.726) (-493.393) -- 0:00:24
611500 -- (-493.277) [-494.497] (-494.196) (-496.716) * (-493.908) (-499.359) [-496.505] (-497.201) -- 0:00:24
612000 -- [-493.610] (-494.290) (-495.168) (-493.505) * (-494.067) (-494.833) [-494.923] (-495.768) -- 0:00:24
612500 -- (-495.762) (-493.812) [-496.619] (-496.990) * [-494.559] (-495.177) (-496.267) (-494.756) -- 0:00:24
613000 -- (-496.526) [-494.614] (-496.258) (-495.465) * (-496.802) [-493.923] (-494.490) (-499.456) -- 0:00:23
613500 -- (-499.005) (-493.689) (-494.087) [-496.800] * (-495.393) (-494.958) (-495.003) [-493.301] -- 0:00:23
614000 -- (-494.702) (-494.358) (-494.535) [-496.993] * (-495.944) [-494.582] (-499.590) (-495.035) -- 0:00:23
614500 -- (-494.515) (-494.114) [-497.066] (-493.703) * (-496.569) [-497.161] (-495.571) (-493.098) -- 0:00:23
615000 -- (-501.273) [-494.612] (-494.362) (-493.788) * (-497.965) [-495.522] (-495.961) (-495.015) -- 0:00:23
Average standard deviation of split frequencies: 0.009183
615500 -- (-494.092) (-497.938) (-493.826) [-496.599] * (-496.291) (-494.487) (-495.169) [-496.130] -- 0:00:23
616000 -- [-494.329] (-495.944) (-494.709) (-498.140) * (-495.243) (-494.080) (-494.357) [-496.476] -- 0:00:23
616500 -- (-493.956) [-496.343] (-495.301) (-495.956) * (-498.610) (-495.688) [-494.450] (-495.366) -- 0:00:23
617000 -- (-495.003) [-495.345] (-493.933) (-500.982) * (-495.553) (-498.787) (-493.926) [-494.064] -- 0:00:23
617500 -- (-495.913) (-497.344) [-495.237] (-495.729) * [-499.313] (-498.770) (-495.042) (-494.759) -- 0:00:23
618000 -- (-496.076) [-493.929] (-495.285) (-494.806) * (-494.644) [-496.582] (-494.402) (-495.183) -- 0:00:23
618500 -- (-495.741) (-493.852) (-499.609) [-498.300] * [-497.203] (-495.144) (-494.667) (-493.719) -- 0:00:23
619000 -- (-498.590) (-495.291) (-495.815) [-494.199] * (-495.130) [-493.873] (-498.045) (-494.524) -- 0:00:23
619500 -- (-496.038) (-496.559) (-495.671) [-494.681] * (-494.983) (-494.913) [-493.984] (-495.181) -- 0:00:23
620000 -- [-493.593] (-494.960) (-495.618) (-494.299) * [-496.032] (-493.575) (-495.447) (-502.911) -- 0:00:23
Average standard deviation of split frequencies: 0.009779
620500 -- (-495.101) (-499.135) [-494.026] (-497.068) * (-496.387) (-497.291) (-494.818) [-493.492] -- 0:00:23
621000 -- (-496.721) [-500.891] (-505.347) (-494.888) * (-496.436) [-496.874] (-493.760) (-493.317) -- 0:00:23
621500 -- [-498.302] (-497.641) (-500.792) (-500.062) * (-494.554) (-493.783) (-494.266) [-495.055] -- 0:00:23
622000 -- (-496.641) [-493.307] (-496.043) (-499.609) * (-498.742) (-494.993) [-494.469] (-495.140) -- 0:00:23
622500 -- [-499.652] (-493.327) (-494.821) (-493.464) * (-495.273) (-498.196) [-499.521] (-493.743) -- 0:00:23
623000 -- (-500.996) (-497.229) [-495.509] (-494.907) * (-494.518) (-496.426) (-495.455) [-496.095] -- 0:00:23
623500 -- (-496.647) (-494.922) (-495.892) [-494.570] * (-495.204) [-494.456] (-500.290) (-497.692) -- 0:00:23
624000 -- (-496.390) (-499.012) [-495.045] (-499.946) * [-497.111] (-494.237) (-495.311) (-497.086) -- 0:00:23
624500 -- [-494.013] (-496.170) (-494.861) (-495.090) * (-494.502) (-495.439) (-498.132) [-495.139] -- 0:00:23
625000 -- (-496.670) (-495.843) (-499.041) [-494.921] * (-493.945) (-497.120) (-500.394) [-496.262] -- 0:00:23
Average standard deviation of split frequencies: 0.009695
625500 -- (-495.186) (-495.428) (-495.079) [-493.941] * [-494.383] (-495.941) (-496.797) (-497.481) -- 0:00:23
626000 -- (-496.337) (-495.215) [-494.146] (-495.432) * [-493.377] (-497.374) (-494.436) (-503.209) -- 0:00:23
626500 -- (-494.786) [-494.848] (-493.986) (-499.787) * (-493.504) (-495.623) (-502.074) [-496.653] -- 0:00:23
627000 -- (-497.178) [-493.511] (-496.032) (-501.254) * [-494.022] (-497.252) (-497.349) (-497.652) -- 0:00:23
627500 -- [-498.317] (-494.882) (-503.322) (-494.184) * [-493.859] (-497.470) (-494.686) (-495.237) -- 0:00:23
628000 -- (-497.986) (-494.344) (-495.518) [-494.866] * (-495.901) (-497.860) (-494.633) [-494.564] -- 0:00:23
628500 -- (-496.968) [-496.496] (-495.756) (-494.860) * (-495.090) (-496.002) [-494.351] (-496.700) -- 0:00:23
629000 -- (-494.892) [-494.827] (-493.961) (-496.467) * (-497.916) (-496.704) (-496.541) [-497.280] -- 0:00:23
629500 -- (-495.643) (-495.621) [-494.283] (-494.118) * (-498.154) (-495.513) [-495.361] (-496.280) -- 0:00:22
630000 -- (-498.239) (-494.708) [-494.469] (-496.324) * [-494.160] (-493.753) (-501.809) (-496.853) -- 0:00:22
Average standard deviation of split frequencies: 0.009811
630500 -- (-499.007) (-496.172) [-493.340] (-496.192) * (-493.571) (-497.026) [-494.407] (-495.234) -- 0:00:22
631000 -- (-495.725) (-493.988) [-494.255] (-501.823) * (-494.149) (-496.672) (-496.809) [-496.641] -- 0:00:22
631500 -- (-497.183) (-494.263) (-493.437) [-493.734] * (-493.628) (-495.167) (-494.741) [-494.456] -- 0:00:22
632000 -- (-496.184) (-493.644) [-493.488] (-497.277) * (-495.671) (-496.927) [-494.875] (-494.635) -- 0:00:22
632500 -- (-493.523) [-494.249] (-495.761) (-495.085) * [-495.899] (-494.297) (-494.315) (-494.330) -- 0:00:22
633000 -- (-496.010) (-495.985) [-494.604] (-496.989) * (-494.055) [-493.526] (-493.798) (-494.370) -- 0:00:22
633500 -- (-498.206) (-496.878) (-495.463) [-497.909] * [-493.610] (-496.303) (-494.824) (-496.263) -- 0:00:22
634000 -- (-493.774) [-498.908] (-496.712) (-497.962) * (-493.831) (-497.584) (-494.753) [-495.608] -- 0:00:22
634500 -- (-494.922) (-496.330) (-495.503) [-496.784] * (-493.390) (-494.181) (-497.396) [-494.024] -- 0:00:22
635000 -- (-495.492) [-498.129] (-502.120) (-500.583) * [-494.022] (-494.222) (-494.968) (-494.542) -- 0:00:22
Average standard deviation of split frequencies: 0.009311
635500 -- (-498.178) (-493.667) (-496.324) [-494.905] * [-498.211] (-493.820) (-494.617) (-495.022) -- 0:00:22
636000 -- (-498.643) (-498.089) (-498.404) [-495.959] * [-493.680] (-494.821) (-497.256) (-498.456) -- 0:00:22
636500 -- (-496.085) (-494.998) [-494.566] (-495.213) * (-500.673) (-496.118) [-496.548] (-493.713) -- 0:00:22
637000 -- [-495.104] (-497.902) (-494.520) (-495.068) * (-496.309) (-494.875) (-496.906) [-497.556] -- 0:00:22
637500 -- (-494.301) (-495.498) (-502.058) [-496.079] * [-497.298] (-495.028) (-497.709) (-496.989) -- 0:00:22
638000 -- [-495.443] (-495.709) (-494.787) (-495.081) * (-495.542) (-496.734) [-494.148] (-496.000) -- 0:00:22
638500 -- [-498.725] (-496.688) (-495.179) (-496.678) * [-499.092] (-496.526) (-497.906) (-498.184) -- 0:00:22
639000 -- (-495.904) (-500.314) (-493.271) [-494.162] * (-496.250) (-500.190) [-494.332] (-495.072) -- 0:00:22
639500 -- (-496.552) (-503.734) [-493.393] (-499.287) * [-496.392] (-495.201) (-495.179) (-495.818) -- 0:00:22
640000 -- (-494.046) [-497.553] (-496.448) (-495.686) * [-493.724] (-498.647) (-494.069) (-500.891) -- 0:00:22
Average standard deviation of split frequencies: 0.009795
640500 -- (-493.877) (-495.764) (-496.590) [-495.395] * [-494.456] (-497.389) (-494.091) (-497.400) -- 0:00:22
641000 -- (-496.683) [-494.681] (-495.399) (-495.211) * (-495.865) (-494.083) (-493.798) [-496.354] -- 0:00:22
641500 -- (-495.033) [-494.678] (-494.700) (-495.963) * (-499.001) (-495.881) (-495.129) [-494.652] -- 0:00:22
642000 -- (-496.377) (-495.549) (-496.531) [-495.990] * (-497.374) (-495.682) [-494.354] (-494.845) -- 0:00:22
642500 -- (-494.352) (-499.204) [-495.869] (-495.242) * (-499.190) (-494.276) (-493.276) [-496.954] -- 0:00:22
643000 -- (-494.367) [-496.458] (-494.807) (-497.468) * (-494.304) [-495.106] (-495.072) (-495.207) -- 0:00:22
643500 -- (-497.045) (-497.483) (-497.895) [-496.142] * (-495.294) (-497.700) (-498.740) [-495.387] -- 0:00:22
644000 -- (-493.720) (-496.618) (-493.677) [-495.100] * (-493.998) (-495.872) (-493.555) [-497.058] -- 0:00:22
644500 -- (-496.994) (-496.555) (-493.436) [-496.627] * (-495.038) [-495.956] (-494.510) (-494.915) -- 0:00:22
645000 -- (-499.097) (-494.364) (-495.692) [-494.339] * (-493.555) (-495.692) [-494.670] (-494.638) -- 0:00:22
Average standard deviation of split frequencies: 0.009578
645500 -- (-497.281) (-496.323) (-507.583) [-494.792] * [-494.691] (-494.195) (-494.842) (-497.094) -- 0:00:21
646000 -- [-495.217] (-495.793) (-496.594) (-494.764) * [-495.518] (-495.517) (-494.399) (-495.761) -- 0:00:21
646500 -- (-496.898) [-495.019] (-496.999) (-494.310) * [-500.335] (-499.547) (-496.608) (-495.749) -- 0:00:21
647000 -- [-496.074] (-497.144) (-495.716) (-494.226) * (-496.473) (-497.790) [-494.398] (-495.732) -- 0:00:21
647500 -- (-495.848) (-493.327) (-494.655) [-495.367] * (-496.088) (-500.330) (-495.024) [-495.066] -- 0:00:21
648000 -- (-495.868) (-494.620) (-493.974) [-495.337] * (-495.845) (-497.357) [-496.304] (-495.384) -- 0:00:21
648500 -- (-493.810) [-493.939] (-495.831) (-494.292) * (-494.915) [-493.377] (-493.717) (-496.015) -- 0:00:21
649000 -- (-494.724) (-495.210) [-495.035] (-496.378) * (-496.987) (-495.581) [-496.475] (-495.861) -- 0:00:21
649500 -- (-494.627) (-495.037) (-494.077) [-494.645] * (-495.899) (-495.237) [-497.745] (-495.382) -- 0:00:21
650000 -- [-496.404] (-500.839) (-495.384) (-494.922) * (-493.990) (-495.632) [-495.052] (-501.131) -- 0:00:21
Average standard deviation of split frequencies: 0.009645
650500 -- (-493.942) (-498.477) [-494.344] (-496.456) * [-493.460] (-494.847) (-498.394) (-499.862) -- 0:00:21
651000 -- (-495.982) [-494.626] (-493.533) (-495.706) * (-494.142) (-497.110) (-495.607) [-498.858] -- 0:00:21
651500 -- (-494.225) (-495.620) [-496.466] (-493.596) * (-501.527) [-494.049] (-495.832) (-494.191) -- 0:00:21
652000 -- (-495.553) (-494.811) [-497.992] (-496.167) * (-499.012) [-496.391] (-497.522) (-493.647) -- 0:00:21
652500 -- (-497.513) [-496.468] (-494.720) (-494.180) * [-495.396] (-494.634) (-494.105) (-498.495) -- 0:00:21
653000 -- (-495.105) (-494.552) (-494.745) [-495.115] * (-497.188) [-493.635] (-494.388) (-495.107) -- 0:00:21
653500 -- (-494.665) (-495.476) [-495.858] (-494.280) * (-494.464) (-496.882) (-496.099) [-494.131] -- 0:00:21
654000 -- [-494.904] (-495.912) (-498.110) (-496.444) * (-493.948) [-498.541] (-500.900) (-494.304) -- 0:00:21
654500 -- (-495.183) (-494.979) [-494.707] (-495.811) * [-494.119] (-499.434) (-501.102) (-493.976) -- 0:00:21
655000 -- (-495.551) [-493.938] (-496.344) (-495.415) * (-496.190) [-493.545] (-496.685) (-496.211) -- 0:00:21
Average standard deviation of split frequencies: 0.009746
655500 -- [-497.413] (-493.949) (-495.376) (-493.835) * (-495.306) (-494.965) (-496.422) [-496.803] -- 0:00:21
656000 -- (-496.223) (-496.474) (-494.648) [-494.072] * (-494.076) [-494.936] (-495.935) (-496.038) -- 0:00:21
656500 -- (-496.845) (-497.367) [-495.149] (-500.633) * (-498.356) (-494.236) [-498.882] (-499.074) -- 0:00:21
657000 -- (-495.890) [-495.447] (-495.530) (-496.049) * (-496.691) [-494.025] (-497.207) (-496.366) -- 0:00:21
657500 -- (-499.162) (-497.050) (-494.413) [-494.666] * (-493.664) (-494.588) (-495.005) [-495.927] -- 0:00:21
658000 -- (-500.934) [-496.385] (-497.131) (-495.825) * (-494.035) (-494.850) [-494.665] (-495.436) -- 0:00:21
658500 -- (-499.584) (-496.520) (-494.589) [-495.614] * (-497.078) [-503.435] (-495.059) (-500.543) -- 0:00:21
659000 -- [-496.032] (-497.560) (-497.262) (-498.676) * (-495.889) (-497.850) [-496.614] (-495.933) -- 0:00:21
659500 -- [-495.765] (-494.259) (-493.751) (-494.015) * (-502.425) [-496.316] (-494.474) (-494.954) -- 0:00:21
660000 -- [-497.729] (-494.811) (-497.165) (-493.466) * (-499.239) (-494.689) [-495.939] (-497.814) -- 0:00:21
Average standard deviation of split frequencies: 0.009677
660500 -- (-497.303) (-494.130) [-495.315] (-496.275) * (-496.301) (-499.637) (-494.946) [-494.285] -- 0:00:21
661000 -- (-497.658) (-494.160) (-495.524) [-495.949] * [-495.223] (-500.435) (-495.770) (-495.564) -- 0:00:21
661500 -- (-495.591) [-494.147] (-494.785) (-494.576) * (-501.365) (-502.862) (-493.936) [-496.686] -- 0:00:20
662000 -- (-494.704) (-494.170) (-494.786) [-494.027] * (-494.134) [-495.949] (-496.776) (-493.465) -- 0:00:20
662500 -- (-496.667) [-497.706] (-495.858) (-494.218) * (-499.907) [-494.525] (-494.059) (-493.427) -- 0:00:20
663000 -- (-500.887) (-495.993) [-496.111] (-496.137) * (-494.388) (-497.517) (-493.772) [-495.212] -- 0:00:20
663500 -- (-496.961) (-496.429) [-494.475] (-495.345) * (-493.975) (-497.097) [-495.387] (-494.601) -- 0:00:20
664000 -- [-494.286] (-495.149) (-497.706) (-496.755) * (-496.590) (-494.446) [-495.985] (-500.380) -- 0:00:20
664500 -- (-496.535) [-494.547] (-496.011) (-500.717) * (-498.298) (-494.275) [-494.171] (-501.505) -- 0:00:20
665000 -- (-495.641) [-494.742] (-495.609) (-496.739) * [-496.819] (-495.342) (-495.854) (-496.625) -- 0:00:20
Average standard deviation of split frequencies: 0.009555
665500 -- [-493.809] (-495.487) (-493.443) (-497.133) * (-496.991) (-501.042) (-494.452) [-497.066] -- 0:00:20
666000 -- [-494.479] (-494.722) (-495.410) (-494.469) * (-497.900) (-500.102) (-495.527) [-496.180] -- 0:00:20
666500 -- (-497.119) (-496.098) [-493.924] (-497.339) * (-497.757) [-496.026] (-493.527) (-495.743) -- 0:00:20
667000 -- [-494.964] (-493.123) (-495.008) (-495.425) * (-496.142) [-494.226] (-493.528) (-496.766) -- 0:00:20
667500 -- (-494.919) [-495.082] (-498.215) (-494.170) * [-497.922] (-493.963) (-496.558) (-494.117) -- 0:00:20
668000 -- [-498.600] (-496.637) (-495.058) (-495.551) * (-496.537) (-496.505) (-494.633) [-493.681] -- 0:00:20
668500 -- (-495.510) (-496.564) [-494.157] (-494.212) * (-497.462) (-499.248) (-495.051) [-494.781] -- 0:00:20
669000 -- (-495.876) (-499.103) [-494.834] (-497.249) * (-495.508) (-497.725) (-499.597) [-495.355] -- 0:00:20
669500 -- (-495.457) [-495.133] (-495.339) (-497.088) * (-493.195) [-493.567] (-496.180) (-494.220) -- 0:00:20
670000 -- [-498.121] (-501.879) (-495.447) (-495.408) * (-497.108) (-494.949) (-501.927) [-496.792] -- 0:00:20
Average standard deviation of split frequencies: 0.010368
670500 -- [-495.625] (-496.441) (-494.362) (-494.026) * (-495.566) [-497.214] (-493.552) (-496.631) -- 0:00:20
671000 -- [-493.427] (-497.003) (-494.805) (-494.427) * [-495.925] (-498.054) (-494.100) (-497.870) -- 0:00:20
671500 -- (-493.612) (-494.775) [-494.431] (-494.697) * (-495.469) (-495.118) (-495.110) [-494.156] -- 0:00:20
672000 -- (-495.704) [-496.290] (-495.008) (-497.449) * (-495.659) (-495.434) [-494.061] (-494.737) -- 0:00:20
672500 -- (-502.559) [-493.980] (-498.575) (-496.169) * (-497.588) [-495.560] (-495.313) (-495.267) -- 0:00:20
673000 -- (-499.131) [-495.402] (-498.000) (-496.736) * (-495.049) [-494.150] (-496.296) (-494.389) -- 0:00:20
673500 -- (-496.664) (-494.725) (-500.266) [-495.124] * (-496.566) (-496.610) [-497.024] (-493.652) -- 0:00:20
674000 -- (-494.614) (-495.185) [-494.804] (-498.488) * (-502.110) (-495.425) [-496.493] (-496.691) -- 0:00:20
674500 -- (-494.971) [-496.462] (-496.681) (-495.689) * (-494.213) [-495.600] (-495.735) (-494.972) -- 0:00:20
675000 -- (-496.251) [-494.768] (-494.974) (-496.030) * (-493.794) [-494.596] (-497.461) (-494.949) -- 0:00:20
Average standard deviation of split frequencies: 0.010042
675500 -- [-494.154] (-495.353) (-494.828) (-495.476) * (-493.642) [-494.523] (-495.502) (-493.598) -- 0:00:20
676000 -- (-494.765) (-495.122) [-496.893] (-496.958) * (-494.915) [-494.020] (-496.244) (-498.071) -- 0:00:20
676500 -- (-494.216) (-501.852) (-497.474) [-497.356] * (-496.623) (-496.046) [-494.273] (-494.691) -- 0:00:20
677000 -- (-493.962) (-495.181) [-495.447] (-495.430) * (-495.475) [-494.991] (-495.864) (-495.133) -- 0:00:20
677500 -- (-497.111) (-497.432) [-501.233] (-495.062) * (-495.473) (-494.265) (-496.663) [-493.337] -- 0:00:19
678000 -- (-494.743) (-496.777) (-498.000) [-494.937] * (-495.291) [-495.386] (-496.752) (-496.104) -- 0:00:19
678500 -- (-500.129) [-498.799] (-494.176) (-497.587) * (-502.055) (-493.803) [-494.113] (-495.329) -- 0:00:19
679000 -- [-501.780] (-495.473) (-495.675) (-494.102) * (-501.158) [-494.113] (-497.808) (-498.262) -- 0:00:19
679500 -- [-496.311] (-494.945) (-495.396) (-494.589) * [-499.504] (-493.852) (-498.144) (-494.904) -- 0:00:19
680000 -- (-497.780) [-501.410] (-496.733) (-501.661) * (-499.639) (-495.444) (-495.090) [-494.128] -- 0:00:19
Average standard deviation of split frequencies: 0.010111
680500 -- (-496.120) (-497.964) [-494.872] (-499.145) * [-495.498] (-496.213) (-493.588) (-494.801) -- 0:00:19
681000 -- (-496.911) [-495.281] (-494.361) (-499.845) * (-495.982) (-494.978) [-493.747] (-495.972) -- 0:00:19
681500 -- (-494.612) (-494.883) [-493.877] (-500.836) * (-494.794) (-496.964) [-495.766] (-496.376) -- 0:00:19
682000 -- (-494.489) (-496.330) (-497.592) [-495.120] * (-495.665) (-496.882) [-494.825] (-496.123) -- 0:00:19
682500 -- [-496.864] (-496.299) (-495.633) (-494.462) * (-495.596) [-497.159] (-497.160) (-495.199) -- 0:00:19
683000 -- (-493.302) (-497.110) [-497.822] (-497.085) * [-494.466] (-496.302) (-495.106) (-496.205) -- 0:00:19
683500 -- (-494.003) (-498.521) [-493.890] (-500.885) * (-495.636) (-495.466) (-494.313) [-494.476] -- 0:00:19
684000 -- (-495.921) (-494.958) (-496.668) [-493.863] * (-495.945) (-494.902) [-494.005] (-495.275) -- 0:00:19
684500 -- (-494.310) [-494.703] (-494.381) (-494.339) * (-495.158) [-493.537] (-495.475) (-493.608) -- 0:00:19
685000 -- (-497.813) (-495.359) (-493.504) [-494.151] * (-498.925) [-494.202] (-496.319) (-495.462) -- 0:00:19
Average standard deviation of split frequencies: 0.010079
685500 -- (-496.410) (-494.102) [-494.967] (-498.202) * (-496.593) [-498.027] (-495.902) (-504.765) -- 0:00:19
686000 -- (-493.671) (-493.622) [-495.890] (-496.690) * (-495.668) (-494.898) (-493.178) [-493.262] -- 0:00:19
686500 -- [-495.850] (-493.939) (-494.991) (-495.721) * [-494.311] (-496.353) (-497.001) (-493.611) -- 0:00:19
687000 -- (-494.913) (-493.636) (-497.218) [-494.001] * (-495.659) (-495.843) [-498.816] (-493.768) -- 0:00:19
687500 -- (-496.114) (-501.174) (-494.101) [-493.998] * [-498.099] (-493.611) (-500.888) (-495.023) -- 0:00:19
688000 -- [-497.002] (-497.335) (-496.779) (-495.199) * [-498.058] (-497.750) (-498.456) (-496.739) -- 0:00:19
688500 -- (-495.521) [-496.002] (-496.827) (-494.482) * (-495.771) (-496.991) [-498.492] (-501.505) -- 0:00:19
689000 -- (-495.983) (-496.899) (-496.653) [-495.115] * (-494.331) (-502.800) [-497.044] (-496.676) -- 0:00:19
689500 -- [-497.305] (-494.011) (-496.529) (-494.053) * (-493.970) (-494.426) [-494.908] (-499.541) -- 0:00:19
690000 -- (-493.647) (-493.649) [-495.705] (-494.471) * (-493.941) (-493.553) [-497.665] (-497.324) -- 0:00:19
Average standard deviation of split frequencies: 0.009783
690500 -- (-495.950) [-495.605] (-499.799) (-494.636) * [-497.501] (-498.294) (-494.836) (-494.436) -- 0:00:19
691000 -- (-496.114) (-495.119) (-501.336) [-493.861] * (-495.332) [-497.097] (-495.897) (-494.650) -- 0:00:19
691500 -- (-501.021) (-499.589) (-495.456) [-493.777] * (-493.889) [-493.817] (-494.934) (-496.578) -- 0:00:19
692000 -- (-494.557) (-497.031) [-495.844] (-499.474) * (-495.369) (-493.735) (-497.957) [-494.445] -- 0:00:19
692500 -- (-498.088) [-494.113] (-496.443) (-494.111) * (-494.086) (-494.868) (-495.641) [-495.233] -- 0:00:19
693000 -- (-493.691) [-493.502] (-495.854) (-494.663) * (-498.430) (-498.610) (-496.041) [-494.473] -- 0:00:19
693500 -- (-493.671) [-494.187] (-494.547) (-497.354) * (-493.558) (-494.848) [-495.203] (-494.388) -- 0:00:19
694000 -- [-494.096] (-495.054) (-493.745) (-494.034) * (-493.935) (-495.409) [-495.161] (-495.482) -- 0:00:18
694500 -- (-494.038) (-494.441) (-495.308) [-494.217] * (-494.373) [-495.776] (-496.479) (-495.188) -- 0:00:18
695000 -- (-495.076) (-497.438) [-495.206] (-495.475) * (-495.515) [-495.953] (-495.937) (-494.570) -- 0:00:18
Average standard deviation of split frequencies: 0.010566
695500 -- (-497.448) (-499.079) (-495.293) [-494.898] * (-499.224) [-494.603] (-495.839) (-493.946) -- 0:00:18
696000 -- (-497.592) [-498.287] (-494.354) (-494.789) * (-495.312) (-495.333) (-494.154) [-493.517] -- 0:00:18
696500 -- [-496.690] (-496.250) (-494.379) (-500.312) * (-494.398) (-495.469) [-493.703] (-494.402) -- 0:00:18
697000 -- [-496.233] (-498.074) (-495.505) (-495.974) * (-497.861) [-500.280] (-498.515) (-494.713) -- 0:00:18
697500 -- (-494.675) (-493.885) (-496.448) [-494.352] * (-497.672) [-496.619] (-497.960) (-494.025) -- 0:00:18
698000 -- (-499.865) (-493.735) (-496.683) [-496.709] * (-498.606) (-495.904) (-500.539) [-493.978] -- 0:00:18
698500 -- [-494.524] (-496.258) (-495.404) (-497.896) * (-497.014) [-497.201] (-495.772) (-495.968) -- 0:00:18
699000 -- (-498.208) [-500.795] (-495.505) (-496.527) * [-497.340] (-493.615) (-494.340) (-495.921) -- 0:00:18
699500 -- (-495.089) (-500.999) (-496.159) [-494.181] * [-495.888] (-494.035) (-496.478) (-494.788) -- 0:00:18
700000 -- (-500.455) [-498.527] (-495.595) (-496.471) * (-496.904) (-495.444) [-496.453] (-495.954) -- 0:00:18
Average standard deviation of split frequencies: 0.010540
700500 -- (-494.745) [-494.046] (-496.897) (-496.865) * [-496.203] (-495.184) (-498.590) (-497.472) -- 0:00:18
701000 -- (-494.286) [-494.443] (-495.384) (-498.604) * [-498.319] (-497.052) (-494.061) (-494.891) -- 0:00:18
701500 -- (-495.022) (-494.896) [-497.291] (-494.983) * (-496.783) (-495.654) (-493.866) [-497.456] -- 0:00:18
702000 -- (-495.933) (-496.670) [-495.141] (-495.511) * (-495.189) (-500.711) [-494.328] (-496.821) -- 0:00:18
702500 -- (-495.635) (-500.941) [-494.550] (-494.356) * [-500.754] (-496.517) (-494.160) (-494.180) -- 0:00:18
703000 -- (-497.016) (-497.277) [-494.692] (-494.614) * [-495.752] (-496.796) (-498.304) (-494.691) -- 0:00:18
703500 -- (-495.124) [-496.509] (-495.345) (-496.047) * (-494.297) [-495.499] (-494.280) (-493.824) -- 0:00:18
704000 -- (-496.239) (-498.038) (-495.091) [-494.434] * (-493.806) (-499.268) (-495.225) [-493.395] -- 0:00:18
704500 -- (-497.291) (-497.845) (-494.677) [-494.117] * (-496.337) (-501.296) [-495.168] (-494.555) -- 0:00:18
705000 -- (-498.690) (-494.156) (-494.298) [-495.076] * (-496.022) (-499.752) [-494.584] (-494.210) -- 0:00:18
Average standard deviation of split frequencies: 0.010391
705500 -- (-494.780) (-495.104) (-496.178) [-493.814] * [-495.952] (-496.268) (-495.422) (-493.751) -- 0:00:18
706000 -- (-495.965) (-495.459) [-501.693] (-496.452) * (-495.330) (-495.159) (-496.228) [-494.377] -- 0:00:18
706500 -- (-496.706) [-494.159] (-500.791) (-494.329) * [-494.590] (-496.887) (-496.840) (-495.233) -- 0:00:18
707000 -- (-495.817) (-494.046) [-495.359] (-499.621) * [-496.334] (-493.524) (-496.870) (-494.280) -- 0:00:18
707500 -- (-498.142) [-498.360] (-498.009) (-495.456) * [-495.082] (-494.613) (-494.633) (-495.345) -- 0:00:18
708000 -- (-497.259) [-496.541] (-494.225) (-496.738) * (-494.534) (-494.895) [-495.382] (-495.066) -- 0:00:18
708500 -- (-497.667) [-495.382] (-494.520) (-495.030) * [-494.104] (-494.545) (-494.832) (-498.263) -- 0:00:18
709000 -- (-499.936) (-496.756) (-493.890) [-494.005] * (-495.012) (-497.358) (-494.298) [-494.917] -- 0:00:18
709500 -- [-495.320] (-495.086) (-494.648) (-505.252) * [-493.900] (-503.469) (-494.335) (-496.243) -- 0:00:18
710000 -- (-497.282) (-495.703) (-496.489) [-494.307] * [-493.888] (-494.948) (-497.527) (-494.627) -- 0:00:17
Average standard deviation of split frequencies: 0.009618
710500 -- (-496.030) (-498.503) (-496.258) [-500.258] * [-494.900] (-494.848) (-493.357) (-494.640) -- 0:00:17
711000 -- (-497.874) (-502.023) (-497.175) [-494.382] * (-494.916) [-494.952] (-493.487) (-496.492) -- 0:00:17
711500 -- (-497.002) (-495.593) (-496.411) [-494.053] * [-494.470] (-494.032) (-498.241) (-497.768) -- 0:00:17
712000 -- [-497.140] (-494.416) (-494.714) (-498.751) * (-493.784) [-493.696] (-496.184) (-498.372) -- 0:00:17
712500 -- (-496.923) (-495.639) [-495.077] (-493.979) * (-495.263) (-495.904) (-496.699) [-494.878] -- 0:00:17
713000 -- [-497.884] (-495.413) (-495.426) (-493.696) * (-496.016) (-495.097) [-496.304] (-495.450) -- 0:00:17
713500 -- (-495.551) (-495.514) (-495.177) [-499.540] * [-497.005] (-496.389) (-497.697) (-493.390) -- 0:00:17
714000 -- (-495.225) (-494.191) (-498.391) [-497.812] * (-496.724) [-495.578] (-497.835) (-493.660) -- 0:00:17
714500 -- [-493.891] (-495.742) (-495.745) (-500.085) * [-494.195] (-494.230) (-494.133) (-494.501) -- 0:00:17
715000 -- (-495.862) (-496.163) [-493.764] (-495.746) * (-496.033) [-495.525] (-493.874) (-496.957) -- 0:00:17
Average standard deviation of split frequencies: 0.009752
715500 -- [-496.903] (-495.165) (-496.146) (-499.744) * (-504.417) [-493.818] (-498.108) (-496.103) -- 0:00:17
716000 -- (-498.904) [-494.849] (-496.562) (-497.896) * (-498.980) [-495.716] (-494.885) (-495.745) -- 0:00:17
716500 -- (-498.995) [-494.762] (-495.111) (-496.137) * (-495.594) (-495.424) [-493.494] (-494.190) -- 0:00:17
717000 -- (-494.660) [-496.129] (-497.106) (-497.129) * (-495.300) (-495.954) [-495.914] (-495.040) -- 0:00:17
717500 -- (-493.905) (-497.043) (-496.049) [-493.980] * (-496.116) (-493.956) [-496.298] (-493.460) -- 0:00:17
718000 -- (-494.412) [-497.151] (-495.056) (-494.275) * (-501.545) (-493.852) [-498.650] (-498.773) -- 0:00:17
718500 -- (-493.176) (-495.378) [-495.064] (-494.697) * (-495.983) (-493.704) [-499.859] (-500.061) -- 0:00:17
719000 -- (-495.856) [-493.254] (-493.623) (-495.620) * (-499.368) [-499.283] (-493.861) (-496.543) -- 0:00:17
719500 -- [-495.704] (-493.759) (-494.468) (-493.556) * [-498.467] (-493.984) (-494.647) (-497.517) -- 0:00:17
720000 -- (-498.134) [-495.105] (-497.598) (-493.551) * (-496.198) [-497.666] (-494.830) (-495.458) -- 0:00:17
Average standard deviation of split frequencies: 0.010030
720500 -- (-494.665) (-500.974) [-495.568] (-496.686) * (-495.542) (-494.138) [-493.728] (-494.868) -- 0:00:17
721000 -- (-494.673) [-495.042] (-496.064) (-498.421) * [-495.394] (-501.141) (-494.195) (-495.366) -- 0:00:17
721500 -- [-495.938] (-494.780) (-494.122) (-497.567) * (-496.814) (-496.141) [-494.536] (-497.350) -- 0:00:16
722000 -- (-495.675) [-500.440] (-495.110) (-497.611) * [-494.803] (-494.522) (-495.174) (-499.892) -- 0:00:17
722500 -- (-494.107) (-497.266) (-496.160) [-494.223] * (-503.078) (-499.520) [-499.791] (-494.589) -- 0:00:17
723000 -- (-493.700) [-495.664] (-495.177) (-494.438) * (-494.620) [-495.712] (-496.917) (-495.756) -- 0:00:17
723500 -- (-494.721) (-499.165) (-493.898) [-499.891] * (-493.779) (-498.549) (-496.128) [-494.309] -- 0:00:17
724000 -- [-495.018] (-496.825) (-497.709) (-495.121) * (-497.328) (-496.689) [-493.561] (-494.147) -- 0:00:17
724500 -- (-495.138) (-495.954) (-496.298) [-496.771] * [-495.659] (-496.560) (-498.163) (-493.645) -- 0:00:17
725000 -- (-495.169) (-502.382) (-493.936) [-494.693] * (-495.013) (-496.579) [-497.868] (-493.954) -- 0:00:17
Average standard deviation of split frequencies: 0.009699
725500 -- (-496.546) [-494.137] (-497.596) (-493.924) * (-494.289) (-495.498) [-498.068] (-496.645) -- 0:00:17
726000 -- (-494.630) (-497.677) (-494.582) [-494.253] * (-493.412) (-494.667) [-493.828] (-498.322) -- 0:00:16
726500 -- (-495.035) (-496.052) (-497.863) [-493.762] * [-493.278] (-494.427) (-494.794) (-496.319) -- 0:00:16
727000 -- [-495.113] (-497.585) (-498.001) (-494.940) * (-497.290) [-493.146] (-493.674) (-494.377) -- 0:00:16
727500 -- (-494.444) [-498.916] (-496.627) (-496.774) * (-496.339) [-494.443] (-493.868) (-495.549) -- 0:00:16
728000 -- (-494.952) (-496.648) (-496.388) [-499.504] * [-495.886] (-496.973) (-495.134) (-495.320) -- 0:00:16
728500 -- (-496.604) (-494.930) (-493.974) [-499.183] * (-494.325) [-496.616] (-494.665) (-502.393) -- 0:00:16
729000 -- (-500.053) [-498.216] (-496.664) (-494.807) * [-494.274] (-498.507) (-495.207) (-498.628) -- 0:00:16
729500 -- (-495.542) (-496.967) [-494.330] (-494.008) * (-494.702) (-496.562) (-495.180) [-494.062] -- 0:00:16
730000 -- (-495.120) (-497.085) [-495.287] (-500.584) * (-494.928) (-498.816) [-495.278] (-496.197) -- 0:00:16
Average standard deviation of split frequencies: 0.010081
730500 -- [-494.158] (-496.977) (-498.981) (-495.100) * (-494.570) (-497.529) [-498.710] (-493.322) -- 0:00:16
731000 -- (-498.791) (-496.761) (-497.428) [-502.606] * [-497.452] (-494.364) (-496.675) (-495.406) -- 0:00:16
731500 -- (-500.133) (-494.583) [-494.863] (-497.836) * [-496.549] (-496.644) (-493.901) (-493.729) -- 0:00:16
732000 -- [-496.060] (-497.521) (-496.696) (-494.356) * (-494.469) [-493.942] (-495.132) (-494.082) -- 0:00:16
732500 -- (-494.112) [-494.196] (-494.769) (-494.282) * (-497.828) (-502.210) [-494.190] (-493.812) -- 0:00:16
733000 -- [-494.544] (-496.914) (-495.626) (-493.408) * (-493.244) [-495.632] (-494.461) (-496.900) -- 0:00:16
733500 -- [-495.734] (-497.254) (-493.894) (-496.075) * (-495.668) (-497.303) [-495.642] (-497.504) -- 0:00:16
734000 -- [-495.507] (-496.195) (-494.694) (-495.425) * [-496.056] (-497.291) (-493.667) (-497.569) -- 0:00:16
734500 -- (-499.481) (-496.273) (-494.738) [-494.379] * (-495.009) [-497.628] (-493.728) (-496.092) -- 0:00:16
735000 -- (-495.014) (-494.185) [-494.427] (-497.897) * [-495.171] (-500.899) (-494.432) (-495.420) -- 0:00:16
Average standard deviation of split frequencies: 0.010376
735500 -- [-494.828] (-495.954) (-493.270) (-498.120) * [-494.673] (-497.577) (-495.364) (-497.389) -- 0:00:16
736000 -- [-495.312] (-496.497) (-494.321) (-496.808) * (-495.428) (-498.744) [-493.870] (-497.099) -- 0:00:16
736500 -- [-494.483] (-496.104) (-496.575) (-494.162) * [-495.211] (-496.344) (-495.537) (-494.286) -- 0:00:16
737000 -- (-493.613) (-495.513) (-493.676) [-494.386] * (-498.997) [-494.625] (-495.675) (-494.600) -- 0:00:16
737500 -- (-495.283) (-497.482) [-494.757] (-495.958) * (-495.527) [-496.114] (-496.916) (-495.320) -- 0:00:16
738000 -- (-495.980) (-495.890) [-494.876] (-495.017) * (-494.600) [-495.814] (-497.057) (-494.605) -- 0:00:15
738500 -- [-494.101] (-494.126) (-496.284) (-494.482) * (-493.787) [-493.519] (-494.810) (-495.261) -- 0:00:15
739000 -- (-497.529) (-499.276) (-494.452) [-499.051] * (-496.348) (-494.127) (-496.326) [-493.785] -- 0:00:16
739500 -- (-497.756) [-497.099] (-500.043) (-494.456) * [-494.909] (-495.703) (-494.850) (-495.902) -- 0:00:16
740000 -- (-498.203) [-495.748] (-497.825) (-496.543) * (-499.755) [-496.796] (-496.756) (-493.933) -- 0:00:16
Average standard deviation of split frequencies: 0.010820
740500 -- (-496.913) (-495.066) [-500.097] (-496.957) * (-498.822) (-498.588) [-495.844] (-495.350) -- 0:00:16
741000 -- (-497.131) [-495.040] (-498.005) (-494.927) * (-499.327) (-495.858) [-497.385] (-498.001) -- 0:00:16
741500 -- (-496.383) [-496.008] (-499.472) (-493.253) * [-495.249] (-493.594) (-495.260) (-497.182) -- 0:00:16
742000 -- (-497.572) (-495.152) [-496.416] (-496.039) * (-495.580) [-494.696] (-495.270) (-498.297) -- 0:00:15
742500 -- (-493.652) (-496.822) (-495.496) [-496.037] * (-495.795) (-494.356) (-495.526) [-496.589] -- 0:00:15
743000 -- (-494.910) [-496.460] (-502.781) (-495.024) * (-494.213) [-493.515] (-498.579) (-496.883) -- 0:00:15
743500 -- (-495.433) [-497.026] (-497.328) (-494.246) * (-495.183) (-497.544) [-494.974] (-497.713) -- 0:00:15
744000 -- [-496.439] (-494.109) (-494.702) (-494.200) * (-496.353) (-495.011) [-495.783] (-495.767) -- 0:00:15
744500 -- (-500.015) (-494.028) (-494.436) [-496.064] * (-493.789) (-496.084) (-494.470) [-495.038] -- 0:00:15
745000 -- (-495.570) (-498.479) [-495.184] (-496.378) * (-494.649) (-500.051) [-493.999] (-495.964) -- 0:00:15
Average standard deviation of split frequencies: 0.010387
745500 -- (-495.818) [-495.766] (-497.153) (-496.037) * [-494.245] (-494.713) (-495.847) (-496.797) -- 0:00:15
746000 -- (-493.834) (-500.212) [-501.269] (-494.181) * (-495.287) (-496.489) (-495.921) [-500.049] -- 0:00:15
746500 -- [-494.615] (-503.085) (-499.667) (-495.171) * (-497.102) [-493.899] (-494.963) (-495.065) -- 0:00:15
747000 -- (-494.819) [-493.595] (-507.093) (-494.731) * (-495.637) (-493.820) [-494.337] (-499.105) -- 0:00:15
747500 -- (-494.020) (-496.296) [-494.130] (-498.632) * [-495.477] (-494.608) (-493.828) (-499.254) -- 0:00:15
748000 -- (-495.224) (-494.253) [-495.894] (-494.217) * [-498.729] (-495.180) (-494.931) (-501.712) -- 0:00:15
748500 -- (-497.757) [-496.301] (-494.641) (-497.000) * (-501.701) (-496.243) (-500.044) [-497.544] -- 0:00:15
749000 -- (-495.387) [-495.037] (-498.345) (-496.379) * [-498.988] (-497.515) (-495.773) (-496.699) -- 0:00:15
749500 -- (-493.714) (-494.694) (-496.506) [-495.563] * (-495.619) (-497.195) (-493.854) [-495.412] -- 0:00:15
750000 -- (-494.763) (-497.820) [-494.054] (-496.314) * (-495.395) (-499.325) [-499.545] (-493.842) -- 0:00:15
Average standard deviation of split frequencies: 0.010634
750500 -- (-497.036) [-496.240] (-494.588) (-494.905) * (-497.301) (-497.777) (-495.465) [-495.419] -- 0:00:15
751000 -- (-495.942) (-494.762) (-494.775) [-497.197] * (-494.707) (-496.692) [-497.269] (-496.264) -- 0:00:15
751500 -- (-494.005) [-494.608] (-494.726) (-495.586) * (-495.450) [-496.368] (-496.765) (-493.596) -- 0:00:15
752000 -- (-494.923) (-493.848) (-494.152) [-495.733] * [-496.413] (-495.705) (-497.651) (-493.297) -- 0:00:15
752500 -- (-496.971) (-497.407) (-496.436) [-495.762] * (-496.966) [-497.566] (-496.394) (-498.469) -- 0:00:15
753000 -- (-498.261) (-497.217) (-494.434) [-493.788] * (-497.492) (-498.251) [-493.651] (-495.112) -- 0:00:15
753500 -- (-495.321) [-495.294] (-496.156) (-494.718) * (-495.651) (-499.553) [-494.889] (-495.851) -- 0:00:15
754000 -- (-498.889) [-497.212] (-493.268) (-494.571) * (-496.673) (-494.255) (-497.879) [-495.083] -- 0:00:15
754500 -- (-496.102) (-496.618) [-495.356] (-493.556) * [-494.394] (-497.711) (-498.185) (-494.983) -- 0:00:14
755000 -- (-497.205) (-495.705) (-500.778) [-494.484] * [-495.290] (-495.579) (-494.312) (-495.189) -- 0:00:14
Average standard deviation of split frequencies: 0.010850
755500 -- (-494.985) (-495.514) (-498.533) [-494.086] * (-495.720) [-495.230] (-495.451) (-496.608) -- 0:00:14
756000 -- (-494.347) (-496.227) [-495.183] (-495.836) * (-495.977) [-495.315] (-494.755) (-497.707) -- 0:00:15
756500 -- (-500.306) (-496.823) [-498.647] (-495.408) * (-497.266) [-495.418] (-495.655) (-495.819) -- 0:00:15
757000 -- (-496.621) (-494.272) (-495.265) [-496.217] * (-495.875) [-495.949] (-496.871) (-494.438) -- 0:00:15
757500 -- (-499.538) [-493.708] (-495.551) (-494.071) * [-496.082] (-495.740) (-495.962) (-500.327) -- 0:00:15
758000 -- (-498.621) (-494.651) (-497.303) [-495.352] * [-495.408] (-497.554) (-495.494) (-499.960) -- 0:00:15
758500 -- (-495.408) [-496.346] (-499.058) (-494.392) * (-498.482) [-496.432] (-494.710) (-496.045) -- 0:00:14
759000 -- (-495.064) [-494.105] (-495.433) (-494.233) * (-494.280) (-496.780) [-494.357] (-493.808) -- 0:00:14
759500 -- (-496.847) (-501.052) (-502.018) [-495.119] * [-495.935] (-498.615) (-494.783) (-493.788) -- 0:00:14
760000 -- (-494.127) [-496.012] (-495.808) (-494.633) * (-499.162) [-495.357] (-494.355) (-494.175) -- 0:00:14
Average standard deviation of split frequencies: 0.010453
760500 -- (-497.712) (-493.211) [-494.831] (-496.952) * (-498.407) (-495.035) (-494.443) [-493.966] -- 0:00:14
761000 -- [-495.809] (-496.907) (-495.435) (-501.116) * [-502.179] (-494.534) (-494.173) (-494.942) -- 0:00:14
761500 -- (-499.750) [-494.750] (-494.002) (-494.927) * (-494.646) (-494.856) [-494.209] (-495.133) -- 0:00:14
762000 -- (-504.166) [-494.137] (-494.011) (-494.557) * (-496.091) [-494.189] (-496.498) (-495.506) -- 0:00:14
762500 -- (-494.782) (-495.585) (-497.271) [-495.547] * [-496.415] (-494.503) (-497.168) (-494.054) -- 0:00:14
763000 -- (-495.002) [-495.225] (-495.627) (-494.343) * (-502.561) [-494.182] (-493.837) (-494.886) -- 0:00:14
763500 -- [-494.406] (-494.868) (-497.611) (-497.471) * (-495.436) [-495.719] (-496.080) (-497.964) -- 0:00:14
764000 -- (-494.523) (-494.206) [-494.382] (-497.217) * (-493.759) (-497.845) [-498.538] (-493.758) -- 0:00:14
764500 -- (-495.142) [-497.028] (-498.702) (-498.910) * (-495.555) [-495.471] (-498.371) (-495.503) -- 0:00:14
765000 -- (-494.834) (-497.298) (-497.775) [-497.399] * (-494.686) (-496.581) (-495.483) [-496.090] -- 0:00:14
Average standard deviation of split frequencies: 0.010052
765500 -- (-494.424) (-495.854) (-501.206) [-496.678] * (-493.973) (-495.743) (-500.052) [-499.603] -- 0:00:14
766000 -- (-494.133) [-495.641] (-499.013) (-494.707) * (-494.981) (-497.208) [-497.171] (-496.380) -- 0:00:14
766500 -- (-495.282) (-495.004) [-495.040] (-496.036) * (-495.727) [-494.657] (-497.695) (-496.244) -- 0:00:14
767000 -- [-494.825] (-494.177) (-495.111) (-496.774) * [-493.941] (-494.841) (-493.982) (-496.849) -- 0:00:14
767500 -- [-495.029] (-499.428) (-495.112) (-500.291) * [-495.186] (-494.372) (-495.599) (-496.421) -- 0:00:14
768000 -- (-495.198) [-497.475] (-494.061) (-496.837) * (-493.818) (-495.390) [-494.730] (-495.679) -- 0:00:14
768500 -- (-494.774) (-494.775) (-494.832) [-493.936] * (-495.551) (-494.591) (-495.959) [-495.115] -- 0:00:14
769000 -- (-502.202) [-496.149] (-496.206) (-494.759) * (-496.276) (-493.401) (-495.479) [-494.477] -- 0:00:14
769500 -- (-499.497) (-496.852) [-495.440] (-494.835) * (-493.984) (-493.306) (-494.071) [-494.127] -- 0:00:14
770000 -- (-494.680) (-494.309) [-495.263] (-493.825) * (-494.512) (-494.272) (-495.618) [-494.199] -- 0:00:14
Average standard deviation of split frequencies: 0.009298
770500 -- (-496.272) [-495.701] (-495.911) (-498.606) * (-494.194) (-494.338) (-497.314) [-495.230] -- 0:00:13
771000 -- (-493.530) (-495.214) [-499.203] (-494.929) * (-502.114) [-495.457] (-496.623) (-496.665) -- 0:00:13
771500 -- [-494.658] (-496.351) (-494.176) (-497.547) * (-495.675) (-493.894) (-495.725) [-496.800] -- 0:00:13
772000 -- (-499.083) (-494.711) (-494.976) [-496.599] * (-496.224) [-494.254] (-496.365) (-496.543) -- 0:00:13
772500 -- (-498.174) [-494.483] (-495.817) (-495.888) * (-496.782) (-498.351) (-495.985) [-494.528] -- 0:00:13
773000 -- [-498.397] (-497.206) (-493.879) (-494.142) * [-493.941] (-495.279) (-496.545) (-495.457) -- 0:00:14
773500 -- [-497.116] (-495.450) (-494.694) (-495.572) * (-497.324) (-494.103) [-496.579] (-496.041) -- 0:00:14
774000 -- (-496.550) [-495.285] (-496.252) (-494.867) * (-496.244) (-494.839) (-497.660) [-493.703] -- 0:00:14
774500 -- (-495.681) [-494.611] (-497.870) (-493.677) * (-495.167) (-499.637) (-496.137) [-495.339] -- 0:00:13
775000 -- (-496.032) (-493.910) [-494.631] (-498.398) * (-495.766) [-493.834] (-497.597) (-500.288) -- 0:00:13
Average standard deviation of split frequencies: 0.009477
775500 -- (-496.153) (-493.428) (-496.625) [-494.100] * [-493.792] (-493.525) (-493.552) (-497.909) -- 0:00:13
776000 -- (-497.272) (-495.249) (-494.619) [-494.356] * (-496.782) [-494.193] (-495.026) (-493.891) -- 0:00:13
776500 -- [-497.428] (-497.625) (-496.152) (-495.483) * [-493.214] (-500.136) (-500.154) (-494.966) -- 0:00:13
777000 -- (-496.677) (-499.288) (-495.493) [-495.498] * (-495.129) (-498.089) (-497.613) [-495.463] -- 0:00:13
777500 -- (-494.318) (-495.047) [-496.431] (-494.382) * [-493.905] (-494.700) (-496.241) (-497.040) -- 0:00:13
778000 -- (-494.267) (-496.414) [-493.684] (-503.408) * [-494.101] (-496.400) (-494.204) (-496.131) -- 0:00:13
778500 -- [-495.978] (-494.854) (-496.737) (-496.056) * (-496.382) (-496.680) [-493.466] (-495.944) -- 0:00:13
779000 -- (-496.737) [-494.741] (-495.741) (-495.410) * (-497.161) (-496.541) [-493.533] (-499.751) -- 0:00:13
779500 -- (-495.054) [-495.266] (-501.639) (-495.088) * [-494.438] (-497.052) (-495.026) (-495.477) -- 0:00:13
780000 -- [-495.965] (-495.477) (-497.012) (-496.088) * (-493.943) (-497.558) (-497.581) [-496.989] -- 0:00:13
Average standard deviation of split frequencies: 0.009903
780500 -- [-496.603] (-505.616) (-500.736) (-494.054) * [-497.458] (-495.954) (-494.194) (-499.295) -- 0:00:13
781000 -- (-500.099) [-494.207] (-495.317) (-494.136) * (-498.258) (-493.999) [-495.452] (-494.689) -- 0:00:13
781500 -- [-498.198] (-495.530) (-495.670) (-495.809) * (-502.119) (-495.221) (-497.899) [-494.896] -- 0:00:13
782000 -- (-494.502) [-495.687] (-496.901) (-497.861) * (-495.320) (-495.217) [-498.191] (-496.921) -- 0:00:13
782500 -- [-494.078] (-495.345) (-494.758) (-498.779) * (-494.729) [-495.583] (-498.632) (-496.657) -- 0:00:13
783000 -- (-494.769) (-496.891) [-494.529] (-497.824) * (-494.543) (-497.783) (-495.752) [-497.063] -- 0:00:13
783500 -- (-497.241) (-497.033) (-495.328) [-494.281] * (-499.630) [-495.634] (-494.881) (-495.446) -- 0:00:13
784000 -- (-502.570) (-497.386) (-494.930) [-495.456] * [-495.250] (-495.288) (-499.043) (-495.391) -- 0:00:13
784500 -- (-494.354) [-493.784] (-494.325) (-495.321) * (-498.340) (-495.123) [-498.423] (-495.707) -- 0:00:13
785000 -- (-493.143) (-494.057) (-494.996) [-496.049] * (-496.870) [-495.273] (-496.816) (-495.692) -- 0:00:13
Average standard deviation of split frequencies: 0.009556
785500 -- (-494.218) (-495.485) (- 