--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:53:28 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/fadE25/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1627.54 -1632.45 2 -1627.36 -1632.22 -------------------------------------- TOTAL -1627.45 -1632.34 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.863454 0.090020 0.340607 1.460550 0.833924 1390.37 1426.68 1.000 r(A<->C){all} 0.116538 0.012327 0.000108 0.352872 0.081332 224.08 267.04 1.000 r(A<->G){all} 0.168794 0.022176 0.000081 0.486186 0.126893 288.95 297.16 1.001 r(A<->T){all} 0.170370 0.020108 0.000050 0.452728 0.131116 260.33 282.54 1.001 r(C<->G){all} 0.092367 0.008111 0.000108 0.280085 0.064119 408.49 419.83 1.002 r(C<->T){all} 0.295684 0.031241 0.000698 0.624953 0.275041 210.01 236.01 1.003 r(G<->T){all} 0.156248 0.018750 0.000120 0.437501 0.119361 170.07 230.70 1.000 pi(A){all} 0.209911 0.000141 0.186469 0.232802 0.209777 1328.32 1403.89 1.000 pi(C){all} 0.265499 0.000164 0.241443 0.291959 0.265437 1194.18 1229.23 1.000 pi(G){all} 0.309125 0.000181 0.284115 0.336759 0.308922 1228.53 1235.56 1.000 pi(T){all} 0.215465 0.000143 0.191273 0.237424 0.215069 1219.29 1307.30 1.000 alpha{1,2} 0.188816 0.028517 0.032756 0.448282 0.139773 1244.11 1322.29 1.000 alpha{3} 0.358352 0.217024 0.000154 1.262870 0.188498 1083.15 1102.22 1.000 pinvar{all} 0.995208 0.000011 0.988841 0.999632 0.996068 1257.52 1264.25 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1561.65748 Model 2: PositiveSelection -1560.898906 Model 0: one-ratio -1560.898634 Model 7: beta -1561.657477 Model 8: beta&w>1 -1560.898906 Model 0 vs 1 1.517692000000352 Model 2 vs 1 1.5171480000003612 Model 8 vs 7 1.517142000000149
>C1 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C2 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C3 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C4 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDVAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C5 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C6 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSIWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=389 C1 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C2 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C3 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C4 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C5 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C6 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ************************************************** C1 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C2 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C3 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C4 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C5 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C6 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN ************************************************** C1 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C2 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C3 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C4 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C5 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C6 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA ************************************************** C1 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C2 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C3 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C4 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C5 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C6 KADGDDWILNGFKCWITNGGKSIWYTVMAVTDPDKGANGISAFIVHKDDE ********************** *************************** C1 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C2 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C3 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C4 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C5 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C6 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH ************************************************** C1 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C2 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C3 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C4 TRPTIGAQAVGIAQGALDVAIVYTKDRKQFGESISTFQSIQFMLADMAMK C5 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C6 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK ******************.******************************* C1 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C2 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C3 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C4 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C5 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C6 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG ************************************************** C1 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C2 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C3 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C4 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C5 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C6 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR *************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 389 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 389 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11670] Library Relaxation: Multi_proc [96] Relaxation Summary: [11670]--->[11670] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.531 Mb, Max= 30.967 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C2 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C3 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C4 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C5 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE C6 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ************************************************** C1 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C2 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C3 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C4 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C5 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN C6 ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN ************************************************** C1 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C2 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C3 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C4 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C5 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA C6 KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA ************************************************** C1 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C2 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C3 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C4 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C5 KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE C6 KADGDDWILNGFKCWITNGGKSIWYTVMAVTDPDKGANGISAFIVHKDDE ********************** *************************** C1 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C2 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C3 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C4 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C5 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH C6 GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH ************************************************** C1 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C2 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C3 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C4 TRPTIGAQAVGIAQGALDVAIVYTKDRKQFGESISTFQSIQFMLADMAMK C5 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK C6 TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK ******************.******************************* C1 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C2 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C3 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C4 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C5 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG C6 VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG ************************************************** C1 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C2 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C3 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C4 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C5 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR C6 AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR *************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 99.74 C1 C4 99.74 TOP 3 0 99.74 C4 C1 99.74 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 99.74 C1 C6 99.74 TOP 5 0 99.74 C6 C1 99.74 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 99.74 C2 C4 99.74 TOP 3 1 99.74 C4 C2 99.74 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 99.74 C2 C6 99.74 TOP 5 1 99.74 C6 C2 99.74 BOT 2 3 99.74 C3 C4 99.74 TOP 3 2 99.74 C4 C3 99.74 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 99.74 C3 C6 99.74 TOP 5 2 99.74 C6 C3 99.74 BOT 3 4 99.74 C4 C5 99.74 TOP 4 3 99.74 C5 C4 99.74 BOT 3 5 99.49 C4 C6 99.49 TOP 5 3 99.49 C6 C4 99.49 BOT 4 5 99.74 C5 C6 99.74 TOP 5 4 99.74 C6 C5 99.74 AVG 0 C1 * 99.90 AVG 1 C2 * 99.90 AVG 2 C3 * 99.90 AVG 3 C4 * 99.69 AVG 4 C5 * 99.90 AVG 5 C6 * 99.69 TOT TOT * 99.83 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA C2 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA C3 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA C4 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA C5 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA C6 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA ************************************************** C1 AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA C2 AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA C3 AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA C4 AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA C5 AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA C6 AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA ************************************************** C1 TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA C2 TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA C3 TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA C4 TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA C5 TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA C6 TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA ************************************************** C1 GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA C2 GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA C3 GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA C4 GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA C5 GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA C6 GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA ************************************************** C1 GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG C2 GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG C3 GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG C4 GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG C5 GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG C6 GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG ************************************************** C1 AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC C2 AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC C3 AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC C4 AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC C5 AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC C6 AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC ************************************************** C1 AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA C2 AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA C3 AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA C4 AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA C5 AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA C6 AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA ************************************************** C1 ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT C2 ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT C3 ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT C4 ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT C5 ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT C6 ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT ************************************************** C1 TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC C2 TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC C3 TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC C4 TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC C5 TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC C6 TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC ************************************************** C1 AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC C2 AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC C3 AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC C4 AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC C5 AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC C6 AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC ************************************************** C1 CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG C2 CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG C3 CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG C4 CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG C5 CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG C6 CAACGGTGGCAAGTCGATCTGGTACACGGTTATGGCGGTGACCGATCCGG ***************** ******************************** C1 ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG C2 ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG C3 ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG C4 ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG C5 ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG C6 ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG ************************************************** C1 GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC C2 GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC C3 GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC C4 GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC C5 GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC C6 GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC ************************************************** C1 AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA C2 AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA C3 AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA C4 AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA C5 AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA C6 AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA ************************************************** C1 TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC C2 TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC C3 TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC C4 TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC C5 TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC C6 TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC ************************************************** C1 ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT C2 ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT C3 ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT C4 ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT C5 ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT C6 ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT ************************************************** C1 GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA C2 GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA C3 GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA C4 GGACGTTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA C5 GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA C6 GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA ***** ******************************************** C1 TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA C2 TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA C3 TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA C4 TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA C5 TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA C6 TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA ************************************************** C1 GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG C2 GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG C3 GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG C4 GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG C5 GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG C6 GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG ************************************************** C1 CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT C2 CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT C3 CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT C4 CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT C5 CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT C6 CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT ************************************************** C1 CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC C2 CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC C3 CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC C4 CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC C5 CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC C6 CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC ************************************************** C1 GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA C2 GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA C3 GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA C4 GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA C5 GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA C6 GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA ************************************************** C1 GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT C2 GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT C3 GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT C4 GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT C5 GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT C6 GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT ************************************************** C1 CGCGGGCGCTGCTGCGC C2 CGCGGGCGCTGCTGCGC C3 CGCGGGCGCTGCTGCGC C4 CGCGGGCGCTGCTGCGC C5 CGCGGGCGCTGCTGCGC C6 CGCGGGCGCTGCTGCGC ***************** >C1 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT CGCGGGCGCTGCTGCGC >C2 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT CGCGGGCGCTGCTGCGC >C3 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT CGCGGGCGCTGCTGCGC >C4 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT GGACGTTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT CGCGGGCGCTGCTGCGC >C5 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC CAACGGTGGCAAGTCGACCTGGTACACGGTTATGGCGGTGACCGATCCGG ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT CGCGGGCGCTGCTGCGC >C6 ATGGTTGGGTGGTCCGGAAACCCATTGTTTGATCTATTCAAGCTGCCAGA AGAACACAACGAATTGCGGGCAACCATCCGCGCGTTGGCGGAAAAAGAGA TCGCTCCGCATGCCGCTGATGTGGACCAGCGTGCTCGATTTCCCGAGGAA GCGCTGGCAGCCCTGAATGCATCAGGTTTCAACGCTATCCACGTTCCCGA GGAGTATGGTGGTCAGGGTGCGGATTCGGTAGCGGCTTGCATTGTGATCG AAGAAGTGGCGCGTGTCGATGCTTCTGCATCGTTGATTCCTGCAGTTAAC AAGCTTGGCACCATGGGACTCATCCTGCGCGGTTCGGAAGAGCTCAAGAA ACAGGTTCTGCCATCGTTGGCTGCGGAGGGGGCGATGGCGTCCTATGCAT TAAGTGAGCGCGAAGCCGGCAGTGACGCTGCGTCGATGCGGACCCGGGCC AAAGCTGACGGGGATGACTGGATTCTCAATGGCTTCAAGTGCTGGATTAC CAACGGTGGCAAGTCGATCTGGTACACGGTTATGGCGGTGACCGATCCGG ACAAGGGCGCCAACGGCATCTCGGCGTTCATCGTGCACAAGGACGATGAG GGATTCAGCATTGGCCCGAAAGAAAAGAAGCTCGGGATCAAGGGGTCACC AACCACCGAACTCTACTTCGATAAATGTCGCATCCCCGGTGATCGCATCA TTGGTGAGCCCGGTACTGGCTTTAAGACAGCGCTAGCCACGTTGGATCAC ACGCGTCCCACGATTGGTGCCCAAGCCGTGGGCATTGCGCAGGGCGCGTT GGACGCTGCCATCGTTTATACCAAGGACCGCAAGCAATTCGGCGAGTCGA TTAGCACTTTCCAGTCCATTCAGTTCATGCTCGCCGACATGGCGATGAAA GTGGAGGCTGCACGGTTAATTGTCTACGCTGCCGCTGCCCGTGCTGAACG CGGTGAGCCGGATCTGGGCTTTATTTCAGCGGCGTCGAAATGCTTTGCTT CCGACATTGCGATGGAGGTCACCACCGACGCTGTGCAATTGTTTGGCGGC GCGGGCTACACTTCCGACTTCCCCGTCGAGCGGTTCATGCGCGACGCCAA GATCACACAGATCTATGAGGGGACCAATCAGATTCAGCGTGTGGTGATGT CGCGGGCGCTGCTGCGC >C1 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C2 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C3 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C4 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDVAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C5 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSTWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR >C6 MVGWSGNPLFDLFKLPEEHNELRATIRALAEKEIAPHAADVDQRARFPEE ALAALNASGFNAIHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN KLGTMGLILRGSEELKKQVLPSLAAEGAMASYALSEREAGSDAASMRTRA KADGDDWILNGFKCWITNGGKSIWYTVMAVTDPDKGANGISAFIVHKDDE GFSIGPKEKKLGIKGSPTTELYFDKCRIPGDRIIGEPGTGFKTALATLDH TRPTIGAQAVGIAQGALDAAIVYTKDRKQFGESISTFQSIQFMLADMAMK VEAARLIVYAAAARAERGEPDLGFISAASKCFASDIAMEVTTDAVQLFGG AGYTSDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1167 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579776710 Setting output file names to "/data/1res/fadE25/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1084589582 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9194500910 Seed = 1613641505 Swapseed = 1579776710 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 6 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2618.606119 -- -24.965149 Chain 2 -- -2618.606119 -- -24.965149 Chain 3 -- -2618.606119 -- -24.965149 Chain 4 -- -2618.607669 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2618.607139 -- -24.965149 Chain 2 -- -2618.607518 -- -24.965149 Chain 3 -- -2618.605969 -- -24.965149 Chain 4 -- -2618.606119 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2618.606] (-2618.606) (-2618.606) (-2618.608) * [-2618.607] (-2618.608) (-2618.606) (-2618.606) 500 -- (-1630.013) [-1627.729] (-1641.584) (-1628.730) * (-1633.237) [-1632.506] (-1635.984) (-1637.079) -- 0:00:00 1000 -- (-1631.680) (-1626.707) (-1628.889) [-1630.752] * (-1635.127) [-1628.308] (-1635.483) (-1638.465) -- 0:00:00 1500 -- (-1632.973) (-1634.301) (-1633.616) [-1632.889] * (-1634.430) (-1628.871) (-1631.787) [-1633.578] -- 0:00:00 2000 -- [-1634.056] (-1630.569) (-1633.616) (-1628.009) * (-1636.370) (-1628.232) (-1633.964) [-1625.276] -- 0:00:00 2500 -- (-1632.960) [-1630.878] (-1633.791) (-1632.933) * (-1627.688) (-1629.020) (-1634.500) [-1632.456] -- 0:00:00 3000 -- [-1637.265] (-1630.058) (-1630.945) (-1633.403) * [-1630.498] (-1628.751) (-1636.450) (-1633.398) -- 0:00:00 3500 -- (-1626.584) [-1633.331] (-1629.823) (-1626.839) * (-1635.173) [-1630.667] (-1635.227) (-1630.111) -- 0:00:00 4000 -- (-1631.061) (-1639.373) [-1633.256] (-1639.688) * (-1625.361) (-1626.912) [-1637.898] (-1631.585) -- 0:04:09 4500 -- (-1630.744) (-1630.855) (-1639.060) [-1633.594] * [-1632.540] (-1629.934) (-1633.813) (-1639.516) -- 0:03:41 5000 -- [-1640.513] (-1631.375) (-1632.135) (-1633.185) * (-1632.703) (-1634.255) (-1635.820) [-1632.744] -- 0:03:19 Average standard deviation of split frequencies: 0.061488 5500 -- (-1629.862) (-1628.471) [-1628.347] (-1635.652) * (-1634.550) (-1638.777) [-1629.526] (-1630.835) -- 0:03:00 6000 -- [-1628.026] (-1637.294) (-1632.235) (-1632.097) * (-1630.742) (-1631.547) (-1631.320) [-1634.247] -- 0:02:45 6500 -- (-1635.123) (-1636.584) [-1627.918] (-1636.919) * (-1641.916) (-1633.312) (-1633.834) [-1628.219] -- 0:02:32 7000 -- (-1636.347) [-1634.766] (-1634.015) (-1635.811) * (-1634.887) (-1635.715) [-1633.142] (-1639.985) -- 0:02:21 7500 -- (-1633.277) (-1630.438) [-1630.928] (-1642.814) * [-1634.631] (-1630.589) (-1636.651) (-1633.302) -- 0:02:12 8000 -- (-1635.124) (-1626.556) [-1626.604] (-1636.730) * [-1632.124] (-1637.115) (-1629.564) (-1634.129) -- 0:02:04 8500 -- (-1629.703) (-1628.300) [-1632.244] (-1636.824) * (-1638.677) [-1625.228] (-1631.981) (-1631.948) -- 0:01:56 9000 -- [-1630.408] (-1630.289) (-1625.467) (-1630.290) * (-1636.051) (-1630.840) [-1631.461] (-1633.720) -- 0:01:50 9500 -- (-1634.427) [-1628.246] (-1630.407) (-1634.643) * [-1627.788] (-1633.279) (-1635.451) (-1632.696) -- 0:01:44 10000 -- (-1628.658) [-1629.581] (-1644.939) (-1633.138) * (-1625.364) (-1631.387) (-1636.586) [-1629.710] -- 0:01:39 Average standard deviation of split frequencies: 0.048212 10500 -- (-1632.061) (-1639.113) (-1639.349) [-1631.475] * (-1629.618) (-1629.478) [-1631.824] (-1638.579) -- 0:01:34 11000 -- (-1634.191) (-1637.650) [-1633.572] (-1635.798) * (-1625.475) [-1628.960] (-1631.705) (-1641.825) -- 0:01:29 11500 -- [-1626.041] (-1626.075) (-1632.013) (-1633.178) * [-1628.897] (-1628.716) (-1635.805) (-1627.506) -- 0:01:25 12000 -- (-1628.500) (-1629.669) [-1632.865] (-1633.975) * (-1630.058) (-1630.649) [-1630.954] (-1630.226) -- 0:01:22 12500 -- (-1632.877) (-1625.845) (-1626.637) [-1626.517] * [-1630.369] (-1632.469) (-1637.625) (-1634.620) -- 0:01:19 13000 -- [-1625.243] (-1629.772) (-1632.561) (-1637.207) * (-1628.718) [-1631.107] (-1633.848) (-1627.897) -- 0:01:15 13500 -- [-1626.585] (-1631.228) (-1630.906) (-1633.429) * [-1628.980] (-1628.742) (-1640.020) (-1631.092) -- 0:01:13 14000 -- (-1630.857) (-1627.520) (-1628.537) [-1628.406] * [-1625.763] (-1631.082) (-1631.743) (-1633.114) -- 0:01:10 14500 -- (-1631.278) (-1638.892) (-1630.355) [-1634.689] * (-1631.220) [-1626.808] (-1629.702) (-1632.823) -- 0:01:07 15000 -- (-1633.514) [-1630.295] (-1628.185) (-1629.383) * [-1629.536] (-1629.074) (-1636.187) (-1633.973) -- 0:01:05 Average standard deviation of split frequencies: 0.040687 15500 -- (-1626.846) (-1627.386) [-1635.304] (-1639.916) * [-1630.970] (-1630.509) (-1637.702) (-1631.870) -- 0:01:03 16000 -- (-1628.112) [-1634.128] (-1630.582) (-1629.790) * (-1641.216) (-1633.416) [-1634.362] (-1630.110) -- 0:01:01 16500 -- (-1629.374) (-1633.617) [-1622.992] (-1630.975) * (-1628.199) (-1630.481) [-1633.556] (-1629.882) -- 0:00:59 17000 -- (-1634.682) [-1627.632] (-1634.107) (-1630.966) * (-1634.319) [-1626.566] (-1636.643) (-1629.644) -- 0:00:57 17500 -- [-1634.500] (-1633.011) (-1629.128) (-1633.418) * [-1635.518] (-1636.162) (-1636.474) (-1630.034) -- 0:00:56 18000 -- (-1629.689) (-1638.959) [-1629.176] (-1632.745) * (-1632.657) (-1632.356) [-1631.704] (-1633.096) -- 0:01:49 18500 -- (-1630.406) [-1633.889] (-1635.967) (-1626.988) * [-1631.535] (-1629.622) (-1635.560) (-1630.679) -- 0:01:46 19000 -- [-1633.593] (-1632.761) (-1629.395) (-1633.302) * (-1633.523) (-1632.800) (-1633.997) [-1629.255] -- 0:01:43 19500 -- (-1628.139) [-1637.732] (-1626.067) (-1637.179) * (-1630.335) [-1630.403] (-1631.097) (-1630.185) -- 0:01:40 20000 -- [-1630.286] (-1636.426) (-1637.553) (-1631.560) * [-1627.947] (-1630.846) (-1632.725) (-1633.178) -- 0:01:38 Average standard deviation of split frequencies: 0.030793 20500 -- (-1631.951) [-1629.285] (-1629.166) (-1639.335) * [-1627.667] (-1630.704) (-1631.839) (-1634.960) -- 0:01:35 21000 -- (-1631.276) (-1636.681) (-1626.573) [-1632.962] * (-1631.038) [-1627.282] (-1639.965) (-1634.857) -- 0:01:33 21500 -- (-1633.540) [-1633.327] (-1637.392) (-1631.543) * [-1626.219] (-1628.803) (-1635.798) (-1631.318) -- 0:01:31 22000 -- (-1632.756) (-1647.659) (-1629.041) [-1629.597] * (-1627.184) (-1626.075) [-1630.169] (-1630.444) -- 0:01:28 22500 -- (-1636.430) (-1640.884) [-1627.937] (-1642.804) * (-1638.155) [-1628.199] (-1638.132) (-1631.589) -- 0:01:26 23000 -- (-1630.999) (-1640.931) (-1626.222) [-1635.726] * (-1630.628) [-1628.611] (-1631.017) (-1630.217) -- 0:01:24 23500 -- (-1625.843) [-1632.838] (-1636.212) (-1627.836) * (-1628.910) [-1630.024] (-1633.675) (-1629.195) -- 0:01:23 24000 -- (-1628.869) [-1640.240] (-1631.874) (-1634.238) * (-1629.968) (-1632.551) [-1633.187] (-1631.678) -- 0:01:21 24500 -- (-1626.513) [-1642.177] (-1630.842) (-1638.652) * (-1635.063) (-1636.887) [-1632.126] (-1629.784) -- 0:01:19 25000 -- [-1624.131] (-1632.115) (-1630.334) (-1639.044) * (-1636.812) [-1630.170] (-1630.971) (-1628.470) -- 0:01:18 Average standard deviation of split frequencies: 0.027591 25500 -- [-1630.520] (-1630.995) (-1627.897) (-1631.971) * (-1630.956) (-1634.286) [-1631.606] (-1631.130) -- 0:01:16 26000 -- [-1630.824] (-1631.529) (-1628.999) (-1635.965) * (-1629.617) (-1642.175) (-1637.256) [-1628.024] -- 0:01:14 26500 -- (-1632.387) (-1630.104) [-1626.429] (-1643.332) * (-1631.894) [-1623.568] (-1631.122) (-1629.321) -- 0:01:13 27000 -- (-1634.710) (-1630.218) [-1626.630] (-1631.169) * (-1635.747) (-1632.144) (-1641.070) [-1633.406] -- 0:01:12 27500 -- (-1632.068) [-1631.103] (-1628.856) (-1632.463) * [-1628.509] (-1633.458) (-1626.947) (-1630.856) -- 0:01:10 28000 -- (-1629.608) (-1627.051) [-1629.130] (-1632.089) * (-1628.471) (-1631.883) [-1630.596] (-1630.866) -- 0:01:09 28500 -- (-1634.917) (-1631.949) (-1637.686) [-1640.865] * (-1627.406) (-1638.423) [-1630.659] (-1632.043) -- 0:01:08 29000 -- (-1630.136) (-1628.623) (-1631.520) [-1634.573] * (-1629.769) (-1632.147) [-1636.856] (-1632.501) -- 0:01:06 29500 -- (-1629.818) (-1629.816) (-1637.545) [-1633.923] * [-1629.736] (-1632.908) (-1633.413) (-1629.974) -- 0:01:05 30000 -- (-1626.873) (-1629.973) [-1630.262] (-1629.891) * (-1630.802) (-1630.094) [-1628.156] (-1628.510) -- 0:01:04 Average standard deviation of split frequencies: 0.030744 30500 -- (-1628.589) (-1629.973) [-1628.793] (-1630.880) * [-1629.554] (-1628.957) (-1642.374) (-1629.475) -- 0:01:03 31000 -- (-1628.192) (-1630.064) (-1628.385) [-1634.155] * [-1628.892] (-1628.979) (-1643.261) (-1630.543) -- 0:01:02 31500 -- (-1632.867) (-1627.085) (-1631.226) [-1635.004] * (-1629.206) (-1631.498) (-1638.851) [-1628.856] -- 0:01:01 32000 -- (-1632.909) (-1632.684) [-1637.312] (-1638.003) * (-1628.933) (-1632.408) (-1636.962) [-1632.376] -- 0:01:00 32500 -- (-1630.779) [-1629.462] (-1634.335) (-1633.815) * (-1629.255) (-1629.162) [-1623.761] (-1631.590) -- 0:01:29 33000 -- [-1628.652] (-1627.944) (-1633.447) (-1638.732) * (-1626.224) (-1631.114) [-1625.921] (-1630.853) -- 0:01:27 33500 -- [-1631.316] (-1632.445) (-1633.944) (-1636.958) * [-1630.359] (-1630.000) (-1634.546) (-1629.513) -- 0:01:26 34000 -- (-1634.626) (-1633.914) (-1633.403) [-1635.953] * (-1628.576) (-1631.896) (-1636.410) [-1629.944] -- 0:01:25 34500 -- [-1633.542] (-1632.772) (-1633.126) (-1639.223) * (-1629.176) [-1629.235] (-1628.386) (-1631.397) -- 0:01:23 35000 -- (-1630.460) (-1628.626) (-1634.359) [-1632.728] * [-1630.336] (-1631.043) (-1627.769) (-1631.666) -- 0:01:22 Average standard deviation of split frequencies: 0.032736 35500 -- (-1634.063) (-1632.725) (-1635.192) [-1635.782] * (-1629.705) (-1631.948) [-1627.503] (-1629.785) -- 0:01:21 36000 -- (-1633.515) [-1634.434] (-1634.501) (-1631.676) * (-1629.652) (-1630.093) [-1632.970] (-1630.316) -- 0:01:20 36500 -- [-1630.636] (-1630.678) (-1639.357) (-1640.650) * (-1628.135) [-1626.963] (-1630.775) (-1631.576) -- 0:01:19 37000 -- (-1629.398) (-1631.260) (-1632.601) [-1631.435] * (-1630.436) [-1627.268] (-1635.981) (-1629.283) -- 0:01:18 37500 -- (-1634.886) [-1628.399] (-1633.795) (-1630.972) * (-1630.293) (-1628.815) (-1632.954) [-1631.906] -- 0:01:17 38000 -- (-1631.097) (-1631.343) (-1634.181) [-1631.173] * (-1632.329) (-1631.666) (-1635.444) [-1626.213] -- 0:01:15 38500 -- (-1631.270) (-1629.556) (-1638.671) [-1632.595] * (-1629.967) (-1630.923) (-1631.497) [-1626.564] -- 0:01:14 39000 -- (-1629.063) (-1630.733) (-1634.206) [-1632.806] * (-1631.829) (-1630.405) (-1634.999) [-1629.431] -- 0:01:13 39500 -- [-1632.323] (-1632.454) (-1636.082) (-1635.148) * (-1629.139) (-1630.006) (-1635.011) [-1630.829] -- 0:01:12 40000 -- (-1630.853) (-1631.219) (-1633.565) [-1629.718] * (-1630.557) (-1628.023) [-1645.525] (-1636.010) -- 0:01:12 Average standard deviation of split frequencies: 0.028065 40500 -- [-1632.179] (-1630.421) (-1635.314) (-1634.517) * (-1630.013) [-1629.044] (-1634.655) (-1632.237) -- 0:01:11 41000 -- (-1629.978) (-1631.946) [-1634.409] (-1632.222) * (-1630.483) (-1627.788) [-1628.610] (-1630.604) -- 0:01:10 41500 -- (-1631.213) [-1631.155] (-1631.700) (-1634.792) * [-1631.296] (-1626.230) (-1627.008) (-1632.096) -- 0:01:09 42000 -- (-1636.047) (-1633.478) (-1629.906) [-1633.713] * (-1634.335) (-1630.378) [-1629.946] (-1632.783) -- 0:01:08 42500 -- (-1631.950) [-1638.139] (-1630.499) (-1641.061) * (-1632.147) (-1627.272) [-1631.204] (-1629.683) -- 0:01:07 43000 -- (-1632.968) (-1636.463) (-1627.888) [-1633.814] * (-1632.584) (-1627.912) [-1626.244] (-1629.609) -- 0:01:06 43500 -- (-1632.926) (-1632.282) (-1628.446) [-1629.912] * [-1630.625] (-1629.341) (-1632.508) (-1631.972) -- 0:01:05 44000 -- (-1635.651) (-1631.236) [-1627.796] (-1634.320) * [-1630.861] (-1628.186) (-1635.127) (-1632.223) -- 0:01:05 44500 -- (-1634.948) (-1631.627) (-1630.355) [-1627.180] * (-1634.513) (-1629.475) [-1630.560] (-1633.022) -- 0:01:04 45000 -- (-1632.648) (-1631.861) [-1634.847] (-1628.729) * (-1634.257) (-1631.247) [-1627.958] (-1629.497) -- 0:01:03 Average standard deviation of split frequencies: 0.024083 45500 -- (-1634.901) (-1632.151) (-1631.798) [-1624.180] * [-1633.053] (-1629.606) (-1626.918) (-1633.894) -- 0:01:02 46000 -- (-1632.396) [-1629.880] (-1630.399) (-1632.076) * (-1631.231) (-1629.457) [-1632.342] (-1629.570) -- 0:01:02 46500 -- [-1634.091] (-1629.126) (-1632.545) (-1636.015) * (-1633.426) [-1626.690] (-1629.604) (-1630.160) -- 0:01:22 47000 -- [-1632.321] (-1629.191) (-1631.514) (-1628.206) * (-1631.170) (-1630.099) (-1636.697) [-1629.023] -- 0:01:21 47500 -- (-1633.856) (-1631.177) (-1632.557) [-1625.570] * (-1630.911) (-1630.919) (-1626.901) [-1629.064] -- 0:01:20 48000 -- (-1634.713) (-1629.853) (-1636.942) [-1630.828] * (-1631.894) (-1628.191) [-1630.274] (-1634.045) -- 0:01:19 48500 -- (-1632.470) (-1628.708) (-1631.447) [-1628.134] * (-1628.836) (-1627.648) (-1631.115) [-1627.367] -- 0:01:18 49000 -- (-1635.501) (-1628.538) [-1631.766] (-1631.181) * (-1631.587) [-1626.059] (-1635.095) (-1629.579) -- 0:01:17 49500 -- (-1632.028) (-1631.012) (-1631.300) [-1630.575] * (-1631.190) (-1627.473) [-1624.950] (-1630.792) -- 0:01:16 50000 -- [-1631.742] (-1629.264) (-1632.784) (-1636.706) * (-1631.628) (-1625.771) [-1628.511] (-1627.948) -- 0:01:16 Average standard deviation of split frequencies: 0.019587 50500 -- (-1631.414) (-1630.572) (-1637.730) [-1632.719] * (-1633.035) (-1630.520) (-1632.749) [-1627.206] -- 0:01:15 51000 -- (-1634.764) (-1633.038) (-1631.967) [-1637.495] * (-1629.347) [-1628.753] (-1632.664) (-1629.076) -- 0:01:14 51500 -- (-1629.505) (-1628.806) (-1627.756) [-1643.660] * (-1637.675) [-1628.294] (-1632.270) (-1631.700) -- 0:01:13 52000 -- (-1632.907) [-1626.877] (-1628.591) (-1632.469) * (-1634.396) (-1629.503) [-1627.716] (-1631.294) -- 0:01:12 52500 -- (-1631.107) [-1629.435] (-1630.700) (-1639.658) * (-1632.658) (-1629.966) [-1632.384] (-1631.593) -- 0:01:12 53000 -- [-1628.482] (-1633.399) (-1629.534) (-1628.186) * (-1634.124) (-1630.773) [-1626.301] (-1630.714) -- 0:01:11 53500 -- (-1631.275) (-1628.530) (-1635.569) [-1628.189] * (-1634.685) (-1628.704) [-1625.487] (-1629.584) -- 0:01:10 54000 -- (-1631.449) [-1627.004] (-1631.728) (-1626.701) * (-1632.429) (-1628.237) [-1628.444] (-1631.661) -- 0:01:10 54500 -- (-1631.988) [-1629.926] (-1634.185) (-1629.469) * (-1634.357) [-1627.698] (-1630.969) (-1627.851) -- 0:01:09 55000 -- [-1630.067] (-1627.520) (-1633.286) (-1631.616) * (-1633.592) (-1632.537) (-1627.963) [-1627.293] -- 0:01:08 Average standard deviation of split frequencies: 0.019361 55500 -- (-1628.539) (-1630.249) [-1632.190] (-1627.925) * (-1636.623) (-1627.812) [-1626.964] (-1632.993) -- 0:01:08 56000 -- (-1630.857) (-1631.569) [-1632.726] (-1627.769) * (-1634.798) (-1630.515) (-1632.123) [-1628.285] -- 0:01:07 56500 -- (-1628.854) (-1629.540) (-1633.730) [-1630.220] * (-1639.592) (-1631.139) [-1630.157] (-1628.327) -- 0:01:06 57000 -- (-1630.500) [-1628.320] (-1631.085) (-1628.268) * [-1630.454] (-1627.479) (-1630.878) (-1628.480) -- 0:01:06 57500 -- [-1629.841] (-1628.540) (-1634.479) (-1629.391) * (-1631.826) (-1628.772) (-1633.060) [-1628.359] -- 0:01:05 58000 -- (-1628.178) (-1629.721) [-1630.317] (-1630.038) * (-1632.545) (-1628.260) [-1628.603] (-1631.029) -- 0:01:04 58500 -- [-1627.742] (-1626.205) (-1632.893) (-1633.298) * (-1630.510) (-1631.427) [-1628.866] (-1630.723) -- 0:01:04 59000 -- (-1632.234) (-1632.576) (-1632.463) [-1631.602] * (-1630.504) (-1629.540) (-1638.243) [-1627.128] -- 0:01:03 59500 -- [-1631.944] (-1632.846) (-1630.014) (-1628.611) * (-1630.711) (-1627.191) [-1630.149] (-1630.260) -- 0:01:03 60000 -- (-1633.864) [-1631.532] (-1628.253) (-1627.603) * (-1631.543) (-1626.743) [-1626.869] (-1631.701) -- 0:01:02 Average standard deviation of split frequencies: 0.017177 60500 -- (-1630.615) (-1628.656) (-1629.206) [-1627.430] * (-1637.339) (-1632.038) [-1631.409] (-1631.176) -- 0:01:02 61000 -- (-1628.894) (-1630.681) (-1631.513) [-1628.184] * (-1631.193) [-1631.293] (-1631.637) (-1631.290) -- 0:01:16 61500 -- (-1630.747) (-1632.264) [-1630.360] (-1630.001) * (-1634.215) (-1628.102) [-1631.973] (-1631.942) -- 0:01:16 62000 -- [-1626.905] (-1628.595) (-1631.001) (-1629.910) * (-1631.322) (-1630.432) (-1633.206) [-1627.525] -- 0:01:15 62500 -- (-1628.716) (-1631.926) (-1627.966) [-1625.670] * (-1627.919) (-1630.970) [-1628.427] (-1627.563) -- 0:01:15 63000 -- (-1626.850) [-1630.027] (-1630.285) (-1627.080) * (-1630.210) (-1629.442) (-1625.496) [-1629.063] -- 0:01:14 63500 -- (-1626.319) [-1628.469] (-1628.343) (-1627.688) * (-1629.111) (-1630.630) [-1628.280] (-1631.910) -- 0:01:13 64000 -- (-1639.211) (-1629.690) (-1629.355) [-1630.641] * (-1630.088) (-1631.844) [-1635.352] (-1630.998) -- 0:01:13 64500 -- (-1630.827) (-1627.629) (-1628.509) [-1626.596] * (-1626.952) [-1630.117] (-1629.403) (-1631.783) -- 0:01:12 65000 -- (-1630.335) (-1627.815) [-1629.415] (-1632.671) * (-1631.132) [-1632.636] (-1627.423) (-1627.640) -- 0:01:11 Average standard deviation of split frequencies: 0.016916 65500 -- (-1629.866) (-1625.346) (-1627.677) [-1627.818] * (-1629.198) [-1628.525] (-1631.800) (-1629.163) -- 0:01:11 66000 -- (-1627.820) [-1626.322] (-1629.180) (-1631.766) * (-1627.695) (-1631.798) [-1631.697] (-1630.055) -- 0:01:10 66500 -- (-1630.900) [-1626.582] (-1626.649) (-1629.566) * (-1628.116) (-1628.736) (-1627.956) [-1629.570] -- 0:01:10 67000 -- (-1627.526) [-1626.930] (-1630.948) (-1629.610) * (-1628.651) (-1629.226) [-1627.769] (-1628.830) -- 0:01:09 67500 -- (-1628.680) (-1628.373) (-1626.712) [-1629.959] * (-1627.936) (-1629.891) [-1626.955] (-1631.850) -- 0:01:09 68000 -- (-1626.183) (-1629.605) [-1629.843] (-1630.341) * [-1625.716] (-1628.696) (-1626.346) (-1631.864) -- 0:01:08 68500 -- (-1627.990) [-1626.320] (-1628.406) (-1628.681) * (-1635.692) [-1629.338] (-1633.782) (-1627.423) -- 0:01:07 69000 -- (-1627.599) (-1627.454) [-1628.185] (-1627.424) * (-1627.784) (-1634.667) [-1626.844] (-1629.905) -- 0:01:07 69500 -- (-1635.089) [-1629.395] (-1628.048) (-1627.501) * (-1627.260) (-1630.393) [-1630.713] (-1628.659) -- 0:01:06 70000 -- (-1634.127) (-1628.375) (-1627.612) [-1626.500] * (-1627.914) (-1629.981) (-1629.670) [-1627.826] -- 0:01:06 Average standard deviation of split frequencies: 0.020364 70500 -- (-1635.028) [-1628.719] (-1631.284) (-1628.202) * (-1628.236) (-1631.379) [-1628.630] (-1629.624) -- 0:01:05 71000 -- (-1634.203) [-1627.748] (-1633.889) (-1629.069) * (-1630.722) [-1631.142] (-1629.110) (-1632.500) -- 0:01:05 71500 -- (-1634.342) (-1628.969) [-1627.552] (-1628.843) * [-1631.281] (-1629.247) (-1632.724) (-1631.446) -- 0:01:04 72000 -- (-1634.208) (-1633.526) [-1629.965] (-1632.621) * (-1627.702) (-1631.812) [-1627.115] (-1628.867) -- 0:01:04 72500 -- (-1632.128) (-1632.195) [-1628.862] (-1633.921) * (-1629.258) [-1632.949] (-1624.939) (-1627.258) -- 0:01:03 73000 -- (-1633.332) (-1630.166) [-1626.495] (-1631.654) * [-1626.247] (-1634.189) (-1626.773) (-1629.739) -- 0:01:03 73500 -- (-1629.446) [-1634.235] (-1628.407) (-1636.760) * (-1628.559) [-1631.049] (-1627.059) (-1627.515) -- 0:01:03 74000 -- [-1627.506] (-1630.562) (-1630.190) (-1630.097) * [-1627.780] (-1632.541) (-1631.397) (-1627.102) -- 0:01:02 74500 -- (-1630.345) [-1633.068] (-1627.992) (-1626.737) * [-1627.694] (-1630.734) (-1626.617) (-1627.114) -- 0:01:02 75000 -- (-1625.662) (-1630.280) (-1629.881) [-1629.825] * [-1627.277] (-1627.539) (-1625.460) (-1631.397) -- 0:01:01 Average standard deviation of split frequencies: 0.021873 75500 -- (-1627.009) (-1630.583) [-1628.017] (-1630.381) * (-1631.738) (-1630.509) [-1632.006] (-1629.531) -- 0:01:13 76000 -- (-1631.171) (-1629.025) (-1629.732) [-1632.498] * (-1631.617) (-1632.537) [-1631.243] (-1632.044) -- 0:01:12 76500 -- (-1628.936) (-1630.177) [-1629.586] (-1631.148) * (-1629.823) (-1632.459) [-1624.544] (-1630.694) -- 0:01:12 77000 -- [-1632.418] (-1629.492) (-1631.455) (-1630.507) * (-1626.663) (-1633.082) [-1627.547] (-1627.229) -- 0:01:11 77500 -- (-1636.136) [-1630.096] (-1632.020) (-1632.107) * (-1631.024) (-1634.288) (-1631.054) [-1628.692] -- 0:01:11 78000 -- (-1633.594) [-1632.483] (-1635.858) (-1631.935) * (-1629.583) (-1634.200) (-1632.148) [-1630.054] -- 0:01:10 78500 -- [-1630.863] (-1631.189) (-1629.167) (-1629.895) * (-1630.514) (-1632.328) [-1627.208] (-1630.887) -- 0:01:10 79000 -- [-1631.012] (-1626.693) (-1632.682) (-1632.999) * (-1636.742) (-1634.879) [-1625.768] (-1628.122) -- 0:01:09 79500 -- (-1630.556) [-1628.790] (-1628.278) (-1633.068) * [-1627.049] (-1633.074) (-1640.137) (-1626.907) -- 0:01:09 80000 -- [-1629.379] (-1626.813) (-1629.562) (-1631.334) * (-1626.795) (-1637.056) [-1631.621] (-1626.726) -- 0:01:09 Average standard deviation of split frequencies: 0.024298 80500 -- (-1633.885) (-1628.334) (-1632.214) [-1629.555] * (-1631.617) (-1633.045) (-1629.213) [-1626.952] -- 0:01:08 81000 -- [-1635.625] (-1636.108) (-1627.606) (-1628.971) * (-1627.140) (-1632.265) [-1633.698] (-1625.392) -- 0:01:08 81500 -- (-1633.995) (-1627.794) [-1627.334] (-1630.813) * [-1629.562] (-1633.357) (-1629.501) (-1628.191) -- 0:01:07 82000 -- (-1633.597) (-1628.639) [-1630.174] (-1628.279) * (-1631.104) (-1633.141) [-1624.660] (-1627.124) -- 0:01:07 82500 -- (-1634.714) (-1631.156) (-1634.383) [-1632.032] * (-1629.090) (-1632.591) (-1628.781) [-1624.229] -- 0:01:06 83000 -- (-1631.102) (-1629.767) [-1630.153] (-1627.185) * (-1628.713) (-1632.848) [-1627.055] (-1626.815) -- 0:01:06 83500 -- (-1627.992) [-1629.028] (-1630.103) (-1630.962) * [-1632.450] (-1633.459) (-1626.559) (-1628.522) -- 0:01:05 84000 -- (-1628.614) [-1630.272] (-1631.806) (-1628.782) * (-1629.041) (-1633.349) (-1627.763) [-1628.185] -- 0:01:05 84500 -- (-1630.423) [-1633.014] (-1628.073) (-1628.161) * (-1630.170) (-1634.051) (-1627.435) [-1630.186] -- 0:01:05 85000 -- [-1627.346] (-1630.465) (-1631.136) (-1631.969) * [-1628.633] (-1632.829) (-1626.539) (-1628.333) -- 0:01:04 Average standard deviation of split frequencies: 0.025215 85500 -- (-1629.529) (-1627.789) (-1628.404) [-1632.966] * (-1627.897) (-1632.886) [-1627.127] (-1630.185) -- 0:01:04 86000 -- [-1626.150] (-1627.799) (-1633.265) (-1631.654) * (-1630.099) [-1634.038] (-1624.188) (-1630.752) -- 0:01:03 86500 -- (-1627.064) (-1630.427) [-1629.337] (-1627.318) * (-1630.990) (-1632.356) [-1623.102] (-1630.801) -- 0:01:03 87000 -- [-1626.360] (-1630.062) (-1629.506) (-1627.640) * (-1631.018) (-1631.628) [-1630.269] (-1631.088) -- 0:01:02 87500 -- (-1629.040) [-1629.386] (-1628.657) (-1629.087) * (-1629.324) (-1636.934) [-1627.103] (-1628.238) -- 0:01:02 88000 -- (-1625.854) (-1627.048) (-1629.405) [-1634.201] * [-1630.857] (-1634.136) (-1630.754) (-1629.827) -- 0:01:02 88500 -- (-1630.930) (-1632.716) [-1631.924] (-1630.460) * (-1630.967) (-1630.020) [-1631.572] (-1631.651) -- 0:01:01 89000 -- [-1627.857] (-1630.271) (-1629.740) (-1628.937) * (-1631.266) [-1629.087] (-1632.147) (-1631.336) -- 0:01:01 89500 -- (-1627.670) (-1632.292) [-1628.576] (-1628.869) * (-1626.650) (-1633.789) [-1629.942] (-1632.200) -- 0:01:11 90000 -- (-1626.808) (-1628.060) (-1633.351) [-1634.137] * (-1632.043) (-1634.199) [-1628.480] (-1630.546) -- 0:01:10 Average standard deviation of split frequencies: 0.021071 90500 -- (-1630.322) [-1629.764] (-1633.158) (-1631.713) * (-1628.129) (-1631.587) [-1630.307] (-1631.095) -- 0:01:10 91000 -- (-1628.266) (-1629.484) [-1632.449] (-1629.825) * (-1628.917) (-1631.845) [-1628.507] (-1629.480) -- 0:01:09 91500 -- (-1627.929) [-1630.005] (-1635.491) (-1635.140) * (-1632.528) (-1631.745) [-1632.327] (-1631.598) -- 0:01:09 92000 -- (-1625.378) (-1631.622) (-1631.741) [-1628.605] * (-1627.366) (-1631.771) (-1635.155) [-1628.281] -- 0:01:09 92500 -- (-1629.883) [-1628.801] (-1631.084) (-1632.522) * (-1628.812) [-1631.675] (-1628.778) (-1631.979) -- 0:01:08 93000 -- (-1629.370) (-1627.333) (-1630.643) [-1632.793] * (-1632.986) (-1630.258) [-1628.361] (-1632.059) -- 0:01:08 93500 -- (-1627.439) [-1629.344] (-1635.159) (-1628.149) * (-1633.199) (-1630.289) [-1624.101] (-1635.699) -- 0:01:07 94000 -- [-1625.016] (-1628.116) (-1632.122) (-1633.047) * [-1627.768] (-1630.826) (-1637.231) (-1630.805) -- 0:01:07 94500 -- (-1626.392) (-1631.412) (-1633.891) [-1631.813] * (-1633.956) (-1630.632) [-1628.921] (-1629.866) -- 0:01:07 95000 -- (-1628.559) (-1629.447) (-1627.867) [-1631.441] * (-1629.516) (-1635.508) [-1636.566] (-1629.915) -- 0:01:06 Average standard deviation of split frequencies: 0.022743 95500 -- [-1628.437] (-1629.942) (-1630.027) (-1633.426) * (-1629.078) [-1632.921] (-1641.221) (-1630.729) -- 0:01:06 96000 -- (-1631.330) (-1627.587) [-1629.832] (-1629.822) * [-1628.634] (-1629.977) (-1630.791) (-1629.587) -- 0:01:05 96500 -- (-1632.231) [-1630.368] (-1634.809) (-1629.711) * (-1626.298) [-1629.722] (-1640.929) (-1627.703) -- 0:01:05 97000 -- (-1629.438) [-1629.773] (-1633.655) (-1627.925) * (-1629.216) (-1631.400) (-1628.906) [-1630.796] -- 0:01:05 97500 -- [-1627.303] (-1630.939) (-1631.370) (-1631.010) * [-1630.101] (-1632.052) (-1624.980) (-1626.125) -- 0:01:04 98000 -- (-1630.506) (-1633.678) [-1632.879] (-1629.759) * [-1629.750] (-1631.270) (-1627.600) (-1628.829) -- 0:01:04 98500 -- [-1627.837] (-1633.685) (-1628.860) (-1631.746) * (-1630.896) (-1632.675) (-1630.855) [-1626.798] -- 0:01:04 99000 -- (-1627.444) (-1632.466) [-1629.393] (-1629.519) * (-1632.473) (-1630.925) [-1628.219] (-1629.225) -- 0:01:03 99500 -- (-1629.226) [-1633.877] (-1631.494) (-1628.418) * (-1630.823) (-1627.509) [-1626.825] (-1628.639) -- 0:01:03 100000 -- (-1632.042) (-1633.074) (-1631.233) [-1629.585] * (-1629.980) (-1631.479) [-1629.320] (-1633.188) -- 0:01:02 Average standard deviation of split frequencies: 0.025287 100500 -- [-1627.874] (-1627.579) (-1631.828) (-1628.907) * (-1630.209) (-1629.265) [-1630.422] (-1629.567) -- 0:01:02 101000 -- (-1630.281) [-1630.874] (-1627.852) (-1632.404) * (-1627.071) [-1628.363] (-1631.988) (-1632.929) -- 0:01:02 101500 -- (-1629.632) (-1634.447) [-1629.704] (-1627.531) * (-1629.305) (-1628.865) (-1634.193) [-1627.778] -- 0:01:01 102000 -- (-1627.451) (-1636.223) [-1627.319] (-1631.430) * (-1629.884) (-1629.768) (-1629.282) [-1627.732] -- 0:01:01 102500 -- (-1625.695) [-1631.031] (-1626.602) (-1632.002) * (-1627.968) (-1627.624) [-1632.550] (-1629.264) -- 0:01:01 103000 -- [-1629.900] (-1629.959) (-1625.392) (-1640.673) * (-1628.697) (-1627.350) [-1632.708] (-1630.007) -- 0:01:00 103500 -- (-1631.338) (-1630.922) [-1626.073] (-1626.919) * (-1628.349) [-1630.137] (-1630.564) (-1629.596) -- 0:01:09 104000 -- [-1630.638] (-1630.459) (-1631.840) (-1626.720) * [-1629.177] (-1630.994) (-1628.069) (-1634.688) -- 0:01:08 104500 -- (-1632.484) (-1631.598) (-1627.820) [-1631.554] * (-1630.556) (-1628.016) [-1628.890] (-1633.106) -- 0:01:08 105000 -- (-1627.597) [-1628.330] (-1629.900) (-1630.214) * (-1626.947) (-1632.001) [-1629.547] (-1631.725) -- 0:01:08 Average standard deviation of split frequencies: 0.023793 105500 -- (-1627.796) (-1629.721) [-1629.609] (-1632.461) * (-1628.197) (-1631.174) [-1629.006] (-1632.058) -- 0:01:07 106000 -- (-1628.159) (-1628.396) (-1629.875) [-1629.762] * (-1630.683) (-1631.573) (-1633.194) [-1632.596] -- 0:01:07 106500 -- [-1629.930] (-1628.851) (-1632.629) (-1628.384) * [-1632.560] (-1634.358) (-1631.907) (-1631.840) -- 0:01:07 107000 -- (-1627.883) (-1629.425) [-1629.353] (-1627.099) * (-1629.527) (-1631.076) (-1632.585) [-1632.299] -- 0:01:06 107500 -- (-1627.444) (-1628.597) [-1628.467] (-1632.188) * [-1627.626] (-1627.953) (-1633.419) (-1631.801) -- 0:01:06 108000 -- [-1629.211] (-1630.205) (-1628.959) (-1629.400) * (-1627.599) (-1627.785) [-1636.509] (-1630.453) -- 0:01:06 108500 -- (-1635.230) (-1630.261) [-1628.378] (-1628.990) * (-1626.705) [-1628.538] (-1635.299) (-1632.293) -- 0:01:05 109000 -- (-1632.709) (-1630.693) (-1632.801) [-1628.379] * (-1629.012) (-1633.528) [-1625.350] (-1631.044) -- 0:01:05 109500 -- (-1630.357) (-1630.129) (-1630.972) [-1627.167] * [-1626.226] (-1635.130) (-1633.866) (-1629.419) -- 0:01:05 110000 -- (-1628.062) (-1630.822) [-1627.529] (-1630.467) * (-1628.629) (-1630.541) (-1629.859) [-1631.287] -- 0:01:04 Average standard deviation of split frequencies: 0.021937 110500 -- (-1630.220) [-1628.787] (-1629.713) (-1630.273) * [-1629.521] (-1629.752) (-1630.550) (-1630.216) -- 0:01:04 111000 -- (-1628.291) (-1631.655) (-1626.681) [-1628.630] * (-1629.426) (-1630.556) [-1627.371] (-1630.248) -- 0:01:04 111500 -- (-1630.259) (-1632.124) [-1627.836] (-1630.201) * (-1628.550) (-1629.648) [-1626.401] (-1630.571) -- 0:01:03 112000 -- (-1628.082) (-1630.367) (-1626.947) [-1632.243] * (-1628.227) [-1630.237] (-1625.729) (-1631.006) -- 0:01:03 112500 -- (-1628.361) [-1631.987] (-1630.068) (-1631.371) * (-1628.832) (-1629.400) (-1629.460) [-1632.166] -- 0:01:03 113000 -- (-1628.017) (-1633.776) (-1642.714) [-1627.316] * (-1628.822) (-1630.967) [-1629.397] (-1632.806) -- 0:01:02 113500 -- (-1631.560) (-1631.411) (-1629.033) [-1629.228] * (-1627.705) (-1631.661) [-1632.805] (-1632.918) -- 0:01:02 114000 -- (-1630.276) (-1630.648) [-1627.070] (-1627.905) * (-1628.193) [-1632.102] (-1629.808) (-1631.468) -- 0:01:02 114500 -- (-1628.921) (-1629.484) [-1629.055] (-1630.580) * [-1628.287] (-1630.461) (-1638.207) (-1632.271) -- 0:01:01 115000 -- (-1634.409) (-1633.675) (-1629.250) [-1631.382] * (-1633.688) [-1630.834] (-1631.978) (-1633.859) -- 0:01:01 Average standard deviation of split frequencies: 0.019506 115500 -- (-1632.836) (-1632.829) (-1625.712) [-1630.010] * (-1628.035) (-1629.971) [-1632.227] (-1631.207) -- 0:01:01 116000 -- [-1632.079] (-1630.556) (-1628.133) (-1635.620) * (-1627.493) (-1630.599) (-1630.806) [-1631.397] -- 0:01:00 116500 -- (-1634.448) (-1627.344) [-1628.017] (-1631.083) * (-1627.616) (-1630.297) [-1629.469] (-1627.886) -- 0:01:00 117000 -- [-1630.958] (-1629.082) (-1628.175) (-1632.703) * (-1628.553) (-1630.487) (-1638.856) [-1628.807] -- 0:01:00 117500 -- (-1628.182) (-1628.191) [-1625.817] (-1632.639) * (-1629.864) (-1630.267) [-1635.438] (-1631.495) -- 0:01:00 118000 -- (-1633.498) (-1630.587) (-1628.981) [-1633.517] * (-1628.002) (-1629.394) (-1630.137) [-1631.078] -- 0:01:07 118500 -- (-1628.876) (-1633.888) [-1627.024] (-1633.292) * (-1631.784) (-1632.132) [-1629.149] (-1630.470) -- 0:01:06 119000 -- (-1629.973) [-1629.413] (-1631.625) (-1633.946) * (-1630.724) (-1633.443) [-1627.130] (-1628.644) -- 0:01:06 119500 -- (-1629.224) [-1628.711] (-1632.500) (-1630.190) * (-1629.632) (-1631.394) [-1628.282] (-1632.028) -- 0:01:06 120000 -- (-1632.757) [-1627.262] (-1626.232) (-1634.191) * [-1628.329] (-1632.042) (-1630.785) (-1630.779) -- 0:01:06 Average standard deviation of split frequencies: 0.019945 120500 -- (-1632.116) (-1628.996) (-1628.024) [-1631.821] * (-1633.971) (-1629.610) (-1632.369) [-1635.113] -- 0:01:05 121000 -- [-1628.819] (-1629.614) (-1627.314) (-1629.626) * (-1631.532) (-1632.333) [-1627.202] (-1631.047) -- 0:01:05 121500 -- (-1627.391) [-1626.607] (-1628.768) (-1630.421) * [-1630.697] (-1632.580) (-1633.771) (-1633.072) -- 0:01:05 122000 -- (-1630.406) (-1628.596) [-1625.337] (-1631.856) * [-1626.594] (-1631.754) (-1633.227) (-1634.560) -- 0:01:04 122500 -- (-1628.331) (-1627.881) [-1627.722] (-1630.231) * (-1626.311) (-1633.997) [-1625.343] (-1631.967) -- 0:01:04 123000 -- (-1627.298) (-1626.573) [-1628.702] (-1631.529) * (-1628.044) (-1633.077) [-1624.062] (-1631.965) -- 0:01:04 123500 -- (-1631.027) [-1627.371] (-1627.854) (-1630.107) * (-1626.238) (-1635.281) [-1622.916] (-1632.102) -- 0:01:03 124000 -- (-1630.235) (-1628.594) [-1628.431] (-1628.168) * [-1627.486] (-1635.156) (-1630.320) (-1626.892) -- 0:01:03 124500 -- (-1627.335) (-1629.050) (-1630.997) [-1627.696] * [-1628.846] (-1630.413) (-1634.318) (-1632.560) -- 0:01:03 125000 -- [-1629.824] (-1631.229) (-1628.339) (-1632.258) * (-1630.267) [-1631.023] (-1634.315) (-1630.708) -- 0:01:03 Average standard deviation of split frequencies: 0.018903 125500 -- (-1630.467) [-1627.999] (-1628.115) (-1627.968) * (-1627.888) (-1628.641) (-1625.038) [-1628.237] -- 0:01:02 126000 -- (-1628.332) [-1628.640] (-1629.381) (-1633.533) * (-1626.372) (-1627.772) [-1626.071] (-1628.842) -- 0:01:02 126500 -- (-1630.455) (-1627.544) [-1628.919] (-1634.163) * (-1629.689) [-1629.856] (-1626.491) (-1631.088) -- 0:01:02 127000 -- (-1628.516) [-1626.426] (-1629.788) (-1631.245) * (-1629.108) (-1627.109) (-1631.869) [-1630.596] -- 0:01:01 127500 -- (-1628.228) (-1629.028) [-1626.653] (-1631.059) * (-1632.363) [-1628.698] (-1631.245) (-1632.555) -- 0:01:01 128000 -- (-1627.300) [-1627.923] (-1627.248) (-1632.497) * [-1630.945] (-1630.412) (-1637.987) (-1633.534) -- 0:01:01 128500 -- [-1628.233] (-1629.174) (-1631.897) (-1641.259) * (-1632.929) [-1630.455] (-1635.284) (-1633.817) -- 0:01:01 129000 -- [-1628.685] (-1628.938) (-1634.155) (-1632.009) * (-1630.431) (-1627.572) (-1626.238) [-1631.966] -- 0:01:00 129500 -- (-1629.556) [-1632.212] (-1631.969) (-1631.538) * (-1629.389) [-1627.919] (-1634.742) (-1633.057) -- 0:01:00 130000 -- (-1628.446) (-1632.091) [-1627.859] (-1631.395) * (-1630.649) (-1628.603) (-1629.561) [-1629.344] -- 0:01:00 Average standard deviation of split frequencies: 0.016956 130500 -- (-1631.989) (-1629.215) [-1626.711] (-1630.350) * (-1632.261) [-1628.043] (-1626.134) (-1632.766) -- 0:00:59 131000 -- (-1629.152) (-1630.376) [-1628.879] (-1627.027) * (-1630.364) [-1627.212] (-1628.067) (-1631.394) -- 0:00:59 131500 -- [-1628.868] (-1629.776) (-1627.438) (-1629.116) * (-1633.575) (-1630.000) [-1629.942] (-1633.185) -- 0:00:59 132000 -- (-1628.454) (-1628.124) (-1631.701) [-1629.298] * (-1633.382) [-1630.485] (-1636.406) (-1630.504) -- 0:00:59 132500 -- (-1628.856) (-1630.127) [-1631.162] (-1630.066) * (-1634.577) [-1629.330] (-1627.548) (-1632.515) -- 0:01:05 133000 -- (-1629.822) (-1628.516) (-1627.798) [-1629.479] * (-1632.135) (-1628.480) [-1632.333] (-1633.179) -- 0:01:05 133500 -- [-1631.044] (-1631.988) (-1627.102) (-1631.404) * (-1633.532) [-1628.108] (-1639.749) (-1632.124) -- 0:01:04 134000 -- (-1631.529) (-1632.569) [-1628.202] (-1629.112) * [-1628.897] (-1631.045) (-1627.318) (-1635.025) -- 0:01:04 134500 -- [-1629.722] (-1633.729) (-1628.708) (-1633.542) * (-1629.186) (-1629.413) [-1626.827] (-1630.158) -- 0:01:04 135000 -- (-1628.472) (-1632.567) [-1629.559] (-1631.840) * (-1631.352) (-1631.977) [-1627.728] (-1631.949) -- 0:01:04 Average standard deviation of split frequencies: 0.017331 135500 -- (-1629.968) (-1632.244) [-1629.378] (-1635.420) * (-1632.214) (-1634.786) [-1631.458] (-1630.651) -- 0:01:03 136000 -- (-1631.027) [-1629.231] (-1630.903) (-1633.349) * (-1632.229) (-1631.742) [-1631.227] (-1631.747) -- 0:01:03 136500 -- [-1628.780] (-1633.756) (-1629.469) (-1630.970) * (-1631.214) (-1630.693) [-1627.342] (-1635.494) -- 0:01:03 137000 -- [-1628.731] (-1630.035) (-1628.730) (-1634.857) * (-1628.078) (-1630.149) [-1631.289] (-1633.188) -- 0:01:02 137500 -- (-1637.792) [-1631.245] (-1632.023) (-1632.191) * [-1629.630] (-1631.989) (-1630.108) (-1634.100) -- 0:01:02 138000 -- (-1634.519) [-1632.735] (-1630.985) (-1631.253) * (-1629.160) (-1631.605) [-1627.874] (-1631.216) -- 0:01:02 138500 -- (-1633.234) [-1627.380] (-1630.962) (-1629.632) * (-1630.559) (-1631.774) [-1627.981] (-1630.976) -- 0:01:02 139000 -- (-1634.473) (-1629.253) (-1629.258) [-1626.991] * (-1630.596) (-1634.219) [-1631.305] (-1629.494) -- 0:01:01 139500 -- (-1627.948) (-1632.477) [-1629.366] (-1633.261) * (-1629.406) [-1628.077] (-1629.868) (-1631.471) -- 0:01:01 140000 -- (-1630.884) (-1632.907) (-1629.800) [-1628.523] * (-1630.831) (-1631.560) (-1629.959) [-1630.625] -- 0:01:01 Average standard deviation of split frequencies: 0.016756 140500 -- (-1630.051) (-1632.584) (-1629.694) [-1627.683] * [-1629.921] (-1632.173) (-1627.829) (-1633.241) -- 0:01:01 141000 -- (-1626.657) (-1630.443) [-1631.833] (-1629.410) * (-1631.290) (-1631.480) [-1634.167] (-1634.936) -- 0:01:00 141500 -- (-1630.758) (-1631.171) (-1628.388) [-1626.898] * (-1630.198) [-1630.309] (-1632.416) (-1638.343) -- 0:01:00 142000 -- (-1629.718) (-1632.032) (-1630.081) [-1626.498] * (-1631.858) [-1627.019] (-1632.259) (-1635.888) -- 0:01:00 142500 -- (-1627.992) (-1632.774) (-1627.500) [-1629.335] * (-1628.863) (-1630.342) [-1628.736] (-1632.394) -- 0:01:00 143000 -- (-1628.925) (-1636.424) (-1628.186) [-1627.489] * [-1628.747] (-1631.853) (-1631.077) (-1631.912) -- 0:00:59 143500 -- [-1630.290] (-1634.248) (-1633.573) (-1627.524) * [-1627.996] (-1629.591) (-1634.526) (-1630.032) -- 0:00:59 144000 -- (-1629.291) (-1635.892) (-1635.906) [-1628.732] * (-1626.878) (-1634.625) [-1631.149] (-1629.352) -- 0:00:59 144500 -- [-1627.055] (-1629.474) (-1635.279) (-1627.215) * (-1627.313) (-1628.708) [-1631.278] (-1629.403) -- 0:00:59 145000 -- (-1630.694) (-1631.377) (-1635.866) [-1628.943] * (-1629.737) [-1628.547] (-1633.111) (-1632.343) -- 0:00:58 Average standard deviation of split frequencies: 0.015990 145500 -- [-1629.725] (-1632.946) (-1634.530) (-1626.030) * [-1628.403] (-1627.054) (-1629.228) (-1629.711) -- 0:00:58 146000 -- (-1627.271) (-1631.492) [-1634.474] (-1627.799) * [-1631.504] (-1627.753) (-1634.718) (-1628.574) -- 0:00:58 146500 -- (-1630.734) (-1630.876) [-1631.770] (-1628.856) * (-1628.065) (-1637.821) (-1627.746) [-1628.079] -- 0:01:04 147000 -- (-1633.986) (-1631.458) [-1627.904] (-1624.417) * [-1628.055] (-1627.505) (-1633.188) (-1631.121) -- 0:01:03 147500 -- [-1629.890] (-1629.923) (-1629.641) (-1632.535) * (-1626.637) (-1627.685) [-1627.929] (-1629.979) -- 0:01:03 148000 -- (-1630.392) [-1632.985] (-1628.521) (-1625.066) * [-1631.108] (-1629.412) (-1628.526) (-1629.189) -- 0:01:03 148500 -- [-1630.361] (-1632.284) (-1629.936) (-1626.278) * [-1628.462] (-1628.156) (-1628.484) (-1629.877) -- 0:01:03 149000 -- [-1629.686] (-1632.065) (-1629.998) (-1628.328) * (-1629.532) (-1628.361) (-1629.218) [-1629.453] -- 0:01:02 149500 -- (-1627.875) (-1631.864) [-1629.707] (-1625.906) * (-1629.762) (-1630.554) [-1628.750] (-1630.677) -- 0:01:02 150000 -- (-1626.756) (-1634.510) [-1629.669] (-1628.963) * (-1630.656) [-1630.145] (-1633.252) (-1635.050) -- 0:01:02 Average standard deviation of split frequencies: 0.015809 150500 -- [-1626.831] (-1631.682) (-1630.699) (-1633.648) * (-1628.144) (-1628.381) (-1628.174) [-1632.513] -- 0:01:02 151000 -- [-1628.480] (-1636.835) (-1634.579) (-1626.544) * [-1631.712] (-1630.182) (-1631.990) (-1629.418) -- 0:01:01 151500 -- (-1629.732) (-1633.901) (-1636.430) [-1627.016] * [-1633.270] (-1629.689) (-1630.938) (-1630.941) -- 0:01:01 152000 -- (-1627.440) (-1636.982) [-1629.229] (-1627.387) * (-1631.916) (-1627.583) (-1632.141) [-1628.749] -- 0:01:01 152500 -- (-1627.105) (-1627.840) (-1631.600) [-1631.727] * (-1630.126) [-1625.844] (-1631.906) (-1627.875) -- 0:01:01 153000 -- [-1626.950] (-1630.246) (-1627.767) (-1630.028) * [-1633.525] (-1632.359) (-1635.422) (-1627.398) -- 0:01:00 153500 -- (-1636.578) [-1629.801] (-1630.764) (-1631.884) * [-1628.836] (-1631.528) (-1634.796) (-1630.455) -- 0:01:00 154000 -- (-1627.698) [-1628.973] (-1633.322) (-1629.157) * (-1632.533) [-1628.699] (-1632.406) (-1633.251) -- 0:01:00 154500 -- (-1626.488) (-1631.171) (-1631.098) [-1628.769] * [-1632.850] (-1632.198) (-1629.832) (-1630.263) -- 0:01:00 155000 -- (-1629.861) (-1631.236) (-1630.996) [-1630.805] * (-1635.253) (-1632.670) [-1631.076] (-1628.214) -- 0:00:59 Average standard deviation of split frequencies: 0.013262 155500 -- (-1626.082) (-1630.974) [-1630.131] (-1630.106) * (-1632.997) (-1627.284) (-1628.738) [-1627.118] -- 0:00:59 156000 -- (-1630.018) (-1631.235) (-1628.483) [-1627.442] * (-1631.944) (-1630.803) [-1630.402] (-1629.329) -- 0:00:59 156500 -- (-1627.107) (-1630.762) (-1628.736) [-1632.224] * (-1630.661) [-1625.153] (-1631.164) (-1628.683) -- 0:00:59 157000 -- [-1628.659] (-1629.370) (-1629.790) (-1629.198) * (-1634.064) [-1627.138] (-1629.297) (-1630.406) -- 0:00:59 157500 -- (-1629.919) (-1631.684) [-1628.610] (-1632.701) * (-1632.051) [-1628.334] (-1631.621) (-1628.295) -- 0:00:58 158000 -- (-1629.663) (-1629.717) [-1630.592] (-1628.328) * [-1632.656] (-1627.953) (-1629.116) (-1631.551) -- 0:00:58 158500 -- (-1627.269) (-1637.447) (-1631.775) [-1626.647] * [-1629.052] (-1629.231) (-1631.417) (-1627.988) -- 0:00:58 159000 -- (-1627.547) (-1631.901) (-1632.563) [-1628.182] * (-1639.519) [-1626.363] (-1633.307) (-1631.760) -- 0:00:58 159500 -- (-1629.788) (-1628.175) (-1631.069) [-1628.825] * (-1632.157) (-1631.681) [-1633.768] (-1627.997) -- 0:00:57 160000 -- (-1628.605) (-1628.453) [-1630.533] (-1627.751) * (-1631.227) (-1632.131) [-1629.828] (-1634.961) -- 0:00:57 Average standard deviation of split frequencies: 0.014053 160500 -- (-1629.887) (-1629.872) [-1628.462] (-1627.516) * (-1631.331) (-1631.687) [-1634.464] (-1631.468) -- 0:00:57 161000 -- [-1624.130] (-1632.176) (-1630.184) (-1627.845) * (-1626.963) (-1635.573) (-1631.070) [-1627.931] -- 0:01:02 161500 -- [-1629.384] (-1631.848) (-1628.669) (-1631.664) * (-1629.041) (-1633.836) (-1630.543) [-1629.248] -- 0:01:02 162000 -- (-1627.461) (-1629.697) (-1632.049) [-1630.118] * (-1629.634) [-1628.586] (-1632.346) (-1626.950) -- 0:01:02 162500 -- (-1627.276) (-1631.573) (-1630.731) [-1631.557] * (-1625.825) [-1630.409] (-1632.186) (-1632.910) -- 0:01:01 163000 -- (-1630.491) (-1631.167) [-1628.619] (-1627.818) * (-1630.553) (-1628.758) (-1636.151) [-1626.672] -- 0:01:01 163500 -- (-1627.239) [-1627.110] (-1629.786) (-1625.884) * (-1626.602) (-1625.988) [-1631.866] (-1628.805) -- 0:01:01 164000 -- (-1631.075) [-1627.820] (-1633.612) (-1630.274) * [-1625.351] (-1629.738) (-1632.015) (-1629.649) -- 0:01:01 164500 -- [-1627.975] (-1629.352) (-1632.786) (-1629.903) * [-1627.124] (-1626.432) (-1629.686) (-1631.746) -- 0:01:00 165000 -- (-1628.033) [-1628.398] (-1632.790) (-1627.147) * [-1626.717] (-1626.044) (-1629.862) (-1633.421) -- 0:01:00 Average standard deviation of split frequencies: 0.011927 165500 -- [-1628.051] (-1627.229) (-1631.833) (-1632.570) * (-1628.319) [-1629.304] (-1629.036) (-1629.538) -- 0:01:00 166000 -- [-1629.158] (-1628.161) (-1634.940) (-1631.049) * (-1628.416) (-1633.587) [-1629.743] (-1626.364) -- 0:01:00 166500 -- (-1626.151) [-1629.530] (-1636.358) (-1634.412) * (-1630.985) (-1628.540) (-1629.967) [-1628.500] -- 0:01:00 167000 -- (-1627.405) (-1626.982) [-1630.380] (-1630.136) * (-1627.077) (-1627.840) [-1630.253] (-1629.076) -- 0:00:59 167500 -- (-1627.593) (-1631.093) [-1631.447] (-1629.375) * (-1633.028) (-1628.022) (-1631.760) [-1629.744] -- 0:00:59 168000 -- (-1627.749) (-1627.319) (-1632.579) [-1626.979] * [-1625.364] (-1628.664) (-1631.266) (-1626.358) -- 0:00:59 168500 -- (-1631.176) (-1627.437) (-1631.557) [-1627.229] * (-1626.546) (-1625.362) (-1630.971) [-1629.322] -- 0:00:59 169000 -- [-1630.064] (-1628.395) (-1633.843) (-1627.206) * [-1627.000] (-1627.317) (-1627.864) (-1632.313) -- 0:00:59 169500 -- (-1627.329) (-1628.684) (-1632.374) [-1627.389] * (-1625.696) (-1626.271) [-1630.503] (-1628.384) -- 0:00:58 170000 -- [-1626.791] (-1631.194) (-1631.648) (-1626.709) * [-1627.461] (-1626.180) (-1632.133) (-1628.805) -- 0:00:58 Average standard deviation of split frequencies: 0.013811 170500 -- [-1630.481] (-1628.292) (-1634.218) (-1626.280) * [-1629.140] (-1629.073) (-1632.161) (-1630.848) -- 0:00:58 171000 -- [-1628.997] (-1631.514) (-1634.032) (-1628.218) * (-1628.222) (-1625.854) (-1631.496) [-1636.037] -- 0:00:58 171500 -- [-1630.073] (-1627.217) (-1631.664) (-1630.650) * (-1629.613) [-1625.170] (-1629.593) (-1632.418) -- 0:00:57 172000 -- (-1629.381) [-1627.343] (-1629.248) (-1627.131) * [-1626.711] (-1631.473) (-1630.636) (-1634.255) -- 0:00:57 172500 -- [-1626.841] (-1626.597) (-1631.304) (-1627.875) * [-1628.014] (-1627.250) (-1630.304) (-1633.138) -- 0:00:57 173000 -- [-1629.405] (-1627.685) (-1632.234) (-1628.811) * (-1629.415) (-1626.385) (-1632.472) [-1631.847] -- 0:00:57 173500 -- [-1628.389] (-1629.390) (-1632.457) (-1627.055) * (-1630.074) (-1628.301) (-1630.595) [-1626.173] -- 0:00:57 174000 -- [-1628.480] (-1627.459) (-1631.306) (-1627.400) * (-1625.948) [-1632.191] (-1637.782) (-1628.914) -- 0:00:56 174500 -- [-1626.621] (-1635.630) (-1635.678) (-1627.167) * (-1628.177) (-1627.094) (-1634.187) [-1628.896] -- 0:00:56 175000 -- (-1629.744) (-1632.749) (-1634.933) [-1626.214] * (-1629.646) [-1627.471] (-1633.283) (-1631.959) -- 0:00:56 Average standard deviation of split frequencies: 0.013815 175500 -- (-1627.762) [-1627.502] (-1638.079) (-1630.587) * (-1628.063) [-1627.469] (-1631.168) (-1631.042) -- 0:01:01 176000 -- (-1626.243) [-1627.078] (-1632.194) (-1627.693) * [-1628.099] (-1630.478) (-1633.124) (-1629.617) -- 0:01:00 176500 -- (-1626.608) (-1631.464) [-1630.998] (-1626.946) * (-1632.091) (-1626.702) (-1631.697) [-1627.130] -- 0:01:00 177000 -- [-1627.283] (-1627.276) (-1634.365) (-1628.556) * (-1630.362) [-1627.392] (-1633.397) (-1624.615) -- 0:01:00 177500 -- [-1624.873] (-1629.479) (-1635.272) (-1632.694) * (-1631.900) [-1628.914] (-1633.372) (-1628.167) -- 0:01:00 178000 -- (-1627.996) (-1626.686) (-1628.596) [-1629.024] * [-1632.917] (-1628.536) (-1630.497) (-1629.344) -- 0:01:00 178500 -- [-1628.125] (-1626.681) (-1629.671) (-1627.146) * (-1634.503) [-1628.095] (-1627.132) (-1627.929) -- 0:00:59 179000 -- (-1629.841) [-1627.357] (-1630.975) (-1629.550) * (-1630.571) [-1628.927] (-1632.082) (-1630.209) -- 0:00:59 179500 -- (-1627.791) (-1626.819) [-1631.127] (-1631.928) * (-1631.378) [-1627.510] (-1633.668) (-1629.578) -- 0:00:59 180000 -- (-1628.915) (-1628.595) (-1631.886) [-1628.084] * (-1628.017) (-1628.559) (-1633.860) [-1627.211] -- 0:00:59 Average standard deviation of split frequencies: 0.012394 180500 -- (-1627.475) (-1628.769) [-1634.303] (-1628.371) * [-1629.847] (-1626.649) (-1626.979) (-1632.537) -- 0:00:59 181000 -- (-1628.424) (-1628.110) [-1626.348] (-1627.358) * (-1631.629) (-1627.548) [-1627.340] (-1631.312) -- 0:00:58 181500 -- (-1631.938) (-1627.005) [-1627.865] (-1630.325) * (-1632.396) (-1628.198) (-1630.646) [-1626.221] -- 0:00:58 182000 -- (-1627.976) (-1634.285) (-1628.735) [-1627.886] * (-1631.005) [-1627.531] (-1631.380) (-1625.796) -- 0:00:58 182500 -- [-1629.479] (-1626.641) (-1627.856) (-1630.131) * (-1628.564) (-1632.678) [-1626.474] (-1633.440) -- 0:00:58 183000 -- (-1629.679) (-1632.331) [-1626.684] (-1627.199) * (-1629.052) [-1629.054] (-1628.945) (-1627.444) -- 0:00:58 183500 -- (-1627.301) [-1631.167] (-1634.803) (-1626.706) * (-1629.906) [-1627.942] (-1627.891) (-1629.314) -- 0:00:57 184000 -- (-1627.571) (-1634.605) [-1628.112] (-1627.249) * (-1632.167) (-1627.653) [-1628.253] (-1627.844) -- 0:00:57 184500 -- (-1629.668) [-1625.987] (-1631.366) (-1629.289) * (-1631.835) (-1628.574) [-1628.305] (-1629.716) -- 0:00:57 185000 -- (-1632.256) [-1628.553] (-1630.865) (-1626.592) * (-1627.849) (-1626.514) (-1630.798) [-1630.460] -- 0:00:57 Average standard deviation of split frequencies: 0.013179 185500 -- (-1632.822) (-1626.931) (-1632.701) [-1625.347] * (-1632.724) (-1626.933) [-1629.382] (-1626.375) -- 0:00:57 186000 -- (-1627.380) (-1628.050) (-1632.026) [-1628.914] * (-1637.279) (-1628.405) (-1628.373) [-1627.148] -- 0:00:56 186500 -- [-1628.969] (-1628.711) (-1628.857) (-1627.760) * (-1626.619) (-1626.966) (-1629.384) [-1626.811] -- 0:00:56 187000 -- [-1629.063] (-1626.198) (-1630.882) (-1631.391) * (-1629.877) (-1630.369) [-1626.507] (-1627.736) -- 0:00:56 187500 -- (-1632.858) (-1626.942) (-1628.956) [-1629.901] * (-1629.201) [-1626.340] (-1628.028) (-1631.070) -- 0:00:56 188000 -- (-1626.937) [-1630.517] (-1628.946) (-1630.957) * (-1627.529) (-1630.504) [-1628.838] (-1633.055) -- 0:00:56 188500 -- (-1625.816) [-1630.337] (-1628.379) (-1630.842) * (-1630.954) (-1632.188) [-1627.682] (-1630.976) -- 0:00:55 189000 -- [-1626.337] (-1628.676) (-1632.607) (-1630.636) * (-1629.843) (-1634.070) [-1626.762] (-1631.403) -- 0:00:55 189500 -- (-1626.298) [-1626.103] (-1629.776) (-1629.750) * (-1630.321) (-1638.933) (-1629.464) [-1628.959] -- 0:00:59 190000 -- (-1631.300) (-1628.967) (-1630.831) [-1627.343] * (-1628.409) [-1626.412] (-1628.274) (-1628.274) -- 0:00:59 Average standard deviation of split frequencies: 0.013539 190500 -- (-1627.150) (-1625.923) (-1639.871) [-1627.412] * (-1630.024) (-1630.183) [-1629.856] (-1625.728) -- 0:00:59 191000 -- [-1625.977] (-1628.334) (-1636.461) (-1626.755) * (-1627.577) [-1628.340] (-1633.688) (-1627.671) -- 0:00:59 191500 -- (-1629.150) (-1625.939) (-1631.837) [-1625.626] * [-1628.414] (-1630.659) (-1630.910) (-1629.400) -- 0:00:59 192000 -- [-1628.285] (-1625.950) (-1634.143) (-1630.376) * (-1630.701) (-1630.014) (-1627.984) [-1631.167] -- 0:00:58 192500 -- (-1627.163) [-1625.183] (-1633.224) (-1629.054) * (-1626.234) (-1631.730) (-1628.289) [-1631.019] -- 0:00:58 193000 -- (-1628.267) (-1627.262) [-1632.737] (-1634.806) * (-1631.772) (-1631.206) (-1628.150) [-1627.297] -- 0:00:58 193500 -- (-1627.278) (-1628.994) (-1629.814) [-1633.375] * (-1630.508) [-1626.089] (-1632.092) (-1633.761) -- 0:00:58 194000 -- (-1628.573) (-1629.034) [-1634.362] (-1628.746) * (-1630.246) (-1627.848) [-1632.697] (-1633.406) -- 0:00:58 194500 -- [-1630.029] (-1634.335) (-1629.966) (-1632.759) * [-1633.076] (-1629.674) (-1629.257) (-1638.085) -- 0:00:57 195000 -- (-1629.441) [-1631.988] (-1634.455) (-1631.096) * (-1631.717) (-1631.025) [-1626.112] (-1632.704) -- 0:00:57 Average standard deviation of split frequencies: 0.013108 195500 -- (-1627.977) [-1630.075] (-1632.606) (-1630.519) * (-1629.362) [-1626.715] (-1635.129) (-1632.031) -- 0:00:57 196000 -- [-1626.005] (-1634.933) (-1632.044) (-1628.011) * (-1631.863) [-1628.800] (-1629.492) (-1631.254) -- 0:00:57 196500 -- (-1629.135) (-1629.297) (-1627.138) [-1628.054] * (-1630.526) (-1627.076) [-1627.260] (-1635.446) -- 0:00:57 197000 -- [-1629.436] (-1628.778) (-1632.831) (-1628.889) * (-1630.780) [-1627.916] (-1627.723) (-1640.590) -- 0:00:57 197500 -- [-1629.587] (-1630.095) (-1631.657) (-1629.965) * [-1629.773] (-1626.602) (-1631.843) (-1636.512) -- 0:00:56 198000 -- [-1628.920] (-1627.810) (-1631.452) (-1629.350) * (-1630.394) (-1626.848) [-1628.019] (-1635.326) -- 0:00:56 198500 -- [-1628.923] (-1626.773) (-1629.763) (-1629.296) * (-1628.768) (-1631.266) [-1625.888] (-1630.093) -- 0:00:56 199000 -- (-1632.473) [-1626.482] (-1630.359) (-1629.678) * [-1631.767] (-1627.716) (-1625.964) (-1629.667) -- 0:00:56 199500 -- (-1630.196) [-1630.816] (-1629.741) (-1631.569) * [-1630.737] (-1626.570) (-1626.077) (-1629.918) -- 0:00:56 200000 -- (-1632.568) [-1630.092] (-1630.585) (-1630.856) * (-1637.211) [-1627.943] (-1626.441) (-1629.487) -- 0:00:55 Average standard deviation of split frequencies: 0.011993 200500 -- (-1632.084) [-1627.848] (-1630.375) (-1634.111) * (-1635.802) (-1628.764) (-1627.579) [-1629.352] -- 0:00:55 201000 -- (-1628.658) (-1626.382) [-1629.145] (-1630.188) * (-1633.163) (-1626.642) [-1627.408] (-1632.055) -- 0:00:55 201500 -- (-1632.445) [-1627.840] (-1631.638) (-1628.080) * [-1632.022] (-1626.083) (-1628.980) (-1633.891) -- 0:00:55 202000 -- [-1629.054] (-1631.122) (-1633.073) (-1629.696) * (-1636.351) [-1627.912] (-1626.329) (-1630.418) -- 0:00:55 202500 -- (-1631.662) [-1630.609] (-1631.076) (-1630.343) * (-1634.701) [-1630.456] (-1629.199) (-1626.707) -- 0:00:55 203000 -- (-1628.700) (-1628.451) [-1628.510] (-1626.860) * (-1633.228) (-1626.622) (-1629.641) [-1628.846] -- 0:00:54 203500 -- (-1629.536) (-1628.207) [-1628.781] (-1627.810) * (-1632.981) (-1631.845) [-1628.226] (-1627.319) -- 0:00:54 204000 -- (-1628.442) [-1628.998] (-1629.545) (-1630.757) * (-1631.293) (-1627.649) (-1628.170) [-1628.962] -- 0:00:58 204500 -- [-1629.598] (-1628.247) (-1630.422) (-1628.861) * (-1630.671) [-1629.072] (-1630.524) (-1628.972) -- 0:00:58 205000 -- [-1631.541] (-1631.609) (-1630.304) (-1629.459) * [-1634.469] (-1628.354) (-1631.913) (-1633.400) -- 0:00:58 Average standard deviation of split frequencies: 0.012526 205500 -- (-1630.089) (-1629.420) (-1633.821) [-1633.270] * (-1630.742) (-1631.302) (-1628.011) [-1630.563] -- 0:00:57 206000 -- [-1628.525] (-1629.507) (-1629.877) (-1628.709) * (-1632.209) (-1634.002) [-1630.883] (-1633.407) -- 0:00:57 206500 -- (-1631.543) [-1629.681] (-1633.754) (-1631.027) * (-1636.855) (-1629.121) [-1627.526] (-1633.052) -- 0:00:57 207000 -- [-1628.983] (-1628.017) (-1629.051) (-1628.860) * (-1631.975) [-1628.198] (-1628.813) (-1635.118) -- 0:00:57 207500 -- (-1637.560) (-1628.628) (-1629.105) [-1630.739] * [-1627.521] (-1628.735) (-1630.243) (-1633.391) -- 0:00:57 208000 -- (-1636.029) [-1628.343] (-1630.218) (-1627.419) * (-1631.598) [-1627.354] (-1627.663) (-1633.850) -- 0:00:57 208500 -- (-1632.208) (-1634.196) [-1628.964] (-1628.311) * (-1632.908) (-1627.884) [-1628.569] (-1634.038) -- 0:00:56 209000 -- (-1628.819) (-1631.961) [-1630.016] (-1633.030) * (-1633.670) [-1631.300] (-1628.604) (-1629.996) -- 0:00:56 209500 -- (-1631.843) (-1633.231) (-1626.298) [-1633.175] * (-1630.535) (-1626.469) (-1626.685) [-1630.337] -- 0:00:56 210000 -- [-1632.533] (-1631.250) (-1630.647) (-1635.943) * (-1631.037) (-1635.389) (-1626.836) [-1636.061] -- 0:00:56 Average standard deviation of split frequencies: 0.012013 210500 -- [-1630.596] (-1630.780) (-1626.525) (-1635.640) * (-1629.451) (-1633.815) [-1631.265] (-1634.060) -- 0:00:56 211000 -- (-1629.051) (-1628.691) (-1628.383) [-1627.244] * (-1633.706) (-1629.998) (-1632.086) [-1629.721] -- 0:00:56 211500 -- (-1628.127) [-1630.795] (-1628.798) (-1629.755) * (-1631.486) (-1628.770) (-1631.042) [-1629.450] -- 0:00:55 212000 -- (-1627.801) (-1630.654) (-1631.285) [-1633.650] * (-1633.683) (-1626.939) [-1630.986] (-1630.383) -- 0:00:55 212500 -- [-1635.315] (-1630.440) (-1630.860) (-1635.096) * (-1630.906) [-1629.084] (-1628.061) (-1631.139) -- 0:00:55 213000 -- [-1630.414] (-1631.333) (-1626.379) (-1636.345) * (-1633.033) (-1628.563) [-1628.953] (-1630.704) -- 0:00:55 213500 -- (-1629.484) (-1628.819) [-1628.866] (-1637.525) * (-1633.172) (-1631.138) (-1629.243) [-1631.186] -- 0:00:55 214000 -- (-1628.875) [-1633.452] (-1631.886) (-1636.518) * (-1629.067) (-1629.387) (-1626.745) [-1631.952] -- 0:00:55 214500 -- [-1629.024] (-1630.773) (-1630.104) (-1634.049) * [-1629.181] (-1629.523) (-1628.150) (-1631.854) -- 0:00:54 215000 -- (-1632.345) [-1629.528] (-1630.848) (-1634.387) * (-1632.677) (-1630.838) (-1627.011) [-1628.579] -- 0:00:54 Average standard deviation of split frequencies: 0.011458 215500 -- [-1627.431] (-1627.263) (-1632.298) (-1634.104) * (-1631.206) (-1636.221) [-1626.338] (-1630.639) -- 0:00:54 216000 -- [-1629.770] (-1630.635) (-1627.912) (-1634.876) * (-1631.131) (-1631.660) [-1629.397] (-1631.467) -- 0:00:54 216500 -- [-1630.746] (-1632.213) (-1626.172) (-1636.171) * (-1631.864) [-1635.799] (-1630.878) (-1634.151) -- 0:00:54 217000 -- (-1632.417) (-1628.278) (-1627.559) [-1629.782] * (-1630.913) (-1626.922) (-1630.731) [-1631.479] -- 0:00:54 217500 -- (-1630.277) [-1627.050] (-1628.623) (-1629.373) * (-1629.821) (-1627.965) (-1634.102) [-1636.017] -- 0:00:53 218000 -- [-1629.632] (-1632.048) (-1629.864) (-1636.204) * (-1628.737) [-1629.481] (-1627.378) (-1632.198) -- 0:00:57 218500 -- (-1629.410) [-1629.459] (-1633.379) (-1629.400) * (-1628.717) (-1630.592) [-1630.999] (-1633.410) -- 0:00:57 219000 -- (-1629.279) (-1628.684) (-1629.700) [-1626.314] * (-1630.567) [-1632.028] (-1630.952) (-1633.018) -- 0:00:57 219500 -- [-1629.051] (-1628.254) (-1629.476) (-1629.241) * [-1632.157] (-1631.046) (-1627.903) (-1631.082) -- 0:00:56 220000 -- (-1628.033) (-1627.432) [-1629.695] (-1626.981) * (-1630.853) (-1631.335) [-1630.457] (-1630.318) -- 0:00:56 Average standard deviation of split frequencies: 0.010794 220500 -- (-1630.318) [-1628.192] (-1629.177) (-1627.893) * (-1631.222) (-1631.678) [-1630.282] (-1633.068) -- 0:00:56 221000 -- (-1631.585) [-1625.777] (-1632.436) (-1628.978) * (-1629.795) [-1630.081] (-1629.462) (-1628.851) -- 0:00:56 221500 -- (-1628.981) [-1626.614] (-1635.908) (-1631.779) * (-1627.058) (-1626.605) (-1629.161) [-1630.059] -- 0:00:56 222000 -- (-1627.902) [-1627.477] (-1628.693) (-1626.625) * (-1629.436) (-1628.870) (-1631.233) [-1628.691] -- 0:00:56 222500 -- (-1636.628) [-1630.706] (-1630.744) (-1630.174) * (-1630.270) [-1628.647] (-1631.249) (-1630.245) -- 0:00:55 223000 -- (-1629.134) (-1632.004) (-1627.612) [-1626.508] * [-1631.167] (-1629.168) (-1635.962) (-1628.624) -- 0:00:55 223500 -- (-1630.978) (-1636.748) [-1629.357] (-1625.600) * [-1630.663] (-1630.380) (-1630.820) (-1627.447) -- 0:00:55 224000 -- (-1630.172) (-1629.102) (-1628.002) [-1625.494] * (-1633.761) [-1627.076] (-1627.723) (-1628.980) -- 0:00:55 224500 -- (-1630.122) (-1628.445) (-1631.157) [-1628.564] * [-1633.098] (-1628.472) (-1629.461) (-1626.767) -- 0:00:55 225000 -- [-1631.194] (-1628.279) (-1629.481) (-1629.529) * (-1631.415) (-1628.906) [-1630.314] (-1633.422) -- 0:00:55 Average standard deviation of split frequencies: 0.011681 225500 -- (-1629.823) [-1626.243] (-1632.923) (-1634.351) * (-1630.097) (-1626.008) (-1631.722) [-1626.672] -- 0:00:54 226000 -- (-1629.144) (-1626.239) [-1626.963] (-1633.958) * (-1631.371) (-1627.848) (-1627.857) [-1628.491] -- 0:00:54 226500 -- (-1631.723) (-1630.860) [-1626.321] (-1627.555) * (-1632.853) (-1626.181) [-1629.043] (-1628.211) -- 0:00:54 227000 -- [-1627.680] (-1629.909) (-1632.001) (-1630.805) * (-1631.010) (-1630.187) [-1633.343] (-1628.835) -- 0:00:54 227500 -- (-1628.952) (-1628.301) (-1625.365) [-1628.574] * (-1631.729) [-1631.153] (-1633.617) (-1629.383) -- 0:00:54 228000 -- (-1629.032) (-1626.983) (-1624.277) [-1628.647] * [-1631.198] (-1630.620) (-1631.509) (-1626.458) -- 0:00:54 228500 -- (-1628.865) [-1629.509] (-1625.543) (-1628.416) * (-1629.269) (-1630.069) (-1634.325) [-1630.684] -- 0:00:54 229000 -- (-1629.032) (-1630.992) [-1628.836] (-1627.668) * (-1631.414) (-1630.375) [-1632.042] (-1631.317) -- 0:00:53 229500 -- (-1628.605) (-1626.598) [-1630.408] (-1628.074) * (-1630.413) (-1627.478) (-1634.556) [-1630.479] -- 0:00:53 230000 -- (-1630.091) [-1631.136] (-1626.941) (-1630.117) * (-1631.236) (-1629.683) (-1636.858) [-1627.839] -- 0:00:53 Average standard deviation of split frequencies: 0.013079 230500 -- (-1631.625) (-1627.263) [-1635.217] (-1628.138) * (-1630.504) (-1627.762) [-1635.848] (-1626.290) -- 0:00:53 231000 -- (-1629.161) [-1629.650] (-1630.093) (-1631.319) * (-1631.597) (-1630.334) (-1637.448) [-1628.095] -- 0:00:53 231500 -- (-1631.243) (-1627.369) [-1628.474] (-1634.074) * (-1633.080) (-1632.857) (-1634.017) [-1628.956] -- 0:00:53 232000 -- (-1629.552) (-1630.731) [-1629.677] (-1633.952) * (-1631.156) [-1627.447] (-1632.770) (-1632.150) -- 0:00:52 232500 -- (-1630.808) [-1627.971] (-1628.505) (-1633.022) * (-1629.363) (-1630.575) (-1630.019) [-1629.511] -- 0:00:56 233000 -- [-1628.491] (-1627.613) (-1625.126) (-1636.833) * (-1627.786) (-1628.524) (-1630.123) [-1631.857] -- 0:00:55 233500 -- [-1624.754] (-1629.079) (-1627.780) (-1634.704) * (-1629.989) [-1627.500] (-1628.840) (-1631.062) -- 0:00:55 234000 -- (-1628.340) [-1630.961] (-1627.143) (-1638.523) * (-1632.974) (-1628.947) [-1630.232] (-1634.514) -- 0:00:55 234500 -- [-1626.375] (-1631.696) (-1629.285) (-1627.504) * (-1636.242) (-1630.697) (-1636.086) [-1628.023] -- 0:00:55 235000 -- [-1626.407] (-1628.665) (-1628.902) (-1628.436) * [-1628.265] (-1626.764) (-1631.891) (-1631.729) -- 0:00:55 Average standard deviation of split frequencies: 0.013483 235500 -- (-1629.307) (-1627.667) (-1628.257) [-1630.642] * (-1626.335) (-1628.942) (-1633.534) [-1627.334] -- 0:00:55 236000 -- (-1630.561) (-1628.976) [-1628.751] (-1631.551) * [-1630.856] (-1630.729) (-1634.579) (-1628.355) -- 0:00:55 236500 -- [-1629.150] (-1630.541) (-1628.493) (-1630.459) * [-1628.522] (-1629.257) (-1637.670) (-1628.930) -- 0:00:54 237000 -- (-1628.774) (-1629.753) (-1628.153) [-1627.843] * [-1628.136] (-1628.515) (-1632.321) (-1630.104) -- 0:00:54 237500 -- (-1630.173) (-1626.929) (-1627.385) [-1628.306] * (-1629.390) (-1632.775) (-1629.218) [-1627.245] -- 0:00:54 238000 -- (-1636.503) [-1629.116] (-1625.308) (-1630.585) * (-1629.973) (-1629.527) (-1632.679) [-1631.729] -- 0:00:54 238500 -- (-1628.004) (-1628.555) [-1624.850] (-1631.655) * (-1630.812) [-1628.810] (-1633.960) (-1630.933) -- 0:00:54 239000 -- (-1628.928) (-1628.778) [-1625.912] (-1626.655) * (-1630.713) [-1629.870] (-1633.195) (-1629.727) -- 0:00:54 239500 -- [-1627.441] (-1626.342) (-1625.379) (-1630.643) * [-1628.511] (-1627.659) (-1635.137) (-1630.924) -- 0:00:53 240000 -- [-1629.368] (-1625.765) (-1631.394) (-1631.318) * (-1627.949) [-1636.183] (-1636.865) (-1630.089) -- 0:00:53 Average standard deviation of split frequencies: 0.012732 240500 -- (-1630.045) (-1628.606) (-1628.926) [-1628.938] * (-1631.913) (-1628.135) [-1633.959] (-1631.476) -- 0:00:53 241000 -- (-1629.825) (-1625.990) [-1627.294] (-1628.660) * [-1629.179] (-1627.889) (-1631.283) (-1630.752) -- 0:00:53 241500 -- (-1627.637) [-1625.845] (-1632.859) (-1629.244) * (-1632.497) (-1629.973) (-1631.267) [-1628.557] -- 0:00:53 242000 -- (-1627.318) [-1625.884] (-1632.188) (-1632.395) * (-1632.064) [-1631.618] (-1634.803) (-1632.730) -- 0:00:53 242500 -- [-1630.827] (-1626.352) (-1632.080) (-1629.974) * (-1637.902) [-1625.405] (-1630.389) (-1632.536) -- 0:00:53 243000 -- (-1627.109) [-1627.722] (-1633.754) (-1631.295) * (-1634.376) (-1628.152) [-1630.872] (-1629.255) -- 0:00:52 243500 -- (-1629.211) (-1628.702) [-1628.419] (-1629.792) * (-1630.239) (-1630.813) [-1629.432] (-1628.147) -- 0:00:52 244000 -- [-1629.203] (-1628.500) (-1629.417) (-1626.809) * (-1629.613) (-1627.824) [-1628.875] (-1634.461) -- 0:00:52 244500 -- [-1628.226] (-1628.161) (-1628.653) (-1629.620) * (-1630.112) (-1627.124) (-1630.112) [-1628.471] -- 0:00:52 245000 -- [-1627.513] (-1626.304) (-1626.711) (-1626.242) * (-1629.296) (-1630.139) (-1629.855) [-1640.477] -- 0:00:52 Average standard deviation of split frequencies: 0.014372 245500 -- (-1630.152) (-1628.452) [-1627.611] (-1627.428) * (-1630.473) (-1631.102) (-1628.882) [-1627.304] -- 0:00:52 246000 -- (-1630.551) (-1628.425) [-1630.902] (-1629.339) * (-1626.834) (-1630.239) (-1631.671) [-1629.783] -- 0:00:52 246500 -- (-1631.267) (-1632.510) [-1627.703] (-1631.982) * (-1629.870) (-1632.500) [-1630.758] (-1631.761) -- 0:00:51 247000 -- [-1627.781] (-1629.048) (-1631.765) (-1626.288) * (-1628.860) (-1631.286) [-1629.061] (-1631.643) -- 0:00:54 247500 -- (-1631.829) [-1625.532] (-1629.538) (-1625.370) * (-1629.642) (-1631.990) (-1629.384) [-1628.633] -- 0:00:54 248000 -- (-1626.403) (-1628.678) (-1627.353) [-1626.561] * (-1629.960) (-1628.676) [-1633.355] (-1635.504) -- 0:00:54 248500 -- (-1629.634) (-1630.880) [-1629.815] (-1626.562) * (-1628.865) [-1624.552] (-1630.199) (-1632.137) -- 0:00:54 249000 -- (-1628.866) (-1627.706) (-1627.774) [-1625.791] * (-1628.159) (-1627.314) [-1630.654] (-1628.181) -- 0:00:54 249500 -- (-1627.524) (-1631.381) (-1628.579) [-1625.471] * (-1627.988) [-1627.918] (-1633.626) (-1637.801) -- 0:00:54 250000 -- (-1628.277) [-1629.720] (-1627.685) (-1628.143) * [-1629.332] (-1627.321) (-1632.060) (-1632.539) -- 0:00:54 Average standard deviation of split frequencies: 0.015045 250500 -- (-1626.609) (-1626.008) [-1627.081] (-1627.902) * [-1630.813] (-1627.122) (-1629.874) (-1635.045) -- 0:00:53 251000 -- (-1628.368) (-1627.958) (-1626.411) [-1626.459] * (-1634.411) (-1630.055) [-1633.363] (-1629.594) -- 0:00:53 251500 -- (-1630.880) [-1627.295] (-1626.261) (-1626.668) * (-1635.284) (-1626.406) [-1628.583] (-1634.683) -- 0:00:53 252000 -- (-1631.955) (-1628.983) [-1630.058] (-1629.312) * [-1633.035] (-1627.406) (-1632.922) (-1630.879) -- 0:00:53 252500 -- (-1628.608) [-1632.871] (-1628.033) (-1626.476) * (-1633.361) (-1629.786) [-1627.832] (-1630.752) -- 0:00:53 253000 -- [-1630.519] (-1632.917) (-1626.488) (-1628.965) * [-1631.053] (-1631.134) (-1628.653) (-1630.712) -- 0:00:53 253500 -- (-1626.807) [-1631.153] (-1626.164) (-1631.078) * (-1630.665) (-1630.158) (-1628.555) [-1631.732] -- 0:00:53 254000 -- (-1629.081) (-1627.568) (-1628.850) [-1628.440] * (-1633.583) (-1628.248) [-1628.891] (-1626.818) -- 0:00:52 254500 -- [-1628.200] (-1627.007) (-1631.421) (-1626.457) * (-1635.008) [-1628.892] (-1632.231) (-1627.516) -- 0:00:52 255000 -- (-1629.443) (-1629.575) [-1627.254] (-1628.425) * (-1639.200) (-1627.116) [-1629.699] (-1631.435) -- 0:00:52 Average standard deviation of split frequencies: 0.015410 255500 -- [-1630.474] (-1627.826) (-1627.184) (-1627.801) * (-1635.933) [-1628.616] (-1630.258) (-1633.047) -- 0:00:52 256000 -- (-1631.120) (-1629.317) [-1628.618] (-1628.586) * (-1634.211) [-1626.826] (-1628.103) (-1634.259) -- 0:00:52 256500 -- [-1626.294] (-1630.972) (-1630.457) (-1629.876) * [-1632.498] (-1628.623) (-1634.162) (-1635.427) -- 0:00:52 257000 -- (-1628.366) [-1628.180] (-1624.262) (-1628.797) * (-1632.591) (-1627.921) [-1631.923] (-1630.396) -- 0:00:52 257500 -- (-1626.273) (-1626.198) [-1626.753] (-1630.624) * (-1632.323) (-1626.602) (-1632.485) [-1628.301] -- 0:00:51 258000 -- (-1629.639) [-1625.841] (-1630.431) (-1635.769) * (-1634.045) (-1627.599) (-1631.303) [-1632.153] -- 0:00:51 258500 -- (-1632.004) [-1629.580] (-1628.807) (-1635.577) * [-1629.983] (-1628.537) (-1631.595) (-1631.631) -- 0:00:51 259000 -- [-1625.869] (-1627.027) (-1627.351) (-1630.558) * (-1629.154) (-1625.719) [-1627.820] (-1629.956) -- 0:00:51 259500 -- (-1625.986) (-1626.554) [-1628.497] (-1633.061) * [-1633.509] (-1627.115) (-1637.229) (-1631.049) -- 0:00:51 260000 -- (-1628.924) (-1627.863) [-1627.584] (-1632.953) * (-1629.950) [-1627.504] (-1625.958) (-1631.005) -- 0:00:51 Average standard deviation of split frequencies: 0.015101 260500 -- (-1629.439) [-1626.515] (-1627.624) (-1631.189) * [-1631.523] (-1626.548) (-1629.084) (-1630.131) -- 0:00:51 261000 -- (-1632.914) (-1627.890) [-1626.648] (-1630.389) * (-1628.606) (-1632.707) [-1629.344] (-1630.949) -- 0:00:50 261500 -- [-1628.518] (-1629.924) (-1628.695) (-1633.925) * (-1632.244) (-1629.426) (-1630.292) [-1627.578] -- 0:00:53 262000 -- (-1631.475) (-1627.334) (-1631.782) [-1630.619] * (-1629.213) (-1627.856) (-1633.684) [-1628.240] -- 0:00:53 262500 -- (-1631.846) [-1629.134] (-1628.200) (-1632.332) * (-1629.260) (-1629.307) [-1632.532] (-1629.049) -- 0:00:53 263000 -- (-1634.564) (-1628.623) [-1630.245] (-1633.377) * (-1630.418) [-1629.322] (-1630.578) (-1634.724) -- 0:00:53 263500 -- (-1629.628) [-1628.038] (-1633.647) (-1632.947) * (-1632.072) (-1628.836) (-1629.388) [-1636.303] -- 0:00:53 264000 -- (-1628.925) (-1629.441) (-1630.580) [-1629.259] * (-1629.044) [-1629.409] (-1629.930) (-1633.908) -- 0:00:52 264500 -- (-1628.875) [-1630.819] (-1630.708) (-1632.023) * [-1631.686] (-1628.262) (-1626.410) (-1629.988) -- 0:00:52 265000 -- (-1629.685) (-1631.034) [-1628.755] (-1630.125) * (-1633.751) [-1635.784] (-1629.915) (-1633.587) -- 0:00:52 Average standard deviation of split frequencies: 0.015106 265500 -- (-1630.177) (-1626.911) [-1630.271] (-1631.910) * (-1631.214) (-1631.980) (-1629.245) [-1632.643] -- 0:00:52 266000 -- (-1630.803) (-1629.249) [-1627.416] (-1632.869) * (-1631.603) (-1630.860) (-1633.199) [-1633.374] -- 0:00:52 266500 -- (-1631.192) [-1627.683] (-1631.176) (-1629.956) * (-1632.699) (-1635.098) (-1634.236) [-1628.068] -- 0:00:52 267000 -- (-1630.717) [-1633.641] (-1631.938) (-1632.221) * (-1629.810) (-1628.297) (-1628.230) [-1630.016] -- 0:00:52 267500 -- [-1628.997] (-1632.697) (-1638.216) (-1628.707) * (-1628.480) [-1631.187] (-1631.414) (-1630.481) -- 0:00:52 268000 -- (-1627.969) (-1629.323) (-1635.945) [-1630.260] * (-1628.170) (-1636.400) (-1630.371) [-1627.929] -- 0:00:51 268500 -- (-1630.790) (-1629.496) (-1633.751) [-1632.758] * [-1630.629] (-1631.965) (-1630.901) (-1629.175) -- 0:00:51 269000 -- [-1629.049] (-1627.232) (-1629.292) (-1632.128) * (-1633.706) (-1628.239) [-1628.641] (-1630.307) -- 0:00:51 269500 -- (-1633.408) [-1624.820] (-1629.641) (-1626.954) * (-1633.126) (-1629.642) [-1630.990] (-1631.328) -- 0:00:51 270000 -- (-1626.687) (-1631.206) (-1633.362) [-1630.112] * (-1631.434) [-1628.074] (-1629.923) (-1627.497) -- 0:00:51 Average standard deviation of split frequencies: 0.014281 270500 -- [-1633.930] (-1630.294) (-1633.010) (-1625.627) * (-1633.013) (-1628.033) (-1631.013) [-1627.787] -- 0:00:51 271000 -- (-1629.631) [-1627.747] (-1631.652) (-1626.932) * (-1632.911) [-1629.371] (-1628.181) (-1627.610) -- 0:00:51 271500 -- (-1630.113) (-1630.631) (-1629.093) [-1630.179] * (-1627.810) [-1629.325] (-1630.790) (-1628.805) -- 0:00:50 272000 -- (-1631.623) (-1628.907) (-1630.243) [-1627.540] * (-1628.609) (-1629.624) (-1630.910) [-1631.132] -- 0:00:50 272500 -- (-1628.528) (-1631.444) (-1626.914) [-1626.915] * (-1630.777) [-1629.920] (-1630.441) (-1631.638) -- 0:00:50 273000 -- (-1630.639) (-1629.245) (-1634.885) [-1627.578] * (-1629.134) (-1629.398) [-1630.139] (-1627.304) -- 0:00:50 273500 -- (-1632.046) [-1629.512] (-1629.770) (-1629.075) * [-1629.823] (-1628.842) (-1629.242) (-1628.922) -- 0:00:50 274000 -- [-1631.311] (-1630.546) (-1627.930) (-1628.105) * (-1633.127) (-1630.579) (-1630.640) [-1628.383] -- 0:00:50 274500 -- (-1631.506) (-1633.440) (-1629.196) [-1626.772] * (-1635.246) (-1631.545) [-1627.931] (-1627.061) -- 0:00:50 275000 -- [-1628.217] (-1630.914) (-1629.649) (-1624.699) * [-1627.326] (-1629.670) (-1630.946) (-1625.042) -- 0:00:50 Average standard deviation of split frequencies: 0.014965 275500 -- (-1629.829) [-1628.435] (-1630.832) (-1626.524) * (-1629.929) (-1630.462) (-1628.146) [-1628.400] -- 0:00:52 276000 -- (-1631.191) (-1627.443) [-1634.135] (-1631.965) * [-1628.210] (-1630.923) (-1632.595) (-1629.671) -- 0:00:52 276500 -- (-1629.585) (-1629.250) [-1630.420] (-1631.761) * [-1633.397] (-1629.004) (-1630.502) (-1628.004) -- 0:00:52 277000 -- (-1628.544) [-1627.067] (-1627.968) (-1627.023) * (-1628.201) [-1631.660] (-1627.283) (-1631.358) -- 0:00:52 277500 -- [-1629.144] (-1630.310) (-1628.978) (-1627.990) * (-1630.789) (-1633.405) [-1626.232] (-1629.240) -- 0:00:52 278000 -- (-1633.642) (-1628.900) (-1631.299) [-1627.866] * (-1626.507) (-1632.679) [-1629.407] (-1630.241) -- 0:00:51 278500 -- [-1631.335] (-1629.814) (-1632.369) (-1629.664) * (-1628.269) [-1629.291] (-1631.680) (-1631.589) -- 0:00:51 279000 -- (-1629.258) (-1628.818) [-1632.206] (-1626.393) * [-1631.142] (-1630.717) (-1629.604) (-1632.332) -- 0:00:51 279500 -- (-1629.945) (-1629.652) (-1632.378) [-1628.072] * [-1629.201] (-1631.163) (-1630.687) (-1629.821) -- 0:00:51 280000 -- (-1628.541) (-1627.844) [-1630.566] (-1632.570) * [-1627.471] (-1628.796) (-1631.176) (-1628.469) -- 0:00:51 Average standard deviation of split frequencies: 0.016000 280500 -- (-1628.034) (-1627.276) (-1632.371) [-1626.829] * (-1629.086) [-1631.920] (-1633.029) (-1628.660) -- 0:00:51 281000 -- (-1629.003) (-1627.035) [-1628.379] (-1627.193) * (-1631.154) (-1630.216) (-1634.919) [-1629.920] -- 0:00:51 281500 -- (-1629.785) [-1626.199] (-1629.340) (-1626.908) * (-1633.918) [-1629.501] (-1631.763) (-1630.279) -- 0:00:51 282000 -- [-1629.678] (-1627.864) (-1630.189) (-1629.575) * [-1629.050] (-1632.891) (-1632.470) (-1629.273) -- 0:00:50 282500 -- [-1628.216] (-1629.135) (-1626.900) (-1630.183) * (-1629.049) (-1632.334) (-1628.964) [-1629.713] -- 0:00:50 283000 -- [-1631.062] (-1627.414) (-1628.581) (-1629.192) * (-1631.093) (-1634.068) [-1627.094] (-1634.063) -- 0:00:50 283500 -- (-1634.700) (-1628.167) [-1630.558] (-1625.929) * [-1632.687] (-1634.121) (-1629.180) (-1631.218) -- 0:00:50 284000 -- (-1632.794) (-1628.934) (-1629.065) [-1625.934] * (-1634.033) (-1631.032) (-1628.613) [-1626.307] -- 0:00:50 284500 -- (-1631.287) (-1626.534) (-1633.261) [-1629.069] * (-1629.837) (-1630.349) (-1627.741) [-1628.017] -- 0:00:50 285000 -- [-1629.887] (-1628.548) (-1631.757) (-1626.628) * (-1633.329) (-1631.745) (-1629.241) [-1625.936] -- 0:00:50 Average standard deviation of split frequencies: 0.016090 285500 -- (-1630.165) [-1628.456] (-1628.718) (-1626.160) * [-1635.837] (-1630.745) (-1629.062) (-1627.252) -- 0:00:50 286000 -- [-1630.150] (-1628.075) (-1631.143) (-1628.117) * (-1631.558) (-1634.840) (-1628.701) [-1627.184] -- 0:00:49 286500 -- (-1629.496) (-1630.024) [-1627.678] (-1630.499) * (-1632.609) [-1635.837] (-1630.801) (-1629.895) -- 0:00:49 287000 -- (-1631.134) (-1630.539) [-1627.393] (-1628.191) * (-1629.262) (-1634.675) [-1628.986] (-1632.441) -- 0:00:49 287500 -- (-1630.573) (-1633.109) (-1629.605) [-1632.123] * (-1629.088) [-1630.153] (-1627.237) (-1631.984) -- 0:00:49 288000 -- (-1628.953) [-1629.829] (-1628.836) (-1628.111) * (-1627.655) (-1634.191) (-1630.896) [-1630.249] -- 0:00:49 288500 -- (-1630.849) (-1635.180) (-1632.561) [-1629.127] * (-1628.944) (-1633.093) (-1631.420) [-1628.601] -- 0:00:49 289000 -- (-1634.435) (-1630.854) (-1627.643) [-1626.939] * (-1630.763) [-1632.324] (-1628.639) (-1630.512) -- 0:00:49 289500 -- (-1635.819) [-1631.189] (-1630.896) (-1626.044) * (-1631.669) (-1630.976) [-1629.518] (-1630.651) -- 0:00:49 290000 -- (-1626.969) [-1628.047] (-1629.676) (-1627.648) * [-1627.022] (-1630.601) (-1628.608) (-1630.858) -- 0:00:51 Average standard deviation of split frequencies: 0.015060 290500 -- (-1629.849) (-1625.892) (-1628.895) [-1630.754] * (-1632.091) [-1630.930] (-1632.488) (-1632.899) -- 0:00:51 291000 -- (-1629.625) (-1628.828) [-1629.029] (-1629.400) * [-1632.770] (-1629.813) (-1632.377) (-1631.991) -- 0:00:51 291500 -- [-1630.449] (-1629.221) (-1626.944) (-1627.425) * (-1631.573) (-1630.294) (-1629.796) [-1633.314] -- 0:00:51 292000 -- (-1630.886) [-1625.379] (-1627.632) (-1634.693) * (-1629.352) (-1630.575) [-1628.292] (-1632.741) -- 0:00:50 292500 -- (-1627.775) [-1626.911] (-1633.387) (-1630.409) * (-1629.466) (-1629.841) [-1629.312] (-1631.169) -- 0:00:50 293000 -- (-1628.669) (-1627.173) [-1627.745] (-1626.730) * [-1632.053] (-1632.346) (-1632.962) (-1629.187) -- 0:00:50 293500 -- (-1630.270) [-1627.348] (-1629.147) (-1630.078) * [-1626.886] (-1633.631) (-1630.182) (-1629.542) -- 0:00:50 294000 -- (-1628.843) (-1630.709) (-1630.591) [-1630.388] * (-1633.694) [-1630.022] (-1628.999) (-1631.365) -- 0:00:50 294500 -- (-1628.113) (-1631.310) (-1630.983) [-1630.246] * (-1628.755) (-1629.654) [-1630.049] (-1633.439) -- 0:00:50 295000 -- (-1625.876) (-1634.079) (-1635.350) [-1628.466] * (-1629.016) (-1630.106) (-1631.710) [-1629.529] -- 0:00:50 Average standard deviation of split frequencies: 0.012820 295500 -- (-1631.849) (-1630.805) [-1628.178] (-1633.058) * (-1629.146) (-1630.620) (-1630.215) [-1629.421] -- 0:00:50 296000 -- (-1630.274) (-1628.842) (-1628.621) [-1632.147] * (-1629.152) (-1631.355) [-1627.794] (-1626.772) -- 0:00:49 296500 -- (-1628.934) (-1628.349) (-1632.034) [-1629.558] * (-1630.618) (-1630.699) [-1627.957] (-1628.632) -- 0:00:49 297000 -- (-1629.016) (-1632.265) [-1628.470] (-1636.431) * (-1630.691) (-1628.732) [-1629.596] (-1627.861) -- 0:00:49 297500 -- (-1628.243) (-1631.400) [-1626.160] (-1630.383) * (-1629.572) (-1631.450) (-1635.135) [-1626.930] -- 0:00:49 298000 -- (-1630.485) (-1633.220) [-1630.043] (-1629.840) * (-1627.153) (-1627.699) (-1627.601) [-1629.939] -- 0:00:49 298500 -- (-1626.244) (-1634.498) (-1628.284) [-1628.025] * [-1628.328] (-1627.858) (-1627.386) (-1628.996) -- 0:00:49 299000 -- [-1628.335] (-1631.284) (-1628.385) (-1633.204) * (-1630.589) (-1631.546) (-1628.123) [-1627.318] -- 0:00:49 299500 -- [-1628.372] (-1632.887) (-1627.118) (-1627.581) * [-1627.428] (-1629.578) (-1626.998) (-1626.569) -- 0:00:49 300000 -- [-1629.494] (-1630.601) (-1628.701) (-1631.906) * (-1627.322) [-1629.432] (-1627.802) (-1626.553) -- 0:00:48 Average standard deviation of split frequencies: 0.012543 300500 -- (-1626.946) [-1628.843] (-1627.348) (-1631.215) * (-1627.253) [-1628.412] (-1630.762) (-1627.214) -- 0:00:48 301000 -- [-1626.329] (-1627.951) (-1628.506) (-1634.039) * (-1630.198) (-1630.974) (-1632.088) [-1625.627] -- 0:00:48 301500 -- (-1626.697) [-1629.214] (-1629.906) (-1633.698) * (-1631.156) (-1631.584) [-1627.396] (-1627.146) -- 0:00:48 302000 -- [-1630.246] (-1629.198) (-1627.628) (-1632.593) * (-1630.388) (-1631.394) [-1626.489] (-1626.524) -- 0:00:48 302500 -- (-1629.415) [-1627.533] (-1629.861) (-1631.492) * (-1626.805) (-1629.304) (-1634.369) [-1627.983] -- 0:00:48 303000 -- (-1628.124) (-1632.786) (-1628.873) [-1630.646] * (-1628.732) (-1631.255) [-1631.754] (-1629.993) -- 0:00:50 303500 -- [-1630.565] (-1627.892) (-1634.565) (-1630.128) * [-1627.595] (-1628.978) (-1631.963) (-1628.322) -- 0:00:50 304000 -- [-1627.051] (-1627.695) (-1633.657) (-1628.941) * (-1625.873) [-1628.220] (-1628.896) (-1628.840) -- 0:00:50 304500 -- (-1629.168) (-1633.382) (-1631.067) [-1632.903] * (-1627.200) (-1632.113) [-1629.945] (-1628.527) -- 0:00:50 305000 -- (-1629.044) (-1629.725) [-1628.075] (-1627.260) * [-1626.991] (-1631.672) (-1630.479) (-1628.082) -- 0:00:50 Average standard deviation of split frequencies: 0.012324 305500 -- (-1627.309) (-1631.618) [-1626.968] (-1632.307) * [-1629.310] (-1630.435) (-1629.361) (-1628.314) -- 0:00:50 306000 -- (-1634.309) (-1629.155) [-1627.865] (-1629.181) * (-1627.855) (-1629.139) [-1631.275] (-1627.679) -- 0:00:49 306500 -- (-1632.117) [-1629.014] (-1631.018) (-1634.371) * [-1628.999] (-1632.570) (-1635.679) (-1627.939) -- 0:00:49 307000 -- [-1631.120] (-1628.594) (-1629.265) (-1630.018) * [-1628.778] (-1631.050) (-1631.366) (-1629.453) -- 0:00:49 307500 -- [-1630.354] (-1629.695) (-1628.255) (-1628.619) * (-1631.554) (-1632.895) [-1629.631] (-1629.689) -- 0:00:49 308000 -- (-1628.640) (-1630.025) [-1633.139] (-1630.852) * (-1629.812) [-1628.770] (-1629.808) (-1631.872) -- 0:00:49 308500 -- (-1635.233) [-1627.202] (-1628.044) (-1629.634) * (-1630.650) (-1633.586) [-1630.974] (-1634.325) -- 0:00:49 309000 -- (-1630.043) (-1628.387) [-1628.919] (-1628.656) * (-1631.309) (-1628.536) [-1638.154] (-1627.394) -- 0:00:49 309500 -- (-1630.544) (-1627.921) (-1631.334) [-1633.472] * (-1626.716) (-1629.922) (-1630.143) [-1625.691] -- 0:00:49 310000 -- (-1628.957) (-1630.327) [-1630.219] (-1632.840) * (-1628.738) [-1628.501] (-1631.287) (-1625.944) -- 0:00:48 Average standard deviation of split frequencies: 0.013050 310500 -- [-1632.030] (-1630.016) (-1628.293) (-1631.082) * (-1626.437) (-1628.026) (-1631.336) [-1624.477] -- 0:00:48 311000 -- (-1630.542) (-1626.412) (-1629.519) [-1631.061] * (-1628.340) (-1635.055) [-1631.626] (-1626.053) -- 0:00:48 311500 -- (-1632.197) [-1625.713] (-1637.114) (-1630.022) * [-1625.116] (-1631.900) (-1631.635) (-1626.157) -- 0:00:48 312000 -- (-1629.281) (-1631.108) [-1631.360] (-1634.952) * (-1625.922) (-1630.197) (-1632.561) [-1629.646] -- 0:00:48 312500 -- (-1633.573) (-1629.669) [-1630.105] (-1632.518) * (-1629.710) [-1628.644] (-1633.873) (-1629.880) -- 0:00:48 313000 -- [-1629.344] (-1635.859) (-1628.822) (-1630.947) * (-1624.966) [-1629.954] (-1631.836) (-1628.601) -- 0:00:48 313500 -- (-1628.519) (-1631.071) [-1629.741] (-1631.691) * (-1629.488) (-1630.819) (-1631.116) [-1629.069] -- 0:00:48 314000 -- (-1628.904) (-1626.804) [-1627.134] (-1632.676) * (-1630.730) [-1629.312] (-1631.637) (-1625.647) -- 0:00:48 314500 -- [-1628.269] (-1630.577) (-1627.691) (-1629.923) * [-1627.593] (-1628.029) (-1631.967) (-1628.740) -- 0:00:50 315000 -- (-1629.796) (-1629.559) (-1627.478) [-1631.429] * (-1628.650) [-1624.861] (-1632.281) (-1628.055) -- 0:00:50 Average standard deviation of split frequencies: 0.012562 315500 -- [-1626.749] (-1629.159) (-1630.355) (-1636.025) * [-1627.374] (-1628.540) (-1631.020) (-1628.373) -- 0:00:49 316000 -- (-1627.154) [-1628.264] (-1630.188) (-1636.628) * (-1629.544) [-1635.889] (-1629.554) (-1632.322) -- 0:00:49 316500 -- (-1630.113) (-1629.269) (-1626.697) [-1631.224] * (-1627.776) (-1633.977) (-1631.728) [-1634.611] -- 0:00:49 317000 -- [-1626.280] (-1635.052) (-1628.377) (-1632.206) * (-1633.501) (-1628.356) [-1630.640] (-1634.241) -- 0:00:49 317500 -- [-1629.051] (-1629.214) (-1625.628) (-1633.303) * (-1631.174) (-1627.930) (-1630.355) [-1627.674] -- 0:00:49 318000 -- (-1628.395) [-1628.809] (-1628.688) (-1633.566) * (-1627.107) (-1630.123) [-1630.057] (-1631.380) -- 0:00:49 318500 -- (-1633.138) [-1627.150] (-1633.304) (-1634.255) * [-1628.243] (-1626.859) (-1630.395) (-1630.611) -- 0:00:49 319000 -- (-1633.139) (-1627.387) (-1630.675) [-1630.870] * (-1625.839) (-1625.707) [-1632.638] (-1632.142) -- 0:00:49 319500 -- (-1633.002) [-1628.357] (-1634.044) (-1633.123) * (-1629.706) (-1628.758) (-1634.016) [-1628.263] -- 0:00:48 320000 -- (-1631.499) [-1629.952] (-1628.280) (-1631.834) * [-1627.334] (-1633.268) (-1630.913) (-1629.336) -- 0:00:48 Average standard deviation of split frequencies: 0.012921 320500 -- (-1633.496) (-1635.153) [-1628.220] (-1629.632) * [-1627.162] (-1628.647) (-1629.300) (-1632.648) -- 0:00:48 321000 -- (-1636.239) (-1633.753) (-1627.889) [-1632.412] * [-1628.504] (-1626.762) (-1628.062) (-1627.878) -- 0:00:48 321500 -- [-1631.626] (-1630.148) (-1627.063) (-1629.621) * (-1634.104) [-1626.298] (-1628.193) (-1629.476) -- 0:00:48 322000 -- (-1628.116) (-1633.109) (-1627.324) [-1634.199] * (-1629.037) (-1627.918) (-1632.806) [-1626.555] -- 0:00:48 322500 -- (-1628.798) (-1630.646) [-1630.412] (-1631.269) * (-1629.559) [-1627.027] (-1631.590) (-1627.936) -- 0:00:48 323000 -- (-1629.371) (-1630.556) [-1628.921] (-1633.152) * (-1631.060) [-1625.705] (-1627.528) (-1630.801) -- 0:00:48 323500 -- (-1625.271) (-1628.986) (-1630.127) [-1632.069] * (-1631.703) (-1630.517) [-1627.195] (-1630.079) -- 0:00:48 324000 -- [-1628.831] (-1629.700) (-1632.728) (-1631.927) * (-1630.418) (-1626.562) [-1628.607] (-1628.181) -- 0:00:47 324500 -- [-1628.259] (-1628.931) (-1629.701) (-1633.495) * (-1629.799) [-1627.343] (-1630.301) (-1629.506) -- 0:00:47 325000 -- [-1626.656] (-1632.088) (-1630.175) (-1637.661) * [-1627.737] (-1625.284) (-1629.395) (-1628.108) -- 0:00:47 Average standard deviation of split frequencies: 0.012177 325500 -- (-1631.037) (-1635.673) (-1629.526) [-1633.690] * [-1631.611] (-1628.505) (-1629.000) (-1628.196) -- 0:00:47 326000 -- (-1631.940) (-1629.802) (-1631.942) [-1629.400] * (-1631.250) (-1627.160) [-1626.629] (-1630.709) -- 0:00:47 326500 -- [-1629.676] (-1633.970) (-1629.300) (-1632.483) * (-1628.017) (-1626.808) [-1625.597] (-1630.024) -- 0:00:47 327000 -- (-1629.647) (-1631.318) [-1628.289] (-1631.568) * (-1630.350) (-1626.877) [-1631.227] (-1627.130) -- 0:00:47 327500 -- [-1630.731] (-1628.892) (-1626.012) (-1630.913) * (-1632.205) (-1625.720) [-1628.175] (-1630.921) -- 0:00:49 328000 -- (-1629.127) (-1627.494) [-1629.002] (-1631.149) * (-1632.460) [-1628.214] (-1632.673) (-1629.566) -- 0:00:49 328500 -- (-1629.374) [-1626.750] (-1629.571) (-1632.663) * (-1629.400) [-1627.486] (-1629.301) (-1630.380) -- 0:00:49 329000 -- (-1628.829) (-1629.132) [-1626.176] (-1632.231) * (-1628.307) [-1629.339] (-1628.670) (-1627.367) -- 0:00:48 329500 -- (-1626.955) [-1626.528] (-1627.391) (-1630.792) * (-1629.243) (-1628.697) [-1629.106] (-1628.200) -- 0:00:48 330000 -- [-1627.586] (-1627.305) (-1628.644) (-1632.386) * [-1626.932] (-1633.692) (-1631.673) (-1629.767) -- 0:00:48 Average standard deviation of split frequencies: 0.012230 330500 -- (-1631.800) (-1629.095) (-1627.777) [-1630.856] * (-1631.771) (-1628.142) [-1627.563] (-1632.069) -- 0:00:48 331000 -- (-1631.744) (-1627.338) (-1631.416) [-1629.253] * [-1627.373] (-1627.928) (-1629.927) (-1629.804) -- 0:00:48 331500 -- [-1626.725] (-1629.183) (-1630.779) (-1632.294) * (-1630.240) (-1628.681) [-1627.249] (-1628.662) -- 0:00:48 332000 -- (-1629.047) [-1627.389] (-1629.431) (-1633.815) * (-1628.767) (-1628.639) (-1631.556) [-1627.624] -- 0:00:48 332500 -- [-1630.051] (-1627.484) (-1629.978) (-1631.706) * (-1629.435) [-1628.260] (-1628.813) (-1627.506) -- 0:00:48 333000 -- (-1626.982) (-1629.082) [-1626.507] (-1633.171) * (-1633.611) [-1626.053] (-1629.955) (-1630.444) -- 0:00:48 333500 -- (-1630.706) (-1627.825) (-1627.263) [-1631.123] * (-1631.422) [-1626.761] (-1631.474) (-1631.681) -- 0:00:47 334000 -- (-1634.180) (-1627.604) [-1627.827] (-1633.512) * (-1633.084) (-1629.152) [-1626.540] (-1631.056) -- 0:00:47 334500 -- (-1631.977) (-1630.993) (-1628.303) [-1632.831] * (-1629.027) (-1625.822) (-1630.808) [-1629.760] -- 0:00:47 335000 -- [-1630.398] (-1628.894) (-1628.293) (-1631.120) * (-1634.854) [-1629.554] (-1632.083) (-1630.275) -- 0:00:47 Average standard deviation of split frequencies: 0.013144 335500 -- (-1631.005) (-1626.401) [-1628.632] (-1633.269) * [-1633.998] (-1631.083) (-1629.659) (-1632.965) -- 0:00:47 336000 -- [-1628.658] (-1627.973) (-1632.223) (-1633.525) * (-1632.921) [-1630.399] (-1631.264) (-1630.882) -- 0:00:47 336500 -- (-1628.456) (-1627.322) [-1629.259] (-1636.052) * (-1629.780) [-1626.203] (-1631.511) (-1628.542) -- 0:00:47 337000 -- (-1630.453) (-1628.505) (-1629.277) [-1634.103] * (-1630.225) (-1630.276) [-1626.759] (-1631.423) -- 0:00:47 337500 -- (-1632.187) [-1630.221] (-1631.642) (-1634.242) * [-1630.845] (-1632.234) (-1631.870) (-1628.540) -- 0:00:47 338000 -- (-1632.425) (-1628.558) (-1630.900) [-1634.943] * (-1631.479) (-1629.783) [-1628.200] (-1627.523) -- 0:00:47 338500 -- (-1629.033) [-1630.556] (-1628.816) (-1631.983) * (-1633.308) (-1631.687) (-1628.800) [-1628.425] -- 0:00:46 339000 -- (-1634.426) [-1628.549] (-1633.011) (-1633.434) * (-1632.761) [-1630.179] (-1627.780) (-1627.007) -- 0:00:46 339500 -- (-1639.141) (-1629.566) (-1636.138) [-1632.285] * (-1633.561) (-1630.470) [-1626.356] (-1629.651) -- 0:00:46 340000 -- (-1633.387) [-1628.761] (-1626.256) (-1638.266) * (-1633.941) [-1630.651] (-1627.091) (-1630.022) -- 0:00:46 Average standard deviation of split frequencies: 0.013223 340500 -- (-1631.292) (-1629.187) (-1628.342) [-1631.540] * (-1632.144) [-1632.248] (-1627.935) (-1632.543) -- 0:00:46 341000 -- [-1633.918] (-1629.457) (-1627.892) (-1636.315) * [-1630.009] (-1631.912) (-1626.578) (-1630.681) -- 0:00:46 341500 -- (-1629.176) (-1627.962) [-1630.050] (-1634.025) * (-1630.755) (-1628.368) (-1629.750) [-1628.414] -- 0:00:48 342000 -- (-1632.883) [-1628.528] (-1631.724) (-1635.518) * [-1628.330] (-1631.670) (-1628.437) (-1630.922) -- 0:00:48 342500 -- (-1631.348) (-1626.266) [-1627.969] (-1632.000) * (-1633.237) (-1631.403) (-1629.964) [-1628.622] -- 0:00:47 343000 -- [-1630.165] (-1626.133) (-1625.005) (-1633.602) * [-1632.508] (-1628.193) (-1629.475) (-1631.660) -- 0:00:47 343500 -- (-1629.269) (-1627.989) [-1626.311] (-1633.131) * (-1638.041) [-1630.636] (-1627.479) (-1631.125) -- 0:00:47 344000 -- (-1631.729) [-1628.275] (-1627.844) (-1636.175) * (-1631.087) [-1629.710] (-1631.824) (-1629.515) -- 0:00:47 344500 -- (-1632.239) [-1626.624] (-1625.857) (-1632.650) * (-1633.036) (-1633.752) (-1630.309) [-1631.379] -- 0:00:47 345000 -- (-1630.234) [-1626.690] (-1627.543) (-1630.181) * (-1632.074) [-1630.119] (-1634.540) (-1631.940) -- 0:00:47 Average standard deviation of split frequencies: 0.012716 345500 -- (-1630.429) [-1629.094] (-1629.871) (-1630.110) * (-1630.198) (-1628.893) (-1630.348) [-1628.070] -- 0:00:47 346000 -- (-1629.679) [-1629.053] (-1634.380) (-1628.435) * (-1632.413) [-1630.322] (-1630.640) (-1629.986) -- 0:00:47 346500 -- (-1630.837) [-1626.831] (-1628.703) (-1629.375) * (-1632.000) [-1628.740] (-1633.993) (-1629.491) -- 0:00:47 347000 -- (-1627.835) (-1627.541) [-1626.387] (-1628.885) * (-1635.492) (-1630.611) [-1626.473] (-1629.344) -- 0:00:47 347500 -- (-1628.515) [-1627.778] (-1632.058) (-1627.986) * (-1629.795) (-1629.206) [-1631.289] (-1633.579) -- 0:00:46 348000 -- [-1629.659] (-1626.744) (-1630.809) (-1634.651) * (-1630.198) [-1629.713] (-1627.958) (-1636.523) -- 0:00:46 348500 -- (-1630.389) (-1634.190) (-1630.483) [-1635.593] * (-1633.920) (-1637.478) [-1626.310] (-1630.969) -- 0:00:46 349000 -- (-1631.250) (-1630.350) [-1627.336] (-1635.622) * (-1633.120) (-1629.150) (-1626.940) [-1629.961] -- 0:00:46 349500 -- (-1629.042) (-1626.946) (-1628.467) [-1628.526] * (-1632.593) (-1630.394) [-1627.593] (-1628.109) -- 0:00:46 350000 -- (-1627.304) (-1627.209) [-1628.990] (-1629.804) * (-1631.990) (-1631.699) (-1626.654) [-1628.150] -- 0:00:46 Average standard deviation of split frequencies: 0.013019 350500 -- [-1630.157] (-1626.692) (-1628.677) (-1627.326) * (-1631.495) (-1629.840) (-1629.193) [-1627.463] -- 0:00:46 351000 -- (-1630.879) (-1627.979) (-1631.193) [-1628.916] * [-1631.151] (-1633.781) (-1627.312) (-1632.114) -- 0:00:46 351500 -- (-1632.386) (-1627.673) (-1629.927) [-1631.614] * (-1631.026) (-1632.062) (-1627.255) [-1631.161] -- 0:00:46 352000 -- (-1627.832) [-1630.275] (-1632.263) (-1630.011) * (-1629.716) [-1633.242] (-1626.871) (-1629.871) -- 0:00:46 352500 -- (-1627.358) (-1629.874) [-1628.231] (-1628.824) * (-1629.607) [-1633.468] (-1629.155) (-1631.815) -- 0:00:45 353000 -- [-1627.216] (-1628.358) (-1630.584) (-1630.722) * [-1629.607] (-1632.968) (-1628.317) (-1629.944) -- 0:00:45 353500 -- (-1631.211) [-1631.102] (-1628.246) (-1630.922) * (-1632.959) [-1631.064] (-1627.373) (-1630.863) -- 0:00:45 354000 -- [-1628.171] (-1628.564) (-1632.185) (-1629.056) * (-1636.514) (-1632.496) [-1627.149] (-1633.899) -- 0:00:45 354500 -- (-1626.353) (-1628.238) (-1630.662) [-1626.911] * [-1629.581] (-1631.660) (-1629.349) (-1635.098) -- 0:00:45 355000 -- (-1627.417) [-1626.913] (-1629.188) (-1629.364) * [-1631.285] (-1629.497) (-1636.391) (-1630.958) -- 0:00:45 Average standard deviation of split frequencies: 0.013730 355500 -- (-1630.381) (-1629.723) [-1628.357] (-1626.887) * [-1632.123] (-1630.016) (-1629.604) (-1631.979) -- 0:00:45 356000 -- (-1627.857) (-1631.092) [-1634.335] (-1628.139) * (-1627.437) (-1632.768) [-1625.658] (-1632.597) -- 0:00:47 356500 -- [-1627.849] (-1628.713) (-1634.299) (-1627.373) * [-1632.304] (-1629.138) (-1627.979) (-1633.668) -- 0:00:46 357000 -- (-1628.956) (-1634.052) (-1631.643) [-1629.486] * [-1630.203] (-1627.589) (-1628.816) (-1632.266) -- 0:00:46 357500 -- [-1628.120] (-1627.719) (-1636.323) (-1629.169) * [-1630.092] (-1630.329) (-1627.945) (-1634.681) -- 0:00:46 358000 -- [-1630.355] (-1631.308) (-1634.151) (-1629.328) * (-1630.585) [-1630.556] (-1630.765) (-1629.297) -- 0:00:46 358500 -- (-1628.579) [-1628.674] (-1633.000) (-1629.985) * [-1628.811] (-1631.225) (-1633.586) (-1632.198) -- 0:00:46 359000 -- (-1629.752) (-1631.115) (-1631.706) [-1629.027] * [-1629.037] (-1631.510) (-1626.041) (-1628.060) -- 0:00:46 359500 -- [-1630.408] (-1628.368) (-1632.829) (-1629.684) * (-1633.109) [-1630.252] (-1629.199) (-1633.007) -- 0:00:46 360000 -- (-1628.640) [-1634.061] (-1635.846) (-1628.886) * (-1631.637) (-1631.986) (-1628.295) [-1631.625] -- 0:00:46 Average standard deviation of split frequencies: 0.013651 360500 -- (-1630.796) [-1626.924] (-1631.036) (-1626.533) * [-1628.906] (-1630.746) (-1636.117) (-1627.710) -- 0:00:46 361000 -- (-1631.668) [-1630.527] (-1629.968) (-1630.828) * [-1628.583] (-1626.619) (-1627.224) (-1630.233) -- 0:00:46 361500 -- [-1627.837] (-1629.663) (-1630.672) (-1631.948) * (-1628.811) (-1627.290) (-1628.847) [-1630.928] -- 0:00:45 362000 -- (-1628.688) (-1631.656) (-1629.984) [-1629.706] * (-1630.793) [-1627.576] (-1628.350) (-1631.447) -- 0:00:45 362500 -- [-1630.419] (-1631.715) (-1634.490) (-1629.209) * [-1628.624] (-1630.302) (-1626.775) (-1636.127) -- 0:00:45 363000 -- (-1634.492) (-1628.209) [-1630.996] (-1630.571) * (-1629.005) (-1630.811) [-1627.247] (-1631.532) -- 0:00:45 363500 -- (-1638.203) (-1631.402) (-1631.835) [-1628.406] * (-1630.180) [-1628.426] (-1627.454) (-1630.929) -- 0:00:45 364000 -- (-1632.049) (-1630.409) (-1633.173) [-1628.829] * (-1632.282) (-1628.121) [-1628.018] (-1632.359) -- 0:00:45 364500 -- [-1627.575] (-1629.066) (-1630.626) (-1629.775) * (-1631.873) (-1626.812) (-1627.720) [-1634.020] -- 0:00:45 365000 -- (-1630.672) [-1632.110] (-1629.548) (-1627.687) * (-1633.228) [-1626.853] (-1628.721) (-1631.412) -- 0:00:45 Average standard deviation of split frequencies: 0.013524 365500 -- (-1627.814) [-1633.254] (-1634.240) (-1632.259) * (-1632.419) (-1629.394) [-1630.622] (-1634.251) -- 0:00:45 366000 -- (-1629.946) [-1630.245] (-1630.923) (-1632.007) * (-1632.868) (-1627.278) (-1629.170) [-1634.643] -- 0:00:45 366500 -- (-1632.701) (-1633.750) [-1627.860] (-1633.147) * (-1632.226) (-1631.183) [-1631.236] (-1635.658) -- 0:00:44 367000 -- (-1627.618) [-1630.668] (-1626.460) (-1632.137) * [-1630.470] (-1628.129) (-1632.420) (-1630.313) -- 0:00:44 367500 -- [-1628.181] (-1631.930) (-1632.174) (-1633.984) * (-1628.445) [-1627.774] (-1629.557) (-1631.216) -- 0:00:44 368000 -- (-1629.574) (-1633.119) [-1626.717] (-1632.590) * (-1626.917) (-1631.077) [-1629.181] (-1629.159) -- 0:00:44 368500 -- (-1629.114) (-1631.998) (-1627.720) [-1633.850] * (-1628.148) (-1626.853) (-1628.241) [-1628.840] -- 0:00:44 369000 -- [-1628.771] (-1631.545) (-1631.924) (-1633.236) * (-1628.801) (-1627.112) (-1628.578) [-1632.320] -- 0:00:44 369500 -- [-1628.965] (-1634.532) (-1629.022) (-1632.183) * (-1631.105) (-1626.846) (-1626.804) [-1631.085] -- 0:00:46 370000 -- [-1628.110] (-1632.682) (-1631.372) (-1630.723) * (-1630.253) [-1627.362] (-1625.702) (-1629.978) -- 0:00:45 Average standard deviation of split frequencies: 0.013119 370500 -- [-1627.057] (-1631.633) (-1630.605) (-1632.149) * (-1630.406) [-1632.315] (-1627.709) (-1634.133) -- 0:00:45 371000 -- (-1627.456) (-1631.707) (-1630.023) [-1631.427] * (-1629.176) [-1630.922] (-1626.553) (-1629.254) -- 0:00:45 371500 -- (-1629.809) [-1628.594] (-1631.065) (-1630.659) * (-1628.948) (-1633.524) [-1626.112] (-1630.199) -- 0:00:45 372