--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:58:40 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/fbpC/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1211.44 -1216.46 2 -1211.47 -1215.54 -------------------------------------- TOTAL -1211.45 -1216.10 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896248 0.087759 0.377946 1.459751 0.862123 1482.80 1491.90 1.000 r(A<->C){all} 0.184079 0.023028 0.000033 0.486986 0.145421 267.82 313.86 1.004 r(A<->G){all} 0.147723 0.016869 0.000092 0.404489 0.108498 189.89 241.59 1.000 r(A<->T){all} 0.174214 0.021944 0.000036 0.481803 0.135473 105.27 120.85 1.000 r(C<->G){all} 0.159780 0.018806 0.000156 0.428881 0.122095 302.76 320.30 1.000 r(C<->T){all} 0.169247 0.020732 0.000019 0.456496 0.129457 136.54 192.85 1.007 r(G<->T){all} 0.164958 0.020138 0.000041 0.454190 0.124621 156.57 218.29 1.000 pi(A){all} 0.152938 0.000142 0.129513 0.175763 0.152642 1166.68 1249.38 1.000 pi(C){all} 0.284618 0.000215 0.255893 0.313081 0.284273 1236.95 1241.51 1.000 pi(G){all} 0.352704 0.000251 0.322883 0.384579 0.353081 1149.02 1200.29 1.000 pi(T){all} 0.209739 0.000185 0.184120 0.235916 0.209487 1247.25 1276.22 1.000 alpha{1,2} 0.410179 0.221997 0.000168 1.365406 0.239238 994.32 1097.81 1.000 alpha{3} 0.473817 0.244902 0.000134 1.448924 0.324241 1447.07 1474.03 1.000 pinvar{all} 0.998334 0.000004 0.994680 0.999999 0.998977 939.44 1163.12 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1164.563231 Model 2: PositiveSelection -1164.563007 Model 0: one-ratio -1164.563255 Model 7: beta -1164.563881 Model 8: beta&w>1 -1164.563005 Model 0 vs 1 4.799999987881165E-5 Model 2 vs 1 4.480000002331508E-4 Model 8 vs 7 0.0017520000001240987
>C1 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C2 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C3 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C4 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C5 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C6 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=301 C1 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C2 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C3 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C4 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C5 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C6 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG ************************************************** C1 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C2 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C3 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C4 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C5 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C6 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP ************************************************** C1 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C2 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C3 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C4 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C5 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C6 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG ************************************************** C1 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C2 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C3 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C4 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C5 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C6 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG ************************************************** C1 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C2 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C3 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C4 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C5 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C6 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA ************************************************** C1 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C2 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C3 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C4 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C5 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C6 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI ************************************************** C1 R C2 R C3 R C4 R C5 R C6 R * PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 301 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 301 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9030] Library Relaxation: Multi_proc [96] Relaxation Summary: [9030]--->[9030] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.507 Mb, Max= 30.863 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C2 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C3 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C4 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C5 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG C6 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG ************************************************** C1 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C2 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C3 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C4 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C5 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP C6 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP ************************************************** C1 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C2 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C3 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C4 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C5 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG C6 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG ************************************************** C1 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C2 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C3 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C4 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C5 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG C6 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG ************************************************** C1 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C2 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C3 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C4 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C5 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA C6 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA ************************************************** C1 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C2 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C3 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C4 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C5 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI C6 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI ************************************************** C1 R C2 R C3 R C4 R C5 R C6 R * FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC C2 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC C3 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC C4 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC C5 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC C6 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC ************************************************** C1 AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG C2 AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG C3 AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG C4 AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG C5 AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG C6 AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG ************************************************** C1 CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC C2 CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC C3 CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC C4 CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC C5 CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC C6 CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC ************************************************** C1 CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT C2 CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT C3 CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT C4 CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT C5 CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT C6 CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT ************************************************** C1 GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG C2 GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG C3 GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG C4 GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG C5 GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG C6 GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG ************************************************** C1 GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC C2 GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC C3 GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC C4 GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC C5 GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC C6 GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC ************************************************** C1 GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA C2 GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA C3 GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA C4 GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA C5 GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA C6 GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA ************************************************** C1 GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA C2 GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA C3 GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA C4 GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA C5 GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA C6 GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA ************************************************** C1 AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT C2 AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT C3 AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT C4 AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT C5 AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT C6 AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT ************************************************** C1 GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT C2 GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT C3 GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT C4 GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT C5 GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT C6 GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT ************************************************** C1 CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG C2 CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG C3 CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG C4 CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG C5 CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG C6 CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG ************************************************** C1 GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG C2 GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG C3 GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG C4 GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG C5 GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG C6 GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ************************************************** C1 ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT C2 ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT C3 ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT C4 ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT C5 ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT C6 ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT ************************************************** C1 GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC C2 GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC C3 GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC C4 GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC C5 GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC C6 GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC ************************************************** C1 CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA C2 CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA C3 CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA C4 CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA C5 CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA C6 CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA ************************************************** C1 TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG C2 TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG C3 TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG C4 TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG C5 TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG C6 TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG ************************************************** C1 GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG C2 GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG C3 GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG C4 GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG C5 GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG C6 GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG ************************************************** C1 CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT C2 CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT C3 CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT C4 CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT C5 CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT C6 CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT ************************************************** C1 CGC C2 CGC C3 CGC C4 CGC C5 CGC C6 CGC *** >C1 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >C2 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >C3 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >C4 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >C5 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >C6 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >C1 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C2 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C3 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C4 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C5 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >C6 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 903 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579777037 Setting output file names to "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1627331233 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 9204764926 Seed = 831893368 Swapseed = 1579777037 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2020.957284 -- -24.965149 Chain 2 -- -2020.957167 -- -24.965149 Chain 3 -- -2020.957284 -- -24.965149 Chain 4 -- -2020.957167 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2020.957167 -- -24.965149 Chain 2 -- -2020.957284 -- -24.965149 Chain 3 -- -2020.957167 -- -24.965149 Chain 4 -- -2020.957284 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2020.957] (-2020.957) (-2020.957) (-2020.957) * [-2020.957] (-2020.957) (-2020.957) (-2020.957) 500 -- (-1256.140) [-1224.896] (-1252.060) (-1250.549) * [-1237.440] (-1263.649) (-1225.978) (-1226.125) -- 0:00:00 1000 -- (-1227.840) [-1220.671] (-1222.129) (-1223.281) * [-1218.975] (-1221.037) (-1219.207) (-1218.665) -- 0:00:00 1500 -- (-1219.050) (-1221.576) (-1216.807) [-1217.377] * (-1222.239) [-1221.119] (-1220.124) (-1229.162) -- 0:00:00 2000 -- (-1219.720) (-1216.362) (-1220.449) [-1221.292] * (-1227.115) (-1217.071) (-1224.377) [-1216.228] -- 0:00:00 2500 -- (-1223.559) (-1226.558) (-1224.599) [-1222.107] * (-1223.124) (-1216.998) (-1222.208) [-1221.728] -- 0:00:00 3000 -- [-1222.096] (-1223.419) (-1230.355) (-1227.433) * (-1218.019) (-1223.479) [-1218.236] (-1222.137) -- 0:00:00 3500 -- (-1224.786) [-1217.165] (-1220.912) (-1226.329) * (-1223.490) (-1223.750) [-1221.252] (-1226.047) -- 0:00:00 4000 -- (-1225.411) [-1219.555] (-1226.429) (-1228.735) * (-1226.647) [-1218.021] (-1222.196) (-1221.955) -- 0:00:00 4500 -- (-1227.149) (-1220.233) [-1214.596] (-1218.979) * (-1221.747) [-1220.807] (-1220.900) (-1221.391) -- 0:00:00 5000 -- (-1222.637) [-1220.595] (-1223.352) (-1214.590) * (-1216.258) [-1219.667] (-1216.220) (-1218.207) -- 0:00:00 Average standard deviation of split frequencies: 0.121422 5500 -- (-1220.590) (-1218.858) [-1215.366] (-1218.722) * [-1220.193] (-1222.122) (-1222.892) (-1216.355) -- 0:00:00 6000 -- (-1220.357) (-1222.118) (-1220.331) [-1217.941] * (-1224.308) [-1221.471] (-1225.246) (-1220.420) -- 0:00:00 6500 -- [-1217.733] (-1223.878) (-1230.052) (-1221.190) * (-1221.060) (-1223.481) (-1222.283) [-1230.507] -- 0:00:00 7000 -- (-1222.051) [-1218.492] (-1219.358) (-1214.067) * (-1225.411) (-1217.186) [-1219.420] (-1221.625) -- 0:00:00 7500 -- (-1221.400) (-1220.879) (-1222.222) [-1218.793] * (-1222.687) (-1218.839) (-1219.579) [-1216.294] -- 0:00:00 8000 -- (-1220.238) (-1219.343) [-1221.624] (-1221.308) * (-1223.972) (-1231.708) [-1220.727] (-1216.513) -- 0:00:00 8500 -- [-1220.712] (-1219.893) (-1221.448) (-1223.543) * (-1221.377) (-1218.633) [-1216.262] (-1219.572) -- 0:00:00 9000 -- (-1216.336) [-1218.457] (-1223.165) (-1222.322) * (-1225.181) (-1226.702) (-1219.089) [-1219.290] -- 0:00:00 9500 -- (-1221.549) [-1224.861] (-1232.261) (-1225.515) * [-1218.475] (-1218.790) (-1213.935) (-1220.890) -- 0:00:00 10000 -- (-1222.058) (-1224.468) [-1221.504] (-1224.443) * [-1224.982] (-1218.782) (-1232.480) (-1220.610) -- 0:01:39 Average standard deviation of split frequencies: 0.082075 10500 -- (-1217.963) [-1213.087] (-1220.976) (-1225.800) * (-1216.199) [-1221.125] (-1223.843) (-1222.088) -- 0:01:34 11000 -- (-1232.324) (-1212.421) (-1224.280) [-1217.066] * (-1221.931) (-1218.966) [-1221.074] (-1226.792) -- 0:01:29 11500 -- (-1225.625) (-1212.317) [-1222.485] (-1221.977) * [-1223.723] (-1224.465) (-1227.362) (-1229.909) -- 0:01:25 12000 -- (-1223.663) (-1210.765) (-1224.064) [-1225.495] * [-1219.862] (-1225.681) (-1228.088) (-1226.276) -- 0:01:22 12500 -- (-1223.017) (-1211.411) (-1222.833) [-1220.975] * (-1225.108) (-1221.362) (-1219.346) [-1215.631] -- 0:01:19 13000 -- (-1224.858) (-1209.883) (-1222.086) [-1216.718] * (-1221.238) [-1220.596] (-1228.740) (-1216.788) -- 0:01:15 13500 -- (-1222.815) [-1210.084] (-1227.879) (-1217.294) * [-1225.008] (-1227.991) (-1221.182) (-1220.153) -- 0:01:13 14000 -- (-1225.530) (-1211.685) (-1222.701) [-1215.994] * [-1223.904] (-1216.900) (-1231.531) (-1219.787) -- 0:01:10 14500 -- [-1214.685] (-1215.273) (-1228.809) (-1223.423) * [-1220.009] (-1219.000) (-1223.490) (-1227.983) -- 0:01:07 15000 -- (-1214.767) (-1211.905) (-1220.400) [-1216.604] * [-1218.668] (-1220.052) (-1218.608) (-1222.867) -- 0:01:05 Average standard deviation of split frequencies: 0.062943 15500 -- (-1222.940) [-1211.909] (-1217.290) (-1218.191) * [-1218.773] (-1216.500) (-1226.088) (-1224.546) -- 0:01:03 16000 -- (-1217.891) [-1211.514] (-1221.038) (-1218.565) * (-1230.973) (-1243.514) (-1219.988) [-1219.216] -- 0:01:01 16500 -- (-1221.042) (-1212.244) (-1223.858) [-1219.889] * (-1222.426) (-1224.649) [-1218.822] (-1226.217) -- 0:00:59 17000 -- (-1227.402) [-1210.454] (-1215.935) (-1226.787) * (-1224.236) (-1228.244) (-1224.477) [-1221.716] -- 0:00:57 17500 -- (-1241.208) (-1211.080) (-1219.828) [-1219.353] * (-1223.593) (-1229.935) (-1220.191) [-1221.277] -- 0:00:56 18000 -- [-1219.096] (-1211.063) (-1227.798) (-1224.178) * (-1221.648) (-1210.325) [-1223.588] (-1219.031) -- 0:00:54 18500 -- [-1224.420] (-1211.977) (-1226.917) (-1222.012) * [-1220.654] (-1210.325) (-1230.697) (-1227.035) -- 0:00:53 19000 -- [-1216.995] (-1212.542) (-1216.779) (-1217.420) * (-1214.587) [-1213.419] (-1220.959) (-1225.732) -- 0:00:51 19500 -- (-1228.509) (-1212.966) (-1219.332) [-1216.781] * (-1218.484) [-1215.212] (-1220.762) (-1221.646) -- 0:00:50 20000 -- (-1215.743) [-1215.487] (-1215.982) (-1224.810) * (-1220.715) (-1210.969) (-1215.250) [-1217.735] -- 0:00:49 Average standard deviation of split frequencies: 0.061913 20500 -- (-1217.702) (-1212.258) [-1220.538] (-1217.627) * [-1217.527] (-1215.039) (-1217.400) (-1224.745) -- 0:00:47 21000 -- (-1216.613) [-1210.626] (-1221.678) (-1220.642) * [-1218.734] (-1213.642) (-1216.111) (-1225.001) -- 0:00:46 21500 -- (-1219.426) [-1211.147] (-1222.457) (-1227.011) * [-1217.101] (-1212.764) (-1228.557) (-1221.022) -- 0:00:45 22000 -- (-1228.257) (-1210.434) [-1215.875] (-1226.655) * (-1217.306) (-1212.813) [-1225.754] (-1223.470) -- 0:00:44 22500 -- [-1213.601] (-1209.962) (-1223.645) (-1221.987) * (-1231.780) (-1212.815) [-1222.076] (-1230.887) -- 0:00:43 23000 -- (-1221.484) (-1210.945) (-1222.032) [-1222.705] * [-1218.239] (-1216.277) (-1219.202) (-1223.248) -- 0:00:42 23500 -- (-1225.212) (-1212.941) [-1217.398] (-1220.825) * (-1223.175) (-1210.828) [-1222.512] (-1219.336) -- 0:00:41 24000 -- (-1215.575) (-1213.324) [-1219.058] (-1222.017) * [-1223.709] (-1212.376) (-1222.226) (-1223.457) -- 0:00:40 24500 -- (-1219.974) (-1216.045) (-1216.402) [-1219.036] * [-1217.872] (-1212.507) (-1223.925) (-1230.340) -- 0:00:39 25000 -- (-1218.866) (-1215.839) [-1214.772] (-1227.453) * (-1217.928) (-1213.838) [-1220.811] (-1218.530) -- 0:01:18 Average standard deviation of split frequencies: 0.060436 25500 -- (-1221.951) (-1213.693) [-1222.548] (-1224.704) * (-1222.479) (-1212.286) (-1218.127) [-1220.778] -- 0:01:16 26000 -- (-1227.179) (-1213.560) (-1218.318) [-1220.500] * (-1220.958) [-1211.190] (-1220.698) (-1223.656) -- 0:01:14 26500 -- (-1219.232) (-1216.160) (-1219.023) [-1220.872] * (-1227.115) [-1212.540] (-1220.713) (-1226.367) -- 0:01:13 27000 -- (-1231.152) (-1212.663) [-1222.968] (-1219.981) * (-1217.820) [-1213.144] (-1219.010) (-1225.561) -- 0:01:12 27500 -- (-1223.587) (-1212.810) (-1221.551) [-1225.326] * (-1222.505) [-1210.456] (-1224.951) (-1227.002) -- 0:01:10 28000 -- (-1221.842) (-1212.811) [-1223.570] (-1218.585) * (-1219.054) (-1215.930) (-1222.793) [-1221.639] -- 0:01:09 28500 -- (-1221.111) [-1210.887] (-1224.012) (-1227.379) * (-1218.254) (-1212.268) (-1225.650) [-1217.742] -- 0:01:08 29000 -- (-1214.430) (-1213.171) (-1222.863) [-1219.743] * (-1226.189) (-1210.809) (-1227.235) [-1218.040] -- 0:01:06 29500 -- (-1226.362) (-1212.878) (-1220.405) [-1224.769] * (-1221.938) (-1210.867) (-1222.091) [-1227.612] -- 0:01:05 30000 -- (-1223.253) (-1213.506) [-1215.825] (-1223.260) * (-1217.945) (-1211.830) (-1218.931) [-1220.555] -- 0:01:04 Average standard deviation of split frequencies: 0.051240 30500 -- (-1216.347) (-1210.836) [-1226.625] (-1223.778) * (-1228.385) (-1210.256) (-1220.571) [-1216.716] -- 0:01:03 31000 -- (-1221.103) [-1211.467] (-1223.378) (-1222.234) * [-1222.298] (-1210.610) (-1219.336) (-1216.428) -- 0:01:02 31500 -- [-1221.832] (-1211.309) (-1221.879) (-1220.066) * (-1220.201) [-1210.680] (-1218.924) (-1228.136) -- 0:01:01 32000 -- (-1221.604) (-1212.400) (-1213.733) [-1221.178] * (-1216.964) [-1210.244] (-1223.308) (-1222.634) -- 0:01:00 32500 -- (-1219.520) [-1211.576] (-1211.345) (-1224.333) * (-1227.786) (-1211.315) [-1217.043] (-1218.040) -- 0:00:59 33000 -- [-1222.791] (-1211.065) (-1211.486) (-1217.441) * (-1226.996) [-1212.772] (-1220.921) (-1220.697) -- 0:00:58 33500 -- (-1232.566) (-1210.222) [-1211.496] (-1221.630) * (-1225.271) [-1211.907] (-1227.213) (-1222.075) -- 0:00:57 34000 -- [-1216.671] (-1210.649) (-1210.313) (-1221.571) * (-1217.401) [-1211.466] (-1219.290) (-1224.696) -- 0:00:56 34500 -- [-1217.760] (-1213.330) (-1210.230) (-1218.837) * (-1224.414) [-1211.103] (-1221.152) (-1215.865) -- 0:00:55 35000 -- (-1221.203) (-1214.088) [-1213.477] (-1216.954) * (-1224.109) [-1212.357] (-1224.357) (-1222.168) -- 0:00:55 Average standard deviation of split frequencies: 0.050593 35500 -- (-1223.375) [-1214.624] (-1212.736) (-1212.282) * (-1222.245) (-1211.272) (-1221.546) [-1223.293] -- 0:00:54 36000 -- [-1219.025] (-1211.097) (-1213.808) (-1215.881) * [-1221.372] (-1211.347) (-1222.331) (-1226.829) -- 0:00:53 36500 -- (-1225.101) (-1211.445) [-1213.244] (-1216.160) * (-1217.805) (-1212.635) (-1222.873) [-1219.910] -- 0:00:52 37000 -- (-1221.816) (-1214.233) (-1211.245) [-1212.228] * (-1223.364) [-1210.378] (-1226.009) (-1222.141) -- 0:00:52 37500 -- (-1222.399) (-1212.184) [-1210.802] (-1210.808) * [-1219.356] (-1211.903) (-1227.980) (-1218.945) -- 0:00:51 38000 -- (-1238.908) (-1210.611) (-1211.972) [-1211.016] * (-1219.634) (-1212.717) (-1218.608) [-1220.826] -- 0:00:50 38500 -- (-1210.990) (-1210.811) [-1212.708] (-1211.146) * (-1226.139) (-1213.737) [-1224.253] (-1220.637) -- 0:00:49 39000 -- (-1215.010) (-1210.219) [-1212.744] (-1211.205) * (-1223.086) (-1212.370) (-1223.043) [-1219.110] -- 0:00:49 39500 -- [-1212.015] (-1210.608) (-1213.992) (-1211.108) * (-1226.592) (-1211.142) [-1218.541] (-1216.716) -- 0:00:48 40000 -- (-1211.672) [-1210.943] (-1213.873) (-1212.039) * (-1222.448) [-1213.343] (-1224.729) (-1218.196) -- 0:00:48 Average standard deviation of split frequencies: 0.049002 40500 -- [-1211.045] (-1212.273) (-1216.070) (-1214.199) * (-1221.754) (-1210.948) [-1218.927] (-1220.694) -- 0:01:11 41000 -- (-1210.439) (-1210.904) (-1210.564) [-1213.158] * (-1221.902) (-1211.544) (-1218.287) [-1223.902] -- 0:01:10 41500 -- (-1212.736) (-1210.614) (-1211.159) [-1213.679] * (-1217.042) (-1213.508) (-1233.690) [-1222.309] -- 0:01:09 42000 -- [-1212.724] (-1212.813) (-1212.570) (-1212.739) * (-1223.889) (-1211.650) (-1223.292) [-1227.935] -- 0:01:08 42500 -- (-1210.886) (-1212.676) [-1214.432] (-1214.586) * (-1225.122) (-1211.301) (-1224.649) [-1223.639] -- 0:01:07 43000 -- (-1211.126) [-1215.393] (-1213.931) (-1214.526) * (-1224.208) (-1210.926) [-1217.843] (-1228.046) -- 0:01:06 43500 -- (-1210.614) [-1212.510] (-1211.597) (-1213.510) * [-1217.678] (-1212.076) (-1220.261) (-1225.136) -- 0:01:05 44000 -- [-1211.387] (-1213.124) (-1211.125) (-1211.967) * (-1222.640) [-1211.625] (-1222.874) (-1230.582) -- 0:01:05 44500 -- (-1210.944) [-1210.254] (-1214.515) (-1213.370) * (-1220.023) (-1210.829) [-1214.399] (-1217.061) -- 0:01:04 45000 -- (-1210.879) (-1210.292) (-1211.037) [-1210.480] * [-1217.258] (-1210.788) (-1220.424) (-1219.132) -- 0:01:03 Average standard deviation of split frequencies: 0.046784 45500 -- [-1212.469] (-1212.442) (-1211.766) (-1211.506) * (-1226.001) (-1215.518) (-1223.682) [-1219.123] -- 0:01:02 46000 -- (-1210.662) (-1211.116) (-1210.842) [-1211.866] * [-1220.823] (-1212.454) (-1223.344) (-1235.085) -- 0:01:02 46500 -- (-1212.926) (-1210.484) [-1213.792] (-1212.306) * (-1224.041) (-1221.591) (-1228.655) [-1218.533] -- 0:01:01 47000 -- [-1214.340] (-1213.610) (-1210.742) (-1216.015) * (-1221.187) (-1211.430) [-1221.299] (-1219.944) -- 0:01:00 47500 -- [-1215.073] (-1213.124) (-1210.091) (-1213.727) * (-1221.885) [-1212.880] (-1229.334) (-1224.076) -- 0:01:00 48000 -- (-1215.942) [-1215.583] (-1210.596) (-1217.160) * [-1217.031] (-1211.381) (-1226.995) (-1224.456) -- 0:00:59 48500 -- (-1215.247) [-1214.462] (-1210.391) (-1217.245) * (-1228.458) (-1211.113) [-1216.973] (-1220.645) -- 0:00:58 49000 -- (-1217.390) (-1213.595) [-1211.357] (-1218.970) * (-1225.090) [-1211.226] (-1220.528) (-1218.952) -- 0:00:58 49500 -- (-1213.665) (-1212.417) (-1211.379) [-1213.901] * (-1221.388) (-1213.909) [-1223.802] (-1223.651) -- 0:00:57 50000 -- [-1210.502] (-1210.295) (-1213.277) (-1214.326) * (-1215.559) (-1212.691) [-1221.369] (-1219.940) -- 0:00:57 Average standard deviation of split frequencies: 0.050242 50500 -- (-1210.560) [-1210.972] (-1212.874) (-1216.603) * (-1223.347) (-1214.352) (-1224.440) [-1226.810] -- 0:00:56 51000 -- [-1210.422] (-1216.083) (-1214.916) (-1217.928) * [-1224.938] (-1216.558) (-1221.996) (-1223.481) -- 0:00:55 51500 -- (-1212.639) [-1211.055] (-1213.808) (-1213.486) * [-1222.237] (-1219.862) (-1221.000) (-1220.109) -- 0:00:55 52000 -- (-1211.812) (-1211.321) [-1216.335] (-1212.842) * (-1222.122) [-1215.525] (-1215.045) (-1222.689) -- 0:00:54 52500 -- (-1214.471) [-1211.791] (-1211.584) (-1211.454) * (-1226.820) (-1214.162) [-1217.442] (-1222.874) -- 0:00:54 53000 -- (-1216.230) (-1211.597) [-1211.749] (-1211.454) * (-1224.725) [-1214.149] (-1225.126) (-1216.750) -- 0:00:53 53500 -- (-1215.408) (-1210.493) [-1210.981] (-1211.691) * (-1229.403) (-1213.117) (-1225.049) [-1222.639] -- 0:00:53 54000 -- (-1212.870) (-1210.408) [-1211.052] (-1211.167) * [-1216.395] (-1215.669) (-1222.730) (-1229.035) -- 0:00:52 54500 -- [-1214.932] (-1210.394) (-1212.973) (-1213.205) * (-1228.324) (-1211.566) (-1217.394) [-1226.462] -- 0:00:52 55000 -- [-1213.238] (-1213.727) (-1213.414) (-1213.017) * (-1218.683) [-1210.417] (-1219.831) (-1221.276) -- 0:00:51 Average standard deviation of split frequencies: 0.048824 55500 -- [-1211.788] (-1213.339) (-1215.926) (-1211.126) * [-1220.530] (-1212.753) (-1223.240) (-1216.132) -- 0:00:51 56000 -- (-1215.730) [-1211.916] (-1213.023) (-1211.410) * (-1224.996) [-1212.780] (-1223.376) (-1227.871) -- 0:01:07 56500 -- (-1216.283) (-1215.739) [-1211.451] (-1214.026) * (-1224.274) (-1213.907) (-1218.980) [-1217.796] -- 0:01:06 57000 -- (-1216.001) (-1211.930) [-1211.903] (-1214.888) * (-1229.267) [-1213.605] (-1220.394) (-1221.796) -- 0:01:06 57500 -- (-1212.177) (-1214.628) [-1212.861] (-1212.929) * (-1231.591) [-1210.779] (-1221.546) (-1224.099) -- 0:01:05 58000 -- (-1211.303) (-1213.256) (-1214.557) [-1213.958] * (-1222.202) [-1211.107] (-1220.953) (-1216.950) -- 0:01:04 58500 -- [-1212.298] (-1213.405) (-1211.964) (-1214.436) * (-1220.341) (-1212.313) [-1221.813] (-1221.105) -- 0:01:04 59000 -- (-1212.694) [-1210.999] (-1212.428) (-1214.440) * (-1216.972) (-1213.819) (-1224.053) [-1217.968] -- 0:01:03 59500 -- (-1212.168) (-1210.209) [-1212.712] (-1214.472) * (-1210.651) [-1212.863] (-1229.619) (-1220.306) -- 0:01:03 60000 -- (-1212.955) [-1210.103] (-1212.915) (-1215.416) * (-1210.843) (-1210.176) (-1224.091) [-1214.786] -- 0:01:02 Average standard deviation of split frequencies: 0.044987 60500 -- [-1213.077] (-1210.868) (-1212.249) (-1211.803) * (-1213.319) [-1210.646] (-1222.867) (-1228.091) -- 0:01:02 61000 -- (-1212.422) (-1212.579) (-1213.940) [-1211.027] * (-1216.699) (-1210.611) (-1223.127) [-1228.934] -- 0:01:01 61500 -- (-1211.260) [-1213.402] (-1214.953) (-1211.151) * (-1212.849) [-1210.472] (-1221.201) (-1224.971) -- 0:01:01 62000 -- [-1212.340] (-1213.603) (-1211.783) (-1211.066) * (-1213.447) (-1210.789) [-1213.800] (-1228.035) -- 0:01:00 62500 -- [-1210.203] (-1211.184) (-1215.589) (-1210.305) * (-1212.824) (-1210.395) [-1222.235] (-1221.895) -- 0:01:00 63000 -- [-1211.442] (-1212.349) (-1213.194) (-1210.130) * [-1212.808] (-1210.694) (-1218.004) (-1222.474) -- 0:00:59 63500 -- (-1211.643) (-1211.777) (-1211.878) [-1210.307] * [-1211.470] (-1211.626) (-1217.559) (-1219.685) -- 0:00:58 64000 -- [-1211.052] (-1212.283) (-1209.936) (-1210.193) * (-1217.151) [-1211.595] (-1224.634) (-1220.771) -- 0:00:58 64500 -- (-1213.001) (-1211.266) (-1211.177) [-1210.064] * (-1211.830) [-1214.060] (-1219.753) (-1224.605) -- 0:00:58 65000 -- (-1213.892) [-1211.402] (-1212.409) (-1212.196) * (-1216.091) (-1215.489) (-1225.755) [-1218.710] -- 0:00:57 Average standard deviation of split frequencies: 0.039284 65500 -- (-1211.462) [-1210.282] (-1211.215) (-1211.881) * (-1213.164) [-1212.505] (-1231.311) (-1220.718) -- 0:00:57 66000 -- (-1211.150) (-1210.338) (-1215.412) [-1212.955] * [-1211.898] (-1212.803) (-1227.866) (-1225.913) -- 0:00:56 66500 -- [-1210.853] (-1211.606) (-1213.326) (-1212.409) * (-1210.338) [-1213.834] (-1219.968) (-1226.408) -- 0:00:56 67000 -- [-1210.500] (-1212.854) (-1217.814) (-1212.014) * (-1213.993) (-1214.194) (-1223.737) [-1221.024] -- 0:00:55 67500 -- [-1212.291] (-1211.931) (-1215.077) (-1210.606) * (-1210.655) [-1212.269] (-1229.792) (-1243.529) -- 0:00:55 68000 -- [-1211.033] (-1211.194) (-1212.199) (-1210.186) * (-1211.133) (-1212.125) [-1215.153] (-1211.423) -- 0:00:54 68500 -- [-1210.789] (-1211.980) (-1212.233) (-1211.816) * (-1210.262) [-1213.575] (-1221.896) (-1210.990) -- 0:00:54 69000 -- (-1210.992) [-1211.933] (-1212.399) (-1210.956) * [-1213.056] (-1212.846) (-1216.347) (-1213.628) -- 0:00:53 69500 -- (-1210.881) (-1212.268) [-1214.875] (-1211.763) * [-1211.938] (-1211.295) (-1221.723) (-1211.660) -- 0:00:53 70000 -- [-1213.633] (-1212.268) (-1210.795) (-1212.562) * [-1210.811] (-1213.055) (-1222.752) (-1211.906) -- 0:00:53 Average standard deviation of split frequencies: 0.042131 70500 -- (-1213.923) [-1211.690] (-1210.962) (-1213.477) * (-1212.574) (-1213.158) [-1217.869] (-1210.673) -- 0:00:52 71000 -- [-1212.447] (-1211.135) (-1210.585) (-1210.740) * (-1212.113) (-1211.906) (-1222.071) [-1210.992] -- 0:00:52 71500 -- (-1212.535) (-1213.108) (-1212.321) [-1210.491] * [-1211.182] (-1212.424) (-1234.090) (-1211.500) -- 0:00:51 72000 -- (-1211.952) (-1212.878) (-1211.342) [-1211.802] * [-1210.908] (-1214.891) (-1225.303) (-1212.567) -- 0:01:04 72500 -- (-1212.479) [-1210.091] (-1210.684) (-1210.981) * (-1210.350) [-1213.893] (-1220.512) (-1213.129) -- 0:01:03 73000 -- (-1211.231) (-1212.731) [-1212.032] (-1213.223) * [-1211.637] (-1210.969) (-1219.248) (-1213.850) -- 0:01:03 73500 -- (-1212.404) (-1210.642) [-1212.061] (-1214.143) * (-1211.749) [-1212.417] (-1221.607) (-1211.353) -- 0:01:03 74000 -- (-1211.365) [-1211.283] (-1210.078) (-1212.019) * (-1211.708) (-1213.235) (-1214.106) [-1210.123] -- 0:01:02 74500 -- [-1211.707] (-1211.503) (-1212.081) (-1209.834) * [-1212.766] (-1211.891) (-1220.109) (-1213.923) -- 0:01:02 75000 -- [-1212.098] (-1213.152) (-1211.818) (-1210.537) * (-1213.845) (-1211.509) (-1217.072) [-1214.315] -- 0:01:01 Average standard deviation of split frequencies: 0.037807 75500 -- (-1213.446) (-1216.081) (-1212.681) [-1211.417] * (-1212.586) (-1212.771) (-1221.605) [-1211.040] -- 0:01:01 76000 -- (-1211.943) [-1215.191] (-1212.054) (-1210.037) * (-1212.558) (-1212.719) (-1220.176) [-1211.701] -- 0:01:00 76500 -- (-1213.992) [-1218.044] (-1211.760) (-1210.031) * (-1211.930) (-1214.189) [-1219.318] (-1212.062) -- 0:01:00 77000 -- (-1212.401) (-1223.112) (-1212.130) [-1210.485] * (-1213.296) [-1213.264] (-1218.036) (-1213.130) -- 0:00:59 77500 -- (-1214.358) [-1216.691] (-1212.010) (-1209.812) * (-1211.397) (-1214.661) [-1219.442] (-1214.883) -- 0:00:59 78000 -- (-1212.990) (-1212.698) (-1210.429) [-1212.097] * (-1212.878) [-1214.699] (-1218.051) (-1212.653) -- 0:00:59 78500 -- (-1212.585) (-1211.256) (-1210.698) [-1210.299] * (-1214.055) (-1211.031) [-1221.060] (-1211.504) -- 0:00:58 79000 -- (-1211.618) (-1214.264) [-1210.286] (-1211.119) * [-1213.935] (-1212.714) (-1220.915) (-1212.064) -- 0:00:58 79500 -- (-1216.803) [-1210.684] (-1209.936) (-1212.309) * [-1212.250] (-1212.350) (-1218.374) (-1212.039) -- 0:00:57 80000 -- [-1213.463] (-1210.776) (-1211.375) (-1211.463) * (-1214.233) [-1212.625] (-1224.664) (-1213.565) -- 0:00:57 Average standard deviation of split frequencies: 0.034785 80500 -- (-1214.639) (-1213.091) [-1211.258] (-1212.625) * (-1213.765) (-1212.198) (-1222.995) [-1211.895] -- 0:00:57 81000 -- [-1210.621] (-1213.142) (-1213.479) (-1211.659) * (-1213.445) (-1212.725) (-1218.850) [-1212.294] -- 0:00:56 81500 -- [-1210.796] (-1212.609) (-1215.915) (-1212.458) * (-1212.193) (-1212.737) (-1224.587) [-1213.111] -- 0:00:56 82000 -- [-1212.309] (-1212.540) (-1211.376) (-1216.792) * [-1211.158] (-1211.338) (-1222.893) (-1213.127) -- 0:00:55 82500 -- (-1212.245) [-1210.616] (-1211.422) (-1210.450) * (-1212.966) (-1212.550) [-1217.617] (-1214.636) -- 0:00:55 83000 -- [-1212.102] (-1211.394) (-1212.123) (-1212.479) * (-1214.212) (-1215.564) (-1222.147) [-1210.687] -- 0:00:55 83500 -- (-1212.580) (-1212.158) (-1210.416) [-1211.670] * [-1211.639] (-1213.701) (-1218.775) (-1212.201) -- 0:00:54 84000 -- [-1210.452] (-1213.023) (-1210.289) (-1211.063) * (-1211.458) (-1211.953) [-1222.632] (-1213.427) -- 0:00:54 84500 -- [-1212.226] (-1213.584) (-1210.288) (-1210.798) * [-1210.531] (-1212.176) (-1224.367) (-1214.721) -- 0:00:54 85000 -- (-1212.158) (-1212.745) (-1211.369) [-1209.913] * (-1212.040) (-1213.514) [-1219.653] (-1210.740) -- 0:00:53 Average standard deviation of split frequencies: 0.031892 85500 -- (-1212.899) (-1212.320) (-1211.348) [-1210.371] * [-1215.616] (-1213.517) (-1223.391) (-1210.547) -- 0:00:53 86000 -- (-1213.576) (-1211.473) (-1211.918) [-1209.980] * (-1213.450) (-1211.597) (-1220.915) [-1211.737] -- 0:00:53 86500 -- (-1212.339) (-1211.835) (-1213.829) [-1211.861] * (-1215.635) (-1210.677) [-1226.200] (-1211.263) -- 0:00:52 87000 -- (-1212.002) (-1214.499) (-1212.761) [-1210.694] * (-1213.454) (-1212.391) [-1220.891] (-1210.747) -- 0:00:52 87500 -- [-1213.377] (-1210.760) (-1212.626) (-1211.181) * (-1215.080) (-1211.383) (-1217.749) [-1210.703] -- 0:00:52 88000 -- (-1212.483) (-1211.747) (-1211.476) [-1211.185] * (-1218.317) (-1216.315) [-1219.291] (-1212.382) -- 0:01:02 88500 -- [-1210.442] (-1212.237) (-1212.074) (-1211.629) * [-1214.902] (-1211.456) (-1218.322) (-1212.025) -- 0:01:01 89000 -- (-1213.102) (-1213.156) [-1212.077] (-1210.400) * [-1214.388] (-1213.451) (-1216.334) (-1211.018) -- 0:01:01 89500 -- (-1217.065) (-1210.704) [-1210.656] (-1210.513) * (-1210.401) (-1213.549) [-1217.230] (-1212.638) -- 0:01:01 90000 -- (-1214.147) [-1213.040] (-1211.791) (-1212.156) * [-1210.321] (-1213.892) (-1219.202) (-1217.051) -- 0:01:00 Average standard deviation of split frequencies: 0.031196 90500 -- (-1211.167) (-1213.440) [-1211.662] (-1212.228) * (-1210.397) [-1211.834] (-1216.946) (-1212.887) -- 0:01:00 91000 -- (-1211.293) [-1212.703] (-1212.515) (-1214.292) * (-1211.127) [-1212.187] (-1218.720) (-1211.965) -- 0:00:59 91500 -- [-1211.414] (-1212.896) (-1212.344) (-1213.743) * (-1213.878) (-1212.970) [-1220.159] (-1212.286) -- 0:00:59 92000 -- (-1212.405) (-1213.925) [-1212.579] (-1212.790) * (-1216.294) [-1213.082] (-1220.171) (-1212.257) -- 0:00:59 92500 -- [-1211.499] (-1211.577) (-1214.308) (-1213.575) * (-1211.345) (-1210.812) [-1216.468] (-1213.109) -- 0:00:58 93000 -- (-1211.217) [-1211.430] (-1210.933) (-1212.388) * [-1212.485] (-1212.882) (-1224.764) (-1214.989) -- 0:00:58 93500 -- (-1211.526) (-1211.787) [-1211.274] (-1217.871) * [-1212.473] (-1210.640) (-1222.220) (-1211.960) -- 0:00:58 94000 -- (-1212.115) (-1217.796) (-1215.426) [-1213.196] * (-1211.366) (-1211.424) (-1222.220) [-1211.057] -- 0:00:57 94500 -- [-1212.265] (-1212.426) (-1217.458) (-1213.029) * [-1212.580] (-1212.621) (-1227.320) (-1211.844) -- 0:00:57 95000 -- [-1212.298] (-1210.879) (-1211.802) (-1211.816) * (-1211.098) (-1211.202) [-1219.565] (-1212.971) -- 0:00:57 Average standard deviation of split frequencies: 0.029930 95500 -- [-1210.562] (-1210.366) (-1212.394) (-1210.058) * (-1211.944) (-1211.147) (-1227.900) [-1213.268] -- 0:00:56 96000 -- (-1211.254) [-1210.182] (-1213.828) (-1210.113) * (-1211.871) (-1211.970) (-1229.977) [-1211.699] -- 0:00:56 96500 -- [-1213.021] (-1210.915) (-1211.852) (-1212.065) * (-1213.827) [-1215.577] (-1224.955) (-1212.933) -- 0:00:56 97000 -- [-1214.055] (-1211.578) (-1210.802) (-1212.262) * (-1212.162) (-1211.998) (-1218.062) [-1210.608] -- 0:00:55 97500 -- (-1212.766) (-1212.184) (-1211.723) [-1214.430] * (-1216.243) (-1212.583) [-1219.558] (-1211.431) -- 0:00:55 98000 -- (-1211.566) (-1211.151) [-1211.429] (-1213.869) * (-1214.581) (-1215.124) (-1222.550) [-1213.650] -- 0:00:55 98500 -- (-1211.905) [-1213.792] (-1210.342) (-1212.624) * [-1212.485] (-1215.390) (-1227.614) (-1213.832) -- 0:00:54 99000 -- (-1212.406) (-1211.083) [-1212.519] (-1214.062) * (-1214.473) (-1213.229) (-1224.484) [-1214.347] -- 0:00:54 99500 -- (-1213.551) [-1210.968] (-1211.859) (-1211.994) * [-1213.391] (-1214.328) (-1222.816) (-1211.032) -- 0:00:54 100000 -- (-1212.472) (-1211.551) [-1211.260] (-1210.973) * (-1213.851) [-1210.481] (-1217.873) (-1210.941) -- 0:00:54 Average standard deviation of split frequencies: 0.029435 100500 -- (-1212.728) [-1214.004] (-1212.630) (-1211.487) * (-1213.788) [-1209.963] (-1225.170) (-1211.861) -- 0:00:53 101000 -- (-1215.296) [-1212.289] (-1211.842) (-1210.273) * (-1213.630) (-1210.528) [-1220.107] (-1212.058) -- 0:00:53 101500 -- [-1215.111] (-1214.787) (-1213.014) (-1213.190) * (-1214.350) (-1210.132) (-1224.864) [-1213.263] -- 0:00:53 102000 -- [-1214.022] (-1215.612) (-1211.741) (-1212.085) * (-1212.150) (-1212.966) [-1225.953] (-1218.957) -- 0:00:52 102500 -- [-1213.836] (-1213.798) (-1212.049) (-1211.718) * (-1212.257) (-1213.181) (-1219.231) [-1213.579] -- 0:00:52 103000 -- (-1211.921) [-1214.452] (-1212.242) (-1212.043) * [-1211.353] (-1217.987) (-1225.461) (-1211.841) -- 0:00:52 103500 -- (-1216.407) [-1214.331] (-1212.653) (-1215.513) * (-1210.981) (-1213.840) [-1216.292] (-1211.761) -- 0:01:00 104000 -- (-1211.454) (-1213.445) [-1210.945] (-1210.885) * (-1212.793) (-1216.706) [-1218.576] (-1212.268) -- 0:01:00 104500 -- (-1211.130) [-1210.648] (-1212.079) (-1216.096) * [-1212.569] (-1218.331) (-1222.811) (-1213.260) -- 0:00:59 105000 -- (-1211.295) (-1213.987) [-1211.408] (-1212.516) * (-1213.028) [-1211.775] (-1224.478) (-1213.039) -- 0:00:59 Average standard deviation of split frequencies: 0.026472 105500 -- (-1210.744) (-1211.392) (-1211.084) [-1211.623] * (-1213.391) [-1211.758] (-1224.981) (-1212.437) -- 0:00:59 106000 -- [-1210.763] (-1211.529) (-1214.042) (-1212.111) * (-1213.475) [-1213.455] (-1217.004) (-1211.295) -- 0:00:59 106500 -- (-1210.672) [-1210.634] (-1212.587) (-1211.399) * (-1220.313) (-1212.953) [-1221.977] (-1214.118) -- 0:00:58 107000 -- (-1212.188) (-1211.234) [-1211.542] (-1211.186) * (-1219.426) (-1214.523) (-1225.853) [-1212.387] -- 0:00:58 107500 -- (-1211.578) (-1211.391) (-1210.081) [-1213.075] * (-1216.665) (-1213.331) (-1222.708) [-1214.068] -- 0:00:58 108000 -- (-1212.561) [-1213.557] (-1211.656) (-1212.561) * (-1215.257) [-1214.138] (-1224.154) (-1211.423) -- 0:00:57 108500 -- (-1210.496) (-1214.257) [-1212.616] (-1211.951) * (-1216.144) [-1217.578] (-1234.942) (-1213.711) -- 0:00:57 109000 -- [-1212.628] (-1214.499) (-1210.350) (-1215.775) * (-1213.938) [-1214.978] (-1224.459) (-1216.660) -- 0:00:57 109500 -- [-1210.616] (-1212.324) (-1211.943) (-1212.415) * (-1211.981) (-1212.619) (-1223.837) [-1211.529] -- 0:00:56 110000 -- (-1210.520) (-1212.851) (-1212.675) [-1210.933] * [-1213.086] (-1212.618) (-1220.432) (-1213.357) -- 0:00:56 Average standard deviation of split frequencies: 0.027107 110500 -- (-1212.714) (-1212.208) [-1211.666] (-1213.771) * (-1213.723) (-1214.407) (-1222.856) [-1212.223] -- 0:00:56 111000 -- (-1212.757) (-1212.818) [-1211.292] (-1215.388) * [-1212.201] (-1211.932) (-1223.378) (-1211.253) -- 0:00:56 111500 -- (-1211.742) (-1210.881) [-1217.240] (-1209.963) * (-1210.482) (-1211.257) [-1221.894] (-1210.867) -- 0:00:55 112000 -- (-1214.052) [-1213.925] (-1214.250) (-1211.008) * (-1211.790) (-1211.227) (-1218.190) [-1213.050] -- 0:00:55 112500 -- (-1212.250) (-1216.908) (-1214.407) [-1211.240] * (-1211.013) (-1215.323) (-1222.811) [-1214.269] -- 0:00:55 113000 -- (-1213.543) (-1211.613) (-1215.137) [-1211.580] * (-1210.887) (-1214.815) [-1218.470] (-1212.401) -- 0:00:54 113500 -- (-1210.927) (-1215.455) (-1212.212) [-1213.697] * (-1210.773) (-1212.130) [-1219.258] (-1212.942) -- 0:00:54 114000 -- (-1211.310) (-1212.672) [-1213.523] (-1213.301) * (-1212.289) [-1216.395] (-1217.417) (-1210.157) -- 0:00:54 114500 -- [-1210.033] (-1212.917) (-1213.955) (-1214.222) * (-1213.755) (-1220.467) [-1216.965] (-1211.585) -- 0:00:54 115000 -- (-1210.871) (-1212.346) [-1211.552] (-1212.818) * (-1214.646) [-1215.233] (-1225.427) (-1213.377) -- 0:00:53 Average standard deviation of split frequencies: 0.025861 115500 -- (-1210.753) [-1212.161] (-1210.247) (-1212.932) * (-1212.548) (-1213.097) [-1220.823] (-1213.375) -- 0:00:53 116000 -- (-1212.409) [-1211.400] (-1210.570) (-1215.748) * (-1211.176) (-1215.804) (-1220.147) [-1210.670] -- 0:00:53 116500 -- (-1212.482) (-1212.267) [-1212.866] (-1214.261) * (-1211.501) (-1211.790) (-1215.598) [-1212.623] -- 0:00:53 117000 -- (-1213.096) (-1212.165) (-1212.973) [-1211.077] * (-1211.610) (-1211.436) [-1215.663] (-1212.655) -- 0:00:52 117500 -- (-1210.797) (-1214.003) [-1211.439] (-1217.413) * (-1210.977) (-1212.288) (-1212.970) [-1212.322] -- 0:00:52 118000 -- (-1210.683) (-1211.901) [-1211.293] (-1213.155) * [-1211.245] (-1210.573) (-1211.141) (-1210.829) -- 0:00:52 118500 -- (-1212.250) [-1211.170] (-1212.951) (-1212.770) * (-1210.631) (-1210.750) [-1212.977] (-1213.592) -- 0:00:52 119000 -- (-1213.242) (-1212.413) [-1212.032] (-1211.259) * (-1211.044) (-1211.094) [-1210.655] (-1211.908) -- 0:00:51 119500 -- (-1213.946) (-1211.194) (-1213.831) [-1212.844] * [-1210.207] (-1212.826) (-1210.006) (-1211.061) -- 0:00:58 120000 -- (-1215.097) (-1212.078) [-1212.927] (-1211.689) * [-1210.064] (-1211.822) (-1213.941) (-1215.173) -- 0:00:58 Average standard deviation of split frequencies: 0.025784 120500 -- (-1213.528) (-1210.442) [-1212.715] (-1210.634) * (-1210.568) (-1211.673) (-1215.045) [-1213.660] -- 0:00:58 121000 -- (-1213.016) (-1210.439) [-1212.693] (-1213.947) * (-1210.775) (-1210.723) [-1210.960] (-1213.459) -- 0:00:58 121500 -- (-1210.771) (-1210.535) [-1213.490] (-1212.781) * (-1211.703) [-1210.678] (-1211.273) (-1211.469) -- 0:00:57 122000 -- (-1210.861) (-1212.013) [-1214.551] (-1214.225) * (-1212.497) [-1213.016] (-1211.989) (-1213.303) -- 0:00:57 122500 -- (-1214.302) (-1211.046) (-1213.008) [-1211.345] * [-1211.403] (-1217.558) (-1212.214) (-1211.122) -- 0:00:57 123000 -- (-1214.546) (-1211.320) (-1212.285) [-1210.801] * [-1211.586] (-1210.392) (-1213.448) (-1211.824) -- 0:00:57 123500 -- (-1212.457) [-1213.195] (-1210.581) (-1215.470) * (-1212.399) (-1211.641) (-1211.567) [-1211.247] -- 0:00:56 124000 -- [-1211.617] (-1212.170) (-1210.470) (-1212.304) * [-1215.447] (-1211.550) (-1211.878) (-1211.123) -- 0:00:56 124500 -- (-1213.175) (-1211.839) [-1212.257] (-1211.566) * (-1213.405) [-1211.321] (-1212.082) (-1211.841) -- 0:00:56 125000 -- [-1211.471] (-1217.271) (-1214.838) (-1211.576) * (-1214.395) (-1213.146) (-1213.151) [-1211.670] -- 0:00:56 Average standard deviation of split frequencies: 0.022074 125500 -- (-1210.071) (-1213.169) [-1210.731] (-1211.493) * (-1211.947) (-1210.843) (-1213.324) [-1211.830] -- 0:00:55 126000 -- (-1213.754) (-1216.475) [-1212.759] (-1213.437) * [-1212.594] (-1212.393) (-1211.256) (-1212.141) -- 0:00:55 126500 -- (-1211.408) (-1212.147) (-1213.329) [-1212.387] * (-1211.553) [-1210.879] (-1212.296) (-1215.526) -- 0:00:55 127000 -- (-1211.408) (-1212.017) (-1215.434) [-1210.214] * (-1211.612) (-1211.596) [-1212.016] (-1212.958) -- 0:00:54 127500 -- (-1213.663) (-1212.025) (-1214.827) [-1211.082] * (-1211.586) (-1210.629) (-1211.001) [-1212.345] -- 0:00:54 128000 -- (-1214.657) (-1210.829) [-1212.893] (-1215.666) * (-1213.547) (-1210.383) [-1212.030] (-1211.320) -- 0:00:54 128500 -- (-1211.982) (-1210.860) [-1211.553] (-1213.238) * (-1211.839) [-1210.442] (-1210.568) (-1212.338) -- 0:00:54 129000 -- (-1210.843) [-1210.517] (-1213.320) (-1212.083) * (-1213.303) [-1212.159] (-1213.747) (-1209.979) -- 0:00:54 129500 -- (-1211.557) [-1213.216] (-1211.398) (-1212.725) * [-1214.556] (-1210.778) (-1211.271) (-1209.953) -- 0:00:53 130000 -- (-1212.857) (-1212.602) (-1211.053) [-1212.103] * (-1213.407) (-1214.507) [-1210.708] (-1212.496) -- 0:00:53 Average standard deviation of split frequencies: 0.021827 130500 -- (-1210.480) [-1210.809] (-1213.742) (-1212.236) * (-1212.631) (-1214.440) (-1212.286) [-1211.592] -- 0:00:53 131000 -- (-1210.910) (-1211.556) (-1212.875) [-1212.759] * (-1211.747) [-1211.654] (-1211.481) (-1212.283) -- 0:00:53 131500 -- (-1211.465) [-1210.852] (-1211.646) (-1214.303) * (-1212.614) (-1213.723) (-1212.290) [-1214.444] -- 0:00:52 132000 -- (-1210.840) (-1210.465) [-1210.905] (-1212.508) * [-1211.838] (-1213.170) (-1211.289) (-1210.895) -- 0:00:52 132500 -- (-1210.541) [-1210.860] (-1212.252) (-1212.334) * (-1211.669) (-1211.328) (-1218.305) [-1213.268] -- 0:00:52 133000 -- (-1212.591) (-1210.635) (-1212.331) [-1209.988] * (-1211.318) [-1210.040] (-1217.971) (-1212.288) -- 0:00:52 133500 -- (-1212.229) [-1210.789] (-1211.579) (-1212.723) * [-1212.771] (-1210.063) (-1218.185) (-1212.550) -- 0:00:51 134000 -- (-1212.186) (-1211.565) [-1210.797] (-1215.631) * (-1210.995) [-1211.462] (-1220.012) (-1213.041) -- 0:00:51 134500 -- (-1212.638) (-1211.593) (-1214.334) [-1211.441] * [-1214.008] (-1212.580) (-1220.311) (-1210.553) -- 0:00:51 135000 -- (-1213.022) (-1210.639) [-1213.510] (-1210.750) * (-1212.033) (-1214.042) [-1212.383] (-1212.878) -- 0:00:51 Average standard deviation of split frequencies: 0.020624 135500 -- [-1211.554] (-1213.007) (-1214.237) (-1211.528) * (-1211.462) (-1213.888) (-1211.106) [-1210.275] -- 0:00:57 136000 -- [-1215.329] (-1210.455) (-1213.358) (-1210.915) * (-1210.717) (-1215.999) [-1213.327] (-1210.999) -- 0:00:57 136500 -- (-1222.333) (-1211.096) (-1211.176) [-1214.692] * (-1212.443) (-1215.190) [-1212.698] (-1210.203) -- 0:00:56 137000 -- (-1211.669) (-1214.716) (-1212.281) [-1212.816] * (-1210.074) (-1211.901) (-1211.328) [-1210.348] -- 0:00:56 137500 -- (-1212.344) (-1213.341) [-1210.456] (-1213.390) * [-1210.766] (-1214.894) (-1212.365) (-1210.921) -- 0:00:56 138000 -- [-1211.523] (-1211.027) (-1210.836) (-1212.117) * [-1211.354] (-1212.496) (-1216.037) (-1215.220) -- 0:00:56 138500 -- (-1213.150) (-1211.100) (-1212.761) [-1214.370] * [-1211.349] (-1217.618) (-1210.370) (-1210.959) -- 0:00:55 139000 -- (-1210.867) (-1210.456) (-1211.063) [-1214.646] * (-1211.067) (-1213.090) (-1212.209) [-1214.237] -- 0:00:55 139500 -- (-1211.091) (-1212.694) [-1210.905] (-1213.932) * (-1212.068) (-1212.190) [-1210.921] (-1210.257) -- 0:00:55 140000 -- (-1211.206) (-1212.488) (-1210.815) [-1210.083] * [-1212.957] (-1210.774) (-1211.396) (-1211.448) -- 0:00:55 Average standard deviation of split frequencies: 0.022118 140500 -- [-1211.536] (-1212.749) (-1210.656) (-1210.493) * (-1211.189) (-1212.507) (-1211.190) [-1210.704] -- 0:00:55 141000 -- [-1211.615] (-1211.308) (-1211.086) (-1211.469) * (-1211.442) [-1212.085] (-1213.442) (-1211.108) -- 0:00:54 141500 -- (-1214.140) (-1211.861) [-1210.643] (-1210.800) * (-1211.040) (-1211.986) (-1212.912) [-1212.781] -- 0:00:54 142000 -- (-1212.175) [-1212.912] (-1210.616) (-1211.216) * (-1210.407) (-1213.771) [-1210.768] (-1212.011) -- 0:00:54 142500 -- (-1218.254) (-1211.904) [-1209.891] (-1211.075) * (-1211.007) (-1213.703) (-1210.355) [-1211.368] -- 0:00:54 143000 -- (-1214.048) (-1210.657) (-1211.389) [-1215.868] * (-1210.821) [-1212.965] (-1213.593) (-1211.784) -- 0:00:53 143500 -- [-1210.951] (-1210.572) (-1211.982) (-1213.890) * [-1213.181] (-1212.289) (-1212.844) (-1210.912) -- 0:00:53 144000 -- (-1210.987) (-1210.596) [-1211.927] (-1212.514) * (-1213.400) (-1212.270) [-1210.170] (-1214.163) -- 0:00:53 144500 -- (-1211.147) [-1210.723] (-1212.360) (-1213.277) * [-1213.083] (-1210.791) (-1212.407) (-1211.846) -- 0:00:53 145000 -- [-1211.417] (-1211.000) (-1212.379) (-1211.413) * (-1211.534) [-1210.987] (-1211.935) (-1214.105) -- 0:00:53 Average standard deviation of split frequencies: 0.019527 145500 -- (-1210.725) [-1213.692] (-1214.487) (-1211.354) * (-1212.203) (-1212.565) (-1210.106) [-1213.518] -- 0:00:52 146000 -- (-1214.094) [-1213.835] (-1215.488) (-1210.742) * (-1211.708) [-1214.188] (-1214.852) (-1213.735) -- 0:00:52 146500 -- (-1211.584) (-1212.103) (-1212.050) [-1214.968] * [-1210.404] (-1211.670) (-1213.284) (-1213.598) -- 0:00:52 147000 -- (-1213.177) (-1214.113) (-1211.998) [-1211.941] * (-1210.690) (-1211.241) [-1213.755] (-1213.637) -- 0:00:52 147500 -- (-1213.177) (-1211.382) (-1212.203) [-1211.750] * (-1212.066) (-1211.271) [-1213.550] (-1214.034) -- 0:00:52 148000 -- [-1213.978] (-1214.609) (-1211.283) (-1210.943) * (-1211.338) (-1213.776) (-1211.312) [-1210.812] -- 0:00:51 148500 -- (-1215.141) (-1212.025) (-1211.881) [-1210.674] * [-1210.036] (-1212.144) (-1210.418) (-1211.391) -- 0:00:51 149000 -- (-1214.332) (-1213.674) [-1210.908] (-1211.998) * (-1212.265) (-1210.545) [-1211.471] (-1211.391) -- 0:00:51 149500 -- (-1210.513) (-1217.481) (-1210.959) [-1213.394] * (-1209.888) (-1210.330) (-1210.000) [-1213.162] -- 0:00:51 150000 -- (-1210.930) [-1212.854] (-1212.653) (-1211.425) * (-1210.052) [-1210.321] (-1210.529) (-1214.331) -- 0:00:51 Average standard deviation of split frequencies: 0.018773 150500 -- [-1211.135] (-1211.583) (-1214.012) (-1215.639) * (-1211.110) (-1211.701) (-1212.823) [-1212.070] -- 0:00:50 151000 -- (-1210.694) (-1213.013) [-1213.968] (-1214.302) * (-1212.057) (-1211.615) [-1213.180] (-1216.819) -- 0:00:50 151500 -- (-1210.636) [-1211.800] (-1213.211) (-1215.727) * (-1212.694) (-1210.924) [-1210.968] (-1211.327) -- 0:00:50 152000 -- (-1210.728) (-1212.843) (-1212.629) [-1214.042] * (-1212.113) (-1212.743) [-1211.687] (-1210.335) -- 0:00:55 152500 -- (-1211.187) (-1211.465) (-1211.416) [-1211.016] * (-1210.525) (-1210.944) [-1210.890] (-1211.502) -- 0:00:55 153000 -- [-1210.561] (-1210.618) (-1211.910) (-1211.280) * (-1211.365) (-1211.860) [-1211.029] (-1213.319) -- 0:00:55 153500 -- [-1212.581] (-1210.619) (-1212.457) (-1210.418) * [-1211.388] (-1210.781) (-1213.365) (-1211.286) -- 0:00:55 154000 -- [-1212.187] (-1214.295) (-1214.701) (-1211.045) * (-1210.020) (-1213.328) [-1213.518] (-1216.480) -- 0:00:54 154500 -- (-1211.075) (-1212.758) [-1212.977] (-1213.444) * [-1209.868] (-1213.459) (-1214.273) (-1212.442) -- 0:00:54 155000 -- (-1211.278) [-1212.021] (-1214.334) (-1212.171) * (-1211.179) [-1211.616] (-1214.010) (-1212.259) -- 0:00:54 Average standard deviation of split frequencies: 0.018886 155500 -- (-1212.844) (-1211.930) (-1211.039) [-1211.418] * (-1210.475) (-1210.899) (-1213.728) [-1211.473] -- 0:00:54 156000 -- (-1212.761) (-1211.133) [-1211.432] (-1210.122) * (-1216.240) (-1210.261) [-1210.789] (-1211.395) -- 0:00:54 156500 -- [-1210.946] (-1211.263) (-1213.094) (-1211.828) * (-1211.610) [-1210.623] (-1214.538) (-1212.357) -- 0:00:53 157000 -- (-1211.226) [-1212.807] (-1211.809) (-1211.823) * (-1212.125) [-1210.776] (-1211.995) (-1212.336) -- 0:00:53 157500 -- (-1211.220) (-1215.286) [-1210.818] (-1211.855) * [-1210.649] (-1213.671) (-1210.489) (-1215.495) -- 0:00:53 158000 -- (-1211.061) (-1216.549) (-1211.751) [-1210.615] * [-1212.035] (-1209.913) (-1212.854) (-1213.917) -- 0:00:53 158500 -- (-1214.771) [-1212.317] (-1212.898) (-1212.752) * (-1214.880) (-1210.909) [-1213.078] (-1211.755) -- 0:00:53 159000 -- (-1213.003) [-1214.373] (-1210.204) (-1211.353) * (-1214.719) (-1210.363) (-1212.121) [-1210.236] -- 0:00:52 159500 -- (-1211.847) [-1211.575] (-1210.359) (-1211.208) * (-1212.674) [-1209.838] (-1217.593) (-1210.426) -- 0:00:52 160000 -- (-1211.120) (-1211.926) (-1212.120) [-1210.854] * (-1211.624) [-1210.600] (-1215.189) (-1212.312) -- 0:00:52 Average standard deviation of split frequencies: 0.018044 160500 -- (-1212.442) (-1213.203) (-1211.963) [-1210.952] * [-1211.322] (-1210.604) (-1213.907) (-1213.213) -- 0:00:52 161000 -- [-1213.609] (-1212.596) (-1214.565) (-1212.038) * (-1210.709) (-1210.266) (-1212.873) [-1212.113] -- 0:00:52 161500 -- (-1213.797) (-1212.159) (-1211.575) [-1210.919] * (-1211.079) (-1212.140) [-1212.649] (-1213.515) -- 0:00:51 162000 -- (-1212.693) [-1211.061] (-1211.775) (-1211.373) * (-1213.112) (-1212.415) (-1210.205) [-1211.788] -- 0:00:51 162500 -- (-1213.526) (-1214.023) [-1212.025] (-1211.918) * (-1213.707) (-1212.415) [-1210.071] (-1214.652) -- 0:00:51 163000 -- (-1212.480) [-1213.446] (-1212.427) (-1215.254) * (-1213.155) (-1212.182) [-1210.961] (-1212.492) -- 0:00:51 163500 -- (-1211.452) (-1213.772) (-1212.862) [-1211.752] * (-1211.561) [-1211.876] (-1211.386) (-1212.118) -- 0:00:51 164000 -- (-1210.918) (-1212.352) (-1217.356) [-1211.121] * (-1213.847) (-1211.477) [-1212.596] (-1210.050) -- 0:00:50 164500 -- (-1210.864) (-1213.108) (-1215.406) [-1211.285] * (-1212.375) (-1210.741) (-1212.425) [-1210.723] -- 0:00:50 165000 -- (-1212.987) (-1212.887) (-1218.447) [-1212.781] * (-1213.828) (-1211.238) (-1212.555) [-1213.104] -- 0:00:50 Average standard deviation of split frequencies: 0.018661 165500 -- [-1212.217] (-1213.488) (-1214.542) (-1211.520) * (-1212.777) [-1210.190] (-1213.441) (-1210.991) -- 0:00:50 166000 -- (-1212.476) (-1215.915) [-1212.060] (-1211.427) * (-1212.864) (-1212.367) (-1211.559) [-1210.984] -- 0:00:50 166500 -- (-1211.582) [-1212.877] (-1211.758) (-1212.506) * (-1218.523) (-1210.084) (-1211.925) [-1218.188] -- 0:00:50 167000 -- [-1213.327] (-1215.557) (-1211.659) (-1210.400) * (-1210.821) [-1212.407] (-1211.345) (-1214.417) -- 0:00:49 167500 -- (-1216.787) [-1215.035] (-1216.681) (-1212.430) * (-1211.585) [-1213.542] (-1212.157) (-1213.183) -- 0:00:49 168000 -- (-1214.073) (-1210.793) (-1218.599) [-1212.548] * (-1211.517) (-1215.134) (-1212.294) [-1211.631] -- 0:00:54 168500 -- [-1212.460] (-1213.021) (-1211.225) (-1214.015) * [-1211.100] (-1215.231) (-1212.135) (-1211.289) -- 0:00:54 169000 -- (-1214.180) (-1213.021) [-1212.546] (-1216.048) * (-1210.722) (-1213.445) (-1214.827) [-1212.545] -- 0:00:54 169500 -- [-1211.157] (-1212.013) (-1211.448) (-1212.442) * [-1210.122] (-1213.365) (-1211.748) (-1212.255) -- 0:00:53 170000 -- (-1212.440) [-1211.410] (-1213.024) (-1213.088) * [-1212.775] (-1211.349) (-1213.307) (-1211.444) -- 0:00:53 Average standard deviation of split frequencies: 0.016711 170500 -- (-1212.635) (-1211.667) (-1210.936) [-1213.852] * (-1223.507) (-1211.434) (-1214.709) [-1211.604] -- 0:00:53 171000 -- [-1211.130] (-1211.675) (-1210.049) (-1211.358) * (-1214.617) [-1211.349] (-1216.529) (-1211.420) -- 0:00:53 171500 -- (-1214.159) (-1211.976) (-1215.184) [-1212.488] * (-1212.923) (-1211.879) [-1213.880] (-1211.068) -- 0:00:53 172000 -- (-1212.110) [-1211.667] (-1217.848) (-1212.656) * [-1213.009] (-1215.583) (-1215.127) (-1211.157) -- 0:00:52 172500 -- [-1212.894] (-1212.114) (-1211.625) (-1213.463) * (-1214.685) (-1213.466) (-1214.966) [-1212.998] -- 0:00:52 173000 -- [-1213.640] (-1210.303) (-1213.628) (-1214.986) * (-1210.811) [-1210.732] (-1214.630) (-1212.802) -- 0:00:52 173500 -- [-1210.967] (-1212.173) (-1213.926) (-1214.043) * (-1211.622) [-1211.598] (-1213.786) (-1212.254) -- 0:00:52 174000 -- (-1210.813) (-1213.326) [-1210.264] (-1212.162) * [-1215.250] (-1211.852) (-1214.762) (-1213.807) -- 0:00:52 174500 -- (-1212.343) (-1210.616) [-1210.659] (-1212.881) * [-1213.818] (-1212.807) (-1213.498) (-1211.752) -- 0:00:52 175000 -- (-1215.205) [-1210.647] (-1212.407) (-1211.307) * (-1216.683) [-1210.410] (-1210.186) (-1214.590) -- 0:00:51 Average standard deviation of split frequencies: 0.015922 175500 -- [-1215.276] (-1210.643) (-1211.822) (-1214.664) * (-1211.536) [-1210.406] (-1211.254) (-1213.875) -- 0:00:51 176000 -- [-1212.488] (-1211.787) (-1210.733) (-1216.295) * (-1211.228) [-1211.965] (-1210.675) (-1213.777) -- 0:00:51 176500 -- (-1213.888) (-1212.113) [-1210.710] (-1215.355) * (-1210.696) (-1211.743) [-1210.604] (-1214.048) -- 0:00:51 177000 -- (-1212.727) (-1211.850) (-1214.992) [-1213.735] * (-1209.883) (-1211.805) [-1214.861] (-1212.375) -- 0:00:51 177500 -- (-1213.467) [-1211.880] (-1213.181) (-1214.047) * (-1211.739) (-1211.805) [-1213.781] (-1216.201) -- 0:00:50 178000 -- (-1217.293) (-1212.105) [-1214.824] (-1216.408) * (-1211.470) (-1211.187) [-1210.760] (-1213.031) -- 0:00:50 178500 -- (-1211.235) [-1210.974] (-1213.445) (-1216.035) * (-1210.153) [-1211.563] (-1212.819) (-1211.713) -- 0:00:50 179000 -- (-1212.562) [-1212.486] (-1213.755) (-1211.778) * (-1210.675) (-1211.959) [-1212.110] (-1211.866) -- 0:00:50 179500 -- (-1210.472) [-1212.713] (-1213.478) (-1210.387) * (-1210.230) (-1212.014) (-1211.495) [-1212.019] -- 0:00:50 180000 -- (-1211.797) [-1212.449] (-1211.981) (-1210.469) * [-1210.740] (-1211.550) (-1212.112) (-1211.593) -- 0:00:50 Average standard deviation of split frequencies: 0.015366 180500 -- [-1213.988] (-1214.439) (-1213.171) (-1210.701) * [-1210.423] (-1213.235) (-1211.314) (-1211.630) -- 0:00:49 181000 -- [-1214.710] (-1211.158) (-1211.835) (-1215.042) * [-1215.303] (-1213.408) (-1212.915) (-1211.979) -- 0:00:49 181500 -- (-1214.474) (-1211.886) (-1211.565) [-1213.521] * (-1214.832) (-1212.447) [-1211.732] (-1210.559) -- 0:00:49 182000 -- [-1212.717] (-1214.141) (-1212.164) (-1212.011) * (-1212.554) (-1211.875) (-1211.216) [-1210.945] -- 0:00:49 182500 -- [-1212.769] (-1213.791) (-1210.413) (-1212.040) * (-1211.413) (-1212.624) [-1211.937] (-1213.758) -- 0:00:49 183000 -- (-1213.684) (-1212.319) [-1214.397] (-1209.831) * [-1211.651] (-1213.290) (-1213.047) (-1213.896) -- 0:00:49 183500 -- (-1212.621) (-1213.466) (-1211.286) [-1210.227] * (-1213.280) (-1211.112) (-1218.465) [-1210.397] -- 0:00:48 184000 -- [-1212.334] (-1216.274) (-1216.135) (-1210.342) * (-1211.900) (-1211.936) (-1212.658) [-1210.017] -- 0:00:48 184500 -- (-1217.547) (-1213.715) (-1211.291) [-1210.357] * (-1211.721) [-1212.152] (-1212.578) (-1214.659) -- 0:00:53 185000 -- [-1211.011] (-1216.872) (-1210.063) (-1210.239) * [-1211.995] (-1212.027) (-1211.969) (-1211.867) -- 0:00:52 Average standard deviation of split frequencies: 0.015911 185500 -- [-1214.162] (-1211.868) (-1210.115) (-1210.184) * (-1215.128) (-1213.140) [-1212.481] (-1211.723) -- 0:00:52 186000 -- [-1211.928] (-1210.789) (-1215.286) (-1210.201) * (-1213.585) (-1214.744) [-1213.281] (-1210.768) -- 0:00:52 186500 -- (-1211.651) (-1212.193) [-1212.213] (-1210.599) * (-1211.890) [-1214.654] (-1211.528) (-1214.112) -- 0:00:52 187000 -- (-1212.309) (-1211.927) [-1211.393] (-1219.679) * (-1212.936) (-1212.580) (-1217.365) [-1210.504] -- 0:00:52 187500 -- (-1210.139) (-1216.104) [-1210.752] (-1215.547) * (-1209.994) (-1211.986) (-1218.144) [-1210.319] -- 0:00:52 188000 -- (-1212.115) (-1215.422) [-1212.850] (-1211.791) * (-1210.845) [-1210.894] (-1212.696) (-1210.936) -- 0:00:51 188500 -- (-1211.110) [-1214.653] (-1214.655) (-1217.910) * (-1213.179) (-1210.949) (-1213.791) [-1215.034] -- 0:00:51 189000 -- (-1211.350) (-1215.699) [-1210.035] (-1212.085) * (-1215.807) [-1212.306] (-1210.630) (-1210.981) -- 0:00:51 189500 -- [-1211.475] (-1214.401) (-1216.527) (-1213.577) * (-1211.779) (-1212.222) [-1212.202] (-1215.629) -- 0:00:51 190000 -- (-1211.257) [-1210.490] (-1212.330) (-1212.162) * (-1209.914) [-1212.239] (-1211.505) (-1216.537) -- 0:00:51 Average standard deviation of split frequencies: 0.015933 190500 -- (-1212.858) (-1212.952) [-1210.781] (-1214.055) * [-1215.381] (-1215.339) (-1215.006) (-1214.523) -- 0:00:50 191000 -- [-1210.792] (-1210.415) (-1211.361) (-1211.029) * (-1214.182) (-1214.718) [-1213.851] (-1210.630) -- 0:00:50 191500 -- (-1213.091) [-1212.883] (-1212.427) (-1211.566) * [-1213.666] (-1214.591) (-1213.340) (-1213.742) -- 0:00:50 192000 -- (-1211.990) [-1210.697] (-1211.341) (-1210.104) * (-1210.662) (-1212.804) (-1210.888) [-1211.932] -- 0:00:50 192500 -- (-1213.357) [-1210.690] (-1211.709) (-1212.809) * [-1212.072] (-1210.865) (-1212.217) (-1213.193) -- 0:00:50 193000 -- [-1214.689] (-1210.705) (-1212.544) (-1212.128) * (-1210.915) (-1212.603) [-1210.541] (-1212.096) -- 0:00:50 193500 -- [-1215.320] (-1214.480) (-1211.110) (-1212.153) * [-1210.704] (-1213.266) (-1216.064) (-1214.760) -- 0:00:50 194000 -- (-1213.785) [-1212.244] (-1210.904) (-1214.611) * (-1212.856) (-1216.672) [-1210.990] (-1216.014) -- 0:00:49 194500 -- (-1211.111) [-1212.499] (-1210.488) (-1211.893) * (-1212.257) [-1212.733] (-1212.127) (-1213.805) -- 0:00:49 195000 -- (-1214.644) (-1212.558) [-1211.417] (-1214.381) * (-1210.927) [-1217.315] (-1216.320) (-1215.104) -- 0:00:49 Average standard deviation of split frequencies: 0.015232 195500 -- (-1210.383) (-1211.826) [-1210.966] (-1211.954) * (-1213.303) [-1215.374] (-1212.811) (-1212.348) -- 0:00:49 196000 -- (-1211.804) (-1213.419) (-1211.109) [-1216.601] * (-1212.635) (-1219.671) [-1210.474] (-1214.117) -- 0:00:49 196500 -- (-1212.774) (-1210.948) [-1212.958] (-1211.831) * (-1211.792) (-1213.539) [-1210.436] (-1210.831) -- 0:00:49 197000 -- [-1212.075] (-1214.775) (-1211.485) (-1212.047) * (-1211.879) [-1213.223] (-1210.622) (-1210.439) -- 0:00:48 197500 -- (-1210.267) (-1211.745) (-1213.225) [-1211.317] * (-1212.037) [-1216.571] (-1211.740) (-1214.343) -- 0:00:48 198000 -- (-1214.239) (-1214.682) (-1212.101) [-1210.792] * [-1211.360] (-1214.674) (-1211.284) (-1210.782) -- 0:00:48 198500 -- (-1212.486) [-1213.241] (-1212.818) (-1210.581) * (-1212.895) [-1215.086] (-1210.296) (-1214.023) -- 0:00:48 199000 -- (-1211.564) [-1210.456] (-1212.867) (-1209.870) * (-1214.737) (-1214.091) (-1211.506) [-1212.191] -- 0:00:48 199500 -- (-1213.424) (-1210.225) (-1217.420) [-1210.963] * (-1215.493) (-1215.973) (-1212.555) [-1210.999] -- 0:00:48 200000 -- (-1211.143) (-1212.914) [-1213.158] (-1210.365) * (-1211.594) [-1212.606] (-1213.669) (-1211.629) -- 0:00:48 Average standard deviation of split frequencies: 0.015270 200500 -- (-1212.949) (-1211.749) [-1212.140] (-1213.758) * [-1211.504] (-1211.887) (-1212.230) (-1211.302) -- 0:00:51 201000 -- (-1214.033) [-1211.675] (-1211.883) (-1213.052) * (-1212.288) (-1214.348) (-1210.548) [-1211.461] -- 0:00:51 201500 -- (-1213.144) (-1210.983) [-1213.613] (-1214.152) * (-1213.979) [-1211.760] (-1211.285) (-1210.565) -- 0:00:51 202000 -- (-1213.611) (-1214.091) [-1211.115] (-1213.909) * (-1214.485) (-1211.189) [-1212.617] (-1210.508) -- 0:00:51 202500 -- (-1212.748) (-1212.235) [-1211.187] (-1213.183) * (-1210.249) [-1211.189] (-1213.053) (-1211.157) -- 0:00:51 203000 -- (-1212.310) (-1213.065) (-1214.908) [-1210.485] * (-1210.918) [-1210.876] (-1216.828) (-1210.036) -- 0:00:51 203500 -- (-1216.279) [-1214.116] (-1212.423) (-1210.605) * [-1210.160] (-1211.182) (-1217.152) (-1211.148) -- 0:00:50 204000 -- [-1212.923] (-1213.576) (-1211.053) (-1212.435) * (-1215.273) (-1211.283) (-1213.748) [-1210.262] -- 0:00:50 204500 -- (-1210.965) (-1212.368) (-1211.372) [-1210.875] * (-1211.474) (-1214.473) [-1214.418] (-1214.607) -- 0:00:50 205000 -- (-1214.766) (-1212.310) (-1211.415) [-1211.087] * [-1211.926] (-1211.117) (-1211.419) (-1212.514) -- 0:00:50 Average standard deviation of split frequencies: 0.014366 205500 -- (-1212.085) (-1211.654) (-1212.425) [-1214.306] * [-1212.350] (-1212.256) (-1210.164) (-1211.429) -- 0:00:50 206000 -- (-1214.225) (-1211.682) [-1214.705] (-1213.257) * (-1216.387) [-1212.526] (-1210.145) (-1210.668) -- 0:00:50 206500 -- (-1212.327) (-1213.940) (-1219.373) [-1211.709] * (-1212.233) (-1212.377) [-1210.161] (-1212.627) -- 0:00:49 207000 -- (-1212.420) [-1213.925] (-1212.595) (-1211.341) * (-1215.527) (-1211.124) (-1212.038) [-1210.888] -- 0:00:49 207500 -- (-1214.385) (-1212.539) [-1211.255] (-1215.049) * (-1214.293) (-1211.114) [-1210.742] (-1210.862) -- 0:00:49 208000 -- (-1211.584) [-1212.457] (-1211.236) (-1215.420) * (-1210.853) (-1210.798) [-1212.026] (-1211.539) -- 0:00:49 208500 -- [-1212.866] (-1211.542) (-1212.177) (-1214.367) * (-1212.711) [-1210.944] (-1210.352) (-1211.185) -- 0:00:49 209000 -- (-1212.178) (-1213.631) (-1213.462) [-1213.155] * [-1213.480] (-1212.073) (-1210.981) (-1212.994) -- 0:00:49 209500 -- [-1210.595] (-1210.644) (-1211.523) (-1214.655) * [-1213.228] (-1213.650) (-1210.045) (-1211.603) -- 0:00:49 210000 -- [-1213.345] (-1210.460) (-1212.876) (-1215.495) * (-1212.686) [-1212.393] (-1213.046) (-1213.220) -- 0:00:48 Average standard deviation of split frequencies: 0.013897 210500 -- [-1212.208] (-1212.892) (-1212.382) (-1213.689) * (-1213.947) (-1213.074) [-1213.286] (-1211.352) -- 0:00:48 211000 -- (-1213.739) (-1213.890) [-1215.411] (-1211.679) * (-1214.458) [-1214.083] (-1213.645) (-1212.805) -- 0:00:48 211500 -- (-1215.440) (-1211.006) (-1211.192) [-1212.448] * (-1218.464) [-1214.494] (-1211.786) (-1211.795) -- 0:00:48 212000 -- (-1211.609) (-1212.237) (-1212.022) [-1215.891] * (-1213.693) (-1213.203) (-1210.397) [-1211.537] -- 0:00:48 212500 -- (-1211.664) (-1214.426) [-1211.693] (-1215.657) * (-1212.170) (-1212.479) [-1210.913] (-1211.418) -- 0:00:48 213000 -- (-1215.030) (-1212.247) (-1210.414) [-1212.515] * [-1210.943] (-1210.326) (-1211.774) (-1210.211) -- 0:00:48 213500 -- [-1213.744] (-1211.770) (-1212.708) (-1213.036) * (-1210.936) (-1210.978) (-1210.722) [-1214.372] -- 0:00:47 214000 -- (-1214.449) (-1213.681) (-1211.702) [-1210.827] * (-1210.774) (-1212.403) [-1210.985] (-1213.520) -- 0:00:47 214500 -- (-1213.210) [-1214.543] (-1215.538) (-1211.362) * [-1214.614] (-1211.625) (-1213.080) (-1210.901) -- 0:00:47 215000 -- (-1211.646) (-1212.240) (-1213.991) [-1212.048] * (-1214.427) [-1211.730] (-1214.617) (-1212.203) -- 0:00:47 Average standard deviation of split frequencies: 0.012291 215500 -- (-1210.271) [-1210.086] (-1210.791) (-1212.096) * (-1211.549) (-1211.021) (-1211.782) [-1211.798] -- 0:00:47 216000 -- (-1211.489) (-1210.208) (-1211.661) [-1211.335] * (-1213.034) (-1211.896) [-1217.805] (-1211.597) -- 0:00:50 216500 -- [-1210.806] (-1210.210) (-1211.685) (-1212.690) * (-1211.697) (-1214.116) [-1216.279] (-1215.906) -- 0:00:50 217000 -- (-1210.828) (-1211.716) [-1211.624] (-1211.296) * (-1213.300) (-1213.209) (-1213.248) [-1211.629] -- 0:00:50 217500 -- (-1210.444) (-1211.855) (-1214.990) [-1212.162] * [-1212.822] (-1215.171) (-1211.248) (-1213.004) -- 0:00:50 218000 -- [-1210.424] (-1210.704) (-1213.746) (-1213.103) * (-1210.908) [-1214.460] (-1212.766) (-1212.494) -- 0:00:50 218500 -- (-1210.276) [-1211.346] (-1213.141) (-1210.628) * (-1211.170) (-1212.046) [-1211.227] (-1211.263) -- 0:00:50 219000 -- [-1211.081] (-1211.319) (-1213.513) (-1210.997) * [-1211.352] (-1212.282) (-1211.683) (-1211.638) -- 0:00:49 219500 -- (-1218.201) (-1211.517) [-1210.424] (-1211.322) * (-1212.570) (-1212.706) (-1210.011) [-1210.514] -- 0:00:49 220000 -- (-1218.333) (-1211.725) (-1211.476) [-1212.026] * (-1215.779) (-1210.598) [-1216.102] (-1211.942) -- 0:00:49 Average standard deviation of split frequencies: 0.012106 220500 -- (-1213.910) (-1211.480) [-1211.276] (-1211.915) * (-1215.029) [-1216.857] (-1211.123) (-1212.080) -- 0:00:49 221000 -- (-1216.094) (-1211.716) (-1211.143) [-1210.415] * [-1213.404] (-1211.206) (-1211.114) (-1212.257) -- 0:00:49 221500 -- (-1214.680) (-1214.553) [-1213.642] (-1210.537) * [-1211.936] (-1213.877) (-1211.714) (-1217.443) -- 0:00:49 222000 -- [-1211.687] (-1210.644) (-1212.676) (-1215.956) * (-1212.258) (-1213.611) (-1213.059) [-1213.483] -- 0:00:49 222500 -- [-1210.319] (-1210.585) (-1210.759) (-1211.975) * (-1212.157) [-1213.622] (-1211.085) (-1211.797) -- 0:00:48 223000 -- [-1212.764] (-1212.023) (-1211.056) (-1210.568) * (-1212.376) [-1213.214] (-1210.632) (-1215.038) -- 0:00:48 223500 -- (-1214.798) (-1210.339) [-1211.371] (-1212.307) * (-1212.834) (-1212.652) [-1210.268] (-1211.027) -- 0:00:48 224000 -- (-1217.108) [-1212.511] (-1211.566) (-1210.897) * [-1213.384] (-1211.153) (-1210.608) (-1211.419) -- 0:00:48 224500 -- (-1212.245) [-1215.780] (-1211.816) (-1214.223) * (-1212.375) (-1216.049) (-1209.958) [-1211.763] -- 0:00:48 225000 -- (-1213.614) (-1212.093) [-1213.299] (-1212.330) * (-1210.520) (-1213.913) [-1210.228] (-1213.351) -- 0:00:48 Average standard deviation of split frequencies: 0.012405 225500 -- (-1214.452) (-1212.890) (-1213.725) [-1214.326] * [-1210.076] (-1212.289) (-1210.303) (-1217.766) -- 0:00:48 226000 -- [-1215.162] (-1217.160) (-1211.087) (-1212.064) * (-1211.319) [-1210.717] (-1211.334) (-1215.603) -- 0:00:47 226500 -- (-1215.752) (-1215.922) (-1211.928) [-1212.926] * (-1210.542) [-1211.969] (-1210.938) (-1213.799) -- 0:00:47 227000 -- (-1211.578) (-1214.899) (-1210.434) [-1211.577] * (-1211.059) [-1211.426] (-1212.980) (-1213.420) -- 0:00:47 227500 -- (-1212.966) (-1213.092) (-1211.783) [-1210.668] * (-1210.938) (-1214.459) (-1212.980) [-1214.614] -- 0:00:47 228000 -- [-1211.307] (-1215.223) (-1210.989) (-1212.428) * (-1213.303) (-1210.360) (-1212.654) [-1211.076] -- 0:00:47 228500 -- (-1214.670) (-1213.667) [-1210.011] (-1211.557) * (-1212.790) (-1212.419) (-1215.083) [-1213.227] -- 0:00:47 229000 -- (-1214.010) (-1214.413) [-1210.363] (-1210.756) * [-1213.520] (-1210.471) (-1213.221) (-1214.414) -- 0:00:47 229500 -- (-1214.553) [-1210.881] (-1210.219) (-1212.017) * [-1212.830] (-1210.481) (-1213.220) (-1212.111) -- 0:00:47 230000 -- (-1214.838) (-1210.881) [-1211.495] (-1210.847) * [-1214.474] (-1210.655) (-1211.817) (-1213.162) -- 0:00:46 Average standard deviation of split frequencies: 0.012569 230500 -- [-1212.403] (-1211.140) (-1213.653) (-1210.582) * (-1212.520) [-1210.407] (-1210.511) (-1210.846) -- 0:00:46 231000 -- (-1214.148) (-1210.557) (-1211.521) [-1211.756] * (-1212.705) [-1209.998] (-1210.368) (-1211.448) -- 0:00:46 231500 -- (-1212.750) [-1210.798] (-1214.191) (-1210.286) * (-1211.925) [-1210.282] (-1212.881) (-1211.098) -- 0:00:46 232000 -- [-1212.611] (-1214.389) (-1211.657) (-1211.152) * (-1212.694) (-1210.449) (-1211.203) [-1214.587] -- 0:00:49 232500 -- (-1211.838) (-1212.103) (-1213.114) [-1211.455] * (-1213.507) [-1210.883] (-1212.813) (-1212.942) -- 0:00:49 233000 -- (-1212.600) (-1214.077) [-1212.253] (-1212.681) * (-1212.045) (-1211.744) [-1212.232] (-1210.813) -- 0:00:49 233500 -- [-1212.162] (-1211.339) (-1211.779) (-1211.889) * (-1210.947) (-1212.160) [-1212.471] (-1210.558) -- 0:00:49 234000 -- (-1214.710) (-1216.155) [-1212.773] (-1210.880) * (-1212.523) [-1211.560] (-1214.462) (-1219.367) -- 0:00:49 234500 -- (-1212.326) [-1214.703] (-1211.474) (-1211.556) * (-1211.304) [-1212.499] (-1213.539) (-1213.844) -- 0:00:48 235000 -- (-1211.910) (-1210.617) [-1210.881] (-1213.227) * (-1210.201) (-1213.711) [-1210.558] (-1213.360) -- 0:00:48 Average standard deviation of split frequencies: 0.010618 235500 -- (-1216.987) (-1212.919) (-1211.365) [-1212.615] * (-1210.874) (-1214.687) [-1210.609] (-1215.273) -- 0:00:48 236000 -- [-1211.266] (-1212.167) (-1211.184) (-1213.252) * [-1213.513] (-1218.354) (-1216.428) (-1218.661) -- 0:00:48 236500 -- (-1213.281) (-1215.102) (-1211.842) [-1211.300] * (-1215.024) (-1218.338) (-1211.498) [-1212.429] -- 0:00:48 237000 -- (-1213.515) [-1213.516] (-1214.941) (-1210.381) * [-1211.205] (-1216.603) (-1211.349) (-1218.721) -- 0:00:48 237500 -- (-1212.627) (-1211.725) (-1216.652) [-1210.328] * (-1210.176) (-1217.578) [-1211.266] (-1212.576) -- 0:00:48 238000 -- (-1210.816) [-1211.303] (-1214.142) (-1211.607) * (-1210.176) (-1214.877) [-1213.018] (-1212.275) -- 0:00:48 238500 -- [-1210.590] (-1211.248) (-1218.084) (-1212.194) * (-1211.383) (-1216.728) (-1211.003) [-1214.463] -- 0:00:47 239000 -- (-1210.843) [-1212.137] (-1214.342) (-1212.167) * (-1212.294) (-1212.753) [-1210.547] (-1212.698) -- 0:00:47 239500 -- (-1213.412) (-1210.391) [-1211.846] (-1211.782) * [-1213.763] (-1213.177) (-1213.286) (-1212.408) -- 0:00:47 240000 -- (-1210.502) (-1210.572) (-1210.591) [-1214.597] * [-1213.603] (-1211.643) (-1210.491) (-1211.056) -- 0:00:47 Average standard deviation of split frequencies: 0.012165 240500 -- [-1213.018] (-1214.467) (-1210.580) (-1212.983) * (-1212.885) (-1211.945) [-1212.896] (-1211.701) -- 0:00:47 241000 -- (-1211.781) (-1214.633) [-1211.399] (-1213.046) * (-1215.563) (-1211.663) [-1212.159] (-1212.813) -- 0:00:47 241500 -- (-1217.349) (-1217.544) [-1210.750] (-1210.921) * (-1213.143) (-1211.186) [-1212.161] (-1211.557) -- 0:00:47 242000 -- [-1216.511] (-1210.608) (-1211.634) (-1211.055) * (-1211.151) [-1210.804] (-1210.339) (-1211.325) -- 0:00:46 242500 -- [-1212.139] (-1212.190) (-1211.399) (-1212.585) * (-1210.546) (-1211.558) (-1215.642) [-1212.027] -- 0:00:46 243000 -- [-1212.723] (-1211.931) (-1214.930) (-1212.635) * (-1211.366) (-1210.081) (-1210.405) [-1211.206] -- 0:00:46 243500 -- (-1214.133) (-1211.475) (-1211.897) [-1212.606] * (-1211.427) (-1210.090) (-1212.624) [-1210.272] -- 0:00:46 244000 -- (-1216.553) (-1213.937) (-1212.561) [-1210.183] * [-1214.763] (-1214.776) (-1211.463) (-1211.882) -- 0:00:46 244500 -- (-1214.235) [-1211.994] (-1210.947) (-1210.718) * (-1218.284) [-1212.927] (-1212.586) (-1212.555) -- 0:00:46 245000 -- (-1212.047) [-1210.770] (-1210.703) (-1214.706) * (-1212.984) (-1211.469) [-1214.674] (-1215.066) -- 0:00:46 Average standard deviation of split frequencies: 0.011498 245500 -- (-1211.785) (-1211.726) (-1214.079) [-1211.159] * (-1214.665) [-1211.088] (-1214.797) (-1210.867) -- 0:00:46 246000 -- (-1213.085) [-1212.375] (-1210.494) (-1212.647) * (-1210.719) (-1211.826) (-1217.106) [-1211.277] -- 0:00:45 246500 -- [-1212.160] (-1213.065) (-1211.166) (-1210.824) * (-1212.920) (-1213.733) [-1211.728] (-1211.581) -- 0:00:45 247000 -- (-1211.795) (-1212.431) (-1211.679) [-1211.347] * (-1212.903) (-1216.546) [-1211.754] (-1212.589) -- 0:00:45 247500 -- (-1210.650) (-1211.347) (-1210.497) [-1213.447] * [-1212.042] (-1212.087) (-1213.098) (-1213.726) -- 0:00:45 248000 -- (-1213.455) (-1212.653) [-1210.849] (-1211.522) * (-1210.477) [-1210.811] (-1213.344) (-1215.219) -- 0:00:45 248500 -- (-1212.486) [-1212.368] (-1212.652) (-1216.031) * [-1212.664] (-1211.941) (-1217.071) (-1213.599) -- 0:00:48 249000 -- [-1213.445] (-1214.587) (-1211.984) (-1211.605) * (-1213.469) (-1211.702) [-1211.892] (-1214.142) -- 0:00:48 249500 -- (-1214.029) (-1210.968) (-1212.593) [-1210.578] * (-1214.599) (-1212.154) [-1213.654] (-1213.755) -- 0:00:48 250000 -- [-1213.666] (-1212.499) (-1212.615) (-1211.851) * (-1214.996) (-1214.004) (-1212.792) [-1213.427] -- 0:00:48 Average standard deviation of split frequencies: 0.011877 250500 -- (-1213.331) (-1213.665) [-1210.880] (-1212.473) * (-1211.727) (-1219.509) (-1211.110) [-1213.653] -- 0:00:47 251000 -- [-1212.269] (-1212.948) (-1211.648) (-1213.762) * (-1213.518) (-1211.149) (-1215.039) [-1222.090] -- 0:00:47 251500 -- (-1216.813) [-1214.460] (-1211.742) (-1214.015) * (-1213.784) (-1211.972) (-1219.791) [-1211.939] -- 0:00:47 252000 -- (-1214.018) (-1213.907) [-1211.877] (-1210.762) * (-1213.017) [-1212.675] (-1213.527) (-1210.104) -- 0:00:47 252500 -- (-1211.127) (-1214.322) (-1211.690) [-1211.194] * (-1210.551) (-1211.215) [-1214.347] (-1214.370) -- 0:00:47 253000 -- (-1211.617) (-1217.887) [-1211.616] (-1214.720) * (-1211.091) [-1210.427] (-1215.918) (-1212.393) -- 0:00:47 253500 -- (-1212.301) (-1211.728) [-1211.448] (-1212.809) * (-1210.013) (-1211.955) [-1213.042] (-1212.787) -- 0:00:47 254000 -- (-1215.384) (-1211.480) (-1211.175) [-1211.367] * (-1210.013) (-1212.637) [-1212.761] (-1214.870) -- 0:00:46 254500 -- (-1214.408) (-1213.556) [-1212.044] (-1211.590) * (-1211.901) [-1212.482] (-1212.738) (-1215.658) -- 0:00:46 255000 -- (-1214.570) (-1212.037) (-1215.202) [-1214.642] * (-1215.602) (-1210.954) (-1213.032) [-1214.641] -- 0:00:46 Average standard deviation of split frequencies: 0.012992 255500 -- [-1217.375] (-1212.039) (-1213.294) (-1214.510) * [-1210.863] (-1214.534) (-1214.324) (-1211.738) -- 0:00:46 256000 -- (-1214.913) [-1211.792] (-1212.487) (-1213.087) * (-1212.888) [-1211.278] (-1212.711) (-1216.940) -- 0:00:46 256500 -- (-1210.397) (-1211.189) [-1210.205] (-1214.556) * (-1214.728) (-1211.473) (-1213.517) [-1212.746] -- 0:00:46 257000 -- (-1210.470) (-1210.818) (-1211.216) [-1210.045] * (-1216.029) (-1218.063) (-1211.855) [-1211.582] -- 0:00:46 257500 -- (-1211.236) (-1211.973) [-1210.501] (-1210.891) * (-1214.874) [-1210.990] (-1211.177) (-1215.030) -- 0:00:46 258000 -- (-1212.989) [-1210.286] (-1211.503) (-1212.938) * (-1214.409) (-1210.279) [-1210.215] (-1216.284) -- 0:00:46 258500 -- (-1214.923) [-1214.117] (-1211.638) (-1214.788) * (-1213.090) [-1213.888] (-1212.401) (-1211.247) -- 0:00:45 259000 -- (-1212.103) (-1214.347) (-1212.655) [-1212.547] * (-1210.740) [-1214.198] (-1212.201) (-1210.055) -- 0:00:45 259500 -- (-1215.703) (-1211.644) [-1212.524] (-1213.094) * (-1210.174) (-1212.186) (-1211.474) [-1211.654] -- 0:00:45 260000 -- (-1217.305) [-1210.970] (-1216.317) (-1210.713) * (-1210.766) (-1211.330) [-1213.167] (-1211.430) -- 0:00:45 Average standard deviation of split frequencies: 0.013563 260500 -- (-1215.115) (-1210.097) (-1212.099) [-1211.733] * (-1213.796) (-1210.377) (-1211.647) [-1210.732] -- 0:00:45 261000 -- [-1212.710] (-1213.992) (-1210.348) (-1210.411) * (-1215.752) (-1210.216) [-1213.193] (-1212.639) -- 0:00:45 261500 -- (-1212.698) (-1213.981) (-1212.966) [-1209.803] * [-1213.048] (-1210.938) (-1213.132) (-1210.445) -- 0:00:45 262000 -- (-1212.165) (-1210.044) (-1211.012) [-1209.803] * (-1215.085) (-1210.240) (-1214.052) [-1212.109] -- 0:00:45 262500 -- (-1214.588) [-1211.296] (-1215.646) (-1211.267) * (-1210.509) [-1213.468] (-1212.861) (-1215.370) -- 0:00:44 263000 -- (-1212.503) [-1212.386] (-1210.830) (-1212.854) * [-1210.512] (-1213.874) (-1213.906) (-1216.494) -- 0:00:44 263500 -- (-1211.121) [-1212.591] (-1214.044) (-1211.907) * (-1211.195) [-1210.209] (-1213.602) (-1214.805) -- 0:00:44 264000 -- (-1212.139) (-1211.666) (-1210.121) [-1210.936] * (-1211.250) (-1211.441) (-1212.285) [-1211.188] -- 0:00:44 264500 -- (-1214.843) (-1211.726) (-1210.119) [-1210.984] * (-1212.687) (-1218.233) [-1211.799] (-1210.715) -- 0:00:47 265000 -- (-1217.992) (-1211.003) [-1210.919] (-1210.989) * [-1213.148] (-1221.807) (-1213.144) (-1211.594) -- 0:00:47 Average standard deviation of split frequencies: 0.012405 265500 -- (-1212.122) (-1211.076) [-1212.380] (-1211.948) * (-1211.718) [-1213.774] (-1210.772) (-1211.600) -- 0:00:47 266000 -- (-1219.352) (-1213.845) [-1212.387] (-1210.030) * (-1213.357) (-1211.104) [-1210.515] (-1215.334) -- 0:00:46 266500 -- (-1216.882) (-1212.195) (-1212.859) [-1210.682] * (-1215.204) (-1214.329) (-1213.043) [-1215.847] -- 0:00:46 267000 -- (-1213.086) [-1212.791] (-1211.773) (-1210.452) * [-1210.721] (-1211.808) (-1218.726) (-1218.183) -- 0:00:46 267500 -- [-1210.368] (-1211.575) (-1212.148) (-1211.934) * [-1212.951] (-1210.615) (-1216.374) (-1213.650) -- 0:00:46 268000 -- (-1211.985) [-1211.367] (-1212.501) (-1211.384) * (-1214.201) (-1213.150) [-1213.569] (-1210.748) -- 0:00:46 268500 -- (-1212.173) (-1210.601) [-1212.889] (-1211.732) * (-1212.514) [-1211.976] (-1211.891) (-1212.220) -- 0:00:46 269000 -- [-1211.312] (-1211.355) (-1221.588) (-1211.659) * (-1213.867) (-1212.701) [-1211.341] (-1212.496) -- 0:00:46 269500 -- (-1210.008) (-1211.634) (-1214.682) [-1213.326] * (-1210.884) [-1210.921] (-1212.212) (-1213.142) -- 0:00:46 270000 -- (-1210.405) (-1211.127) [-1215.072] (-1215.298) * (-1215.636) [-1213.043] (-1210.271) (-1213.288) -- 0:00:45 Average standard deviation of split frequencies: 0.012283 270500 -- [-1214.774] (-1212.698) (-1210.910) (-1210.921) * (-1212.525) (-1212.999) [-1212.606] (-1213.231) -- 0:00:45 271000 -- (-1219.874) (-1211.110) (-1215.541) [-1210.291] * [-1212.053] (-1216.658) (-1213.233) (-1214.403) -- 0:00:45 271500 -- (-1220.043) [-1211.184] (-1213.706) (-1212.467) * [-1210.777] (-1214.184) (-1212.801) (-1210.458) -- 0:00:45 272000 -- [-1211.361] (-1210.914) (-1210.623) (-1211.269) * (-1212.491) (-1214.155) (-1213.257) [-1213.819] -- 0:00:45 272500 -- (-1213.955) (-1213.280) [-1210.242] (-1215.381) * (-1212.134) (-1214.206) [-1214.235] (-1213.245) -- 0:00:45 273000 -- (-1212.327) (-1213.573) [-1213.938] (-1210.652) * [-1213.194] (-1214.219) (-1213.036) (-1212.195) -- 0:00:45 273500 -- [-1211.424] (-1213.809) (-1212.411) (-1210.614) * (-1215.688) (-1212.531) [-1214.243] (-1212.814) -- 0:00:45 274000 -- [-1212.704] (-1216.833) (-1211.850) (-1212.226) * (-1215.935) [-1212.871] (-1210.523) (-1212.418) -- 0:00:45 274500 -- (-1211.728) (-1219.656) (-1213.862) [-1213.635] * (-1215.510) (-1212.195) (-1210.722) [-1212.358] -- 0:00:44 275000 -- [-1211.678] (-1215.322) (-1212.198) (-1215.388) * (-1212.420) (-1215.476) (-1212.809) [-1212.588] -- 0:00:44 Average standard deviation of split frequencies: 0.011237 275500 -- (-1211.079) (-1214.519) [-1211.550] (-1215.474) * [-1212.182] (-1212.686) (-1211.655) (-1214.292) -- 0:00:44 276000 -- (-1214.607) [-1214.219] (-1210.669) (-1212.898) * (-1213.338) [-1210.903] (-1211.229) (-1213.431) -- 0:00:44 276500 -- (-1213.287) (-1212.534) (-1210.159) [-1211.342] * (-1212.429) (-1218.198) (-1210.817) [-1213.141] -- 0:00:44 277000 -- (-1213.218) (-1213.076) [-1210.146] (-1212.382) * (-1216.226) (-1214.355) [-1212.200] (-1210.728) -- 0:00:44 277500 -- (-1210.845) (-1213.523) (-1217.101) [-1212.358] * [-1210.534] (-1212.128) (-1211.438) (-1211.582) -- 0:00:44 278000 -- (-1210.068) [-1211.914] (-1216.449) (-1213.163) * (-1211.674) (-1214.021) [-1210.558] (-1211.620) -- 0:00:44 278500 -- (-1212.229) (-1210.729) [-1214.029] (-1212.258) * (-1211.273) (-1218.413) (-1212.988) [-1211.745] -- 0:00:44 279000 -- (-1214.089) [-1210.116] (-1213.642) (-1212.271) * (-1211.160) [-1212.321] (-1211.767) (-1212.501) -- 0:00:43 279500 -- [-1211.020] (-1210.340) (-1211.529) (-1213.853) * [-1211.339] (-1211.344) (-1212.896) (-1213.236) -- 0:00:43 280000 -- (-1210.869) (-1210.284) (-1212.620) [-1210.785] * [-1212.213] (-1213.319) (-1211.920) (-1211.770) -- 0:00:43 Average standard deviation of split frequencies: 0.011533 280500 -- [-1211.493] (-1212.262) (-1215.644) (-1211.330) * (-1214.493) (-1212.287) [-1214.585] (-1213.279) -- 0:00:46 281000 -- (-1213.389) (-1212.016) (-1214.344) [-1210.175] * (-1218.143) (-1210.999) [-1211.128] (-1215.493) -- 0:00:46 281500 -- (-1211.493) (-1212.016) [-1211.127] (-1214.259) * (-1218.474) (-1211.777) [-1210.679] (-1213.448) -- 0:00:45 282000 -- (-1215.941) [-1214.722] (-1212.582) (-1213.600) * (-1212.515) [-1211.403] (-1211.130) (-1211.650) -- 0:00:45 282500 -- (-1217.036) (-1212.438) (-1211.912) [-1213.075] * (-1212.976) (-1213.956) [-1210.750] (-1211.810) -- 0:00:45 283000 -- (-1213.470) (-1210.982) [-1211.612] (-1210.568) * [-1211.781] (-1212.248) (-1210.814) (-1211.192) -- 0:00:45 283500 -- [-1213.093] (-1210.026) (-1211.282) (-1211.471) * (-1210.253) (-1215.662) (-1213.423) [-1210.393] -- 0:00:45 284000 -- (-1211.731) (-1210.139) (-1210.892) [-1212.050] * [-1210.603] (-1215.250) (-1212.359) (-1210.838) -- 0:00:45 284500 -- (-1210.784) (-1211.262) (-1213.047) [-1212.164] * (-1210.518) [-1211.577] (-1212.276) (-1210.523) -- 0:00:45 285000 -- (-1211.875) (-1212.642) (-1211.932) [-1213.405] * (-1210.210) (-1213.092) (-1211.273) [-1211.434] -- 0:00:45 Average standard deviation of split frequencies: 0.011150 285500 -- (-1211.709) (-1210.711) (-1212.822) [-1210.191] * (-1210.166) (-1211.947) (-1211.181) [-1212.714] -- 0:00:45 286000 -- (-1213.922) (-1210.784) (-1213.640) [-1210.582] * (-1210.573) (-1211.481) [-1210.666] (-1213.869) -- 0:00:44 286500 -- [-1210.794] (-1211.979) (-1211.466) (-1211.235) * [-1214.657] (-1209.874) (-1211.137) (-1212.387) -- 0:00:44 287000 -- (-1213.568) (-1211.463) (-1212.326) [-1211.193] * (-1213.687) [-1211.633] (-1212.634) (-1212.240) -- 0:00:44 287500 -- (-1213.675) [-1210.989] (-1212.839) (-1211.331) * (-1214.892) [-1210.976] (-1214.565) (-1214.237) -- 0:00:44 288000 -- (-1213.422) (-1212.048) [-1211.557] (-1210.906) * (-1219.583) (-1212.633) (-1211.105) [-1211.020] -- 0:00:44 288500 -- [-1213.799] (-1213.814) (-1211.478) (-1211.373) * (-1213.642) (-1214.152) [-1211.690] (-1210.329) -- 0:00:44 289000 -- [-1211.914] (-1213.655) (-1210.621) (-1212.167) * (-1211.942) (-1210.392) (-1214.660) [-1212.216] -- 0:00:44 289500 -- (-1211.210) [-1211.078] (-1210.097) (-1210.770) * (-1213.803) (-1210.589) (-1212.098) [-1211.451] -- 0:00:44 290000 -- (-1210.862) (-1210.184) (-1210.104) [-1212.985] * (-1212.549) (-1213.509) (-1214.278) [-1215.036] -- 0:00:44 Average standard deviation of split frequencies: 0.010992 290500 -- [-1210.487] (-1215.668) (-1210.626) (-1214.916) * [-1211.760] (-1213.963) (-1212.341) (-1214.379) -- 0:00:43 291000 -- (-1210.842) (-1212.488) (-1210.405) [-1214.574] * (-1211.459) [-1214.253] (-1214.173) (-1215.354) -- 0:00:43 291500 -- (-1216.503) (-1216.298) [-1212.794] (-1211.959) * (-1211.173) (-1212.516) (-1214.146) [-1212.883] -- 0:00:43 292000 -- [-1213.560] (-1213.058) (-1212.785) (-1212.418) * [-1213.575] (-1217.335) (-1212.843) (-1213.297) -- 0:00:43 292500 -- [-1213.059] (-1212.542) (-1211.410) (-1214.477) * (-1210.002) (-1216.959) (-1211.991) [-1211.782] -- 0:00:43 293000 -- (-1214.485) (-1212.376) [-1210.983] (-1211.237) * (-1210.265) (-1214.879) [-1212.805] (-1213.469) -- 0:00:43 293500 -- (-1212.049) (-1215.145) [-1210.677] (-1212.632) * [-1210.266] (-1213.424) (-1211.928) (-1210.368) -- 0:00:43 294000 -- (-1212.706) (-1212.473) (-1210.836) [-1212.302] * (-1210.054) (-1214.174) [-1214.145] (-1211.357) -- 0:00:43 294500 -- (-1212.173) (-1213.352) [-1212.734] (-1213.697) * (-1209.980) (-1214.218) [-1214.561] (-1213.281) -- 0:00:43 295000 -- (-1212.478) (-1210.704) [-1211.929] (-1215.541) * (-1210.805) (-1213.206) (-1215.510) [-1211.509] -- 0:00:43 Average standard deviation of split frequencies: 0.010961 295500 -- (-1210.900) (-1212.102) (-1211.921) [-1213.844] * (-1212.513) (-1211.018) [-1210.418] (-1211.479) -- 0:00:42 296000 -- (-1213.282) (-1215.389) [-1214.464] (-1210.766) * [-1214.272] (-1210.648) (-1210.885) (-1214.533) -- 0:00:42 296500 -- (-1213.877) (-1212.847) [-1210.911] (-1215.638) * (-1212.424) (-1210.766) [-1210.609] (-1213.649) -- 0:00:45 297000 -- (-1214.799) (-1214.748) [-1212.123] (-1210.525) * (-1211.448) [-1211.523] (-1211.488) (-1211.099) -- 0:00:44 297500 -- (-1211.681) (-1216.284) (-1212.212) [-1214.198] * (-1212.967) [-1210.724] (-1211.570) (-1214.879) -- 0:00:44 298000 -- (-1211.556) [-1214.132] (-1211.104) (-1210.151) * (-1212.478) [-1210.795] (-1211.726) (-1213.334) -- 0:00:44 298500 -- (-1213.341) [-1210.318] (-1211.266) (-1212.242) * (-1210.644) (-1213.366) (-1212.242) [-1210.825] -- 0:00:44 299000 -- [-1209.990] (-1210.636) (-1210.994) (-1211.114) * (-1211.546) (-1211.955) (-1213.261) [-1210.719] -- 0:00:44 299500 -- (-1213.225) [-1211.355] (-1211.456) (-1212.701) * [-1212.785] (-1211.391) (-1213.646) (-1211.754) -- 0:00:44 300000 -- (-1211.198) (-1211.382) [-1211.450] (-1213.202) * (-1213.096) (-1216.064) [-1214.452] (-1212.303) -- 0:00:44 Average standard deviation of split frequencies: 0.010883 300500 -- [-1211.936] (-1212.052) (-1214.602) (-1214.764) * (-1215.724) [-1210.450] (-1214.839) (-1211.679) -- 0:00:44 301000 -- [-1210.253] (-1211.690) (-1212.222) (-1212.746) * (-1214.108) (-1213.908) (-1215.026) [-1211.601] -- 0:00:44 301500 -- [-1212.258] (-1211.369) (-1211.739) (-1213.671) * (-1213.275) (-1213.073) [-1212.474] (-1211.207) -- 0:00:44 302000 -- (-1210.985) (-1211.592) (-1210.138) [-1210.313] * (-1214.198) (-1212.531) [-1211.038] (-1210.860) -- 0:00:43 302500 -- [-1210.985] (-1210.548) (-1212.770) (-1211.574) * [-1218.272] (-1210.663) (-1211.521) (-1214.258) -- 0:00:43 303000 -- [-1211.465] (-1210.518) (-1213.390) (-1215.564) * (-1212.196) (-1210.643) (-1212.341) [-1211.198] -- 0:00:43 303500 -- (-1213.258) [-1210.994] (-1211.549) (-1215.754) * (-1211.864) (-1210.971) [-1213.682] (-1211.607) -- 0:00:43 304000 -- (-1210.490) (-1211.556) [-1212.943] (-1214.986) * (-1211.527) [-1212.914] (-1216.176) (-1212.514) -- 0:00:43 304500 -- [-1210.636] (-1210.804) (-1211.040) (-1220.036) * (-1212.528) [-1210.571] (-1213.498) (-1213.160) -- 0:00:43 305000 -- (-1211.207) (-1210.609) (-1211.339) [-1215.523] * (-1213.007) [-1213.254] (-1213.199) (-1211.605) -- 0:00:43 Average standard deviation of split frequencies: 0.010965 305500 -- [-1211.903] (-1212.183) (-1210.722) (-1214.108) * (-1211.692) (-1210.621) (-1213.099) [-1211.854] -- 0:00:43 306000 -- [-1210.881] (-1212.522) (-1212.207) (-1213.389) * (-1211.458) (-1210.183) (-1213.838) [-1212.252] -- 0:00:43 306500 -- (-1211.009) (-1212.335) [-1212.345] (-1211.031) * (-1212.706) (-1211.726) (-1213.580) [-1210.915] -- 0:00:42 307000 -- [-1210.512] (-1210.746) (-1211.819) (-1211.697) * (-1212.221) (-1211.599) [-1214.209] (-1215.964) -- 0:00:42 307500 -- (-1212.128) (-1213.325) [-1210.729] (-1218.060) * (-1214.780) (-1213.404) [-1210.727] (-1213.133) -- 0:00:42 308000 -- (-1212.128) (-1212.274) (-1210.227) [-1212.660] * (-1212.017) [-1211.929] (-1212.593) (-1211.347) -- 0:00:42 308500 -- (-1216.455) (-1211.691) [-1212.218] (-1210.091) * (-1212.125) [-1212.044] (-1210.993) (-1212.808) -- 0:00:42 309000 -- (-1215.021) (-1212.581) (-1213.314) [-1214.077] * (-1212.107) (-1212.099) [-1212.459] (-1212.842) -- 0:00:42 309500 -- (-1215.762) (-1210.900) (-1213.747) [-1211.534] * (-1213.398) (-1212.022) [-1212.476] (-1213.261) -- 0:00:42 310000 -- (-1215.650) (-1214.520) (-1215.935) [-1211.152] * (-1211.833) (-1214.618) (-1212.755) [-1214.783] -- 0:00:42 Average standard deviation of split frequencies: 0.011570 310500 -- (-1214.384) (-1213.911) [-1211.387] (-1210.001) * (-1213.651) (-1211.018) [-1214.474] (-1216.381) -- 0:00:42 311000 -- (-1210.824) (-1212.968) (-1213.197) [-1210.816] * (-1212.302) [-1210.263] (-1212.226) (-1212.065) -- 0:00:42 311500 -- (-1211.924) (-1212.505) [-1213.360] (-1210.762) * (-1212.046) (-1217.229) [-1210.006] (-1212.546) -- 0:00:41 312000 -- (-1209.904) [-1213.486] (-1212.756) (-1211.051) * (-1211.386) (-1217.320) [-1210.934] (-1211.807) -- 0:00:41 312500 -- [-1210.895] (-1210.562) (-1212.855) (-1212.100) * (-1214.385) (-1214.781) (-1212.487) [-1212.853] -- 0:00:44 313000 -- [-1211.170] (-1213.349) (-1210.853) (-1214.480) * (-1215.489) (-1213.720) (-1210.269) [-1210.651] -- 0:00:43 313500 -- [-1210.314] (-1211.344) (-1212.463) (-1215.489) * (-1213.699) (-1213.724) (-1210.884) [-1210.686] -- 0:00:43 314000 -- [-1212.292] (-1210.397) (-1211.409) (-1211.408) * (-1212.942) (-1214.412) (-1212.931) [-1210.095] -- 0:00:43 314500 -- (-1212.310) (-1210.188) (-1210.487) [-1213.826] * (-1213.755) (-1213.843) (-1215.647) [-1210.398] -- 0:00:43 315000 -- (-1213.075) (-1212.754) [-1211.199] (-1212.328) * [-1209.981] (-1211.638) (-1211.020) (-1211.058) -- 0:00:43 Average standard deviation of split frequencies: 0.011095 315500 -- (-1211.527) [-1210.310] (-1211.239) (-1214.564) * (-1211.755) [-1210.431] (-1211.634) (-1210.730) -- 0:00:43 316000 -- (-1211.465) (-1213.071) [-1213.397] (-1217.044) * (-1211.921) [-1212.253] (-1212.872) (-1213.241) -- 0:00:43 316500 -- (-1212.074) (-1212.483) (-1215.867) [-1214.592] * (-1211.777) (-1210.343) (-1211.737) [-1212.995] -- 0:00:43 317000 -- [-1214.999] (-1214.376) (-1222.497) (-1210.520) * (-1212.923) (-1210.722) [-1212.830] (-1212.665) -- 0:00:43 317500 -- (-1212.410) (-1210.466) (-1211.530) [-1212.496] * (-1212.053) [-1212.064] (-1211.514) (-1210.658) -- 0:00:42 318000 -- [-1210.243] (-1212.205) (-1210.450) (-1212.361) * (-1212.040) (-1210.427) (-1210.479) [-1212.020] -- 0:00:42 318500 -- (-1211.715) [-1213.469] (-1211.507) (-1211.580) * (-1214.507) (-1213.281) [-1212.604] (-1212.874) -- 0:00:42 319000 -- (-1212.655) (-1210.313) (-1212.977) [-1215.358] * (-1212.271) (-1214.406) (-1214.866) [-1211.477] -- 0:00:42 319500 -- [-1214.008] (-1214.231) (-1215.426) (-1218.600) * (-1211.573) (-1211.311) [-1211.236] (-1210.260) -- 0:00:42 320000 -- (-1211.812) (-1211.875) (-1211.005) [-1213.104] * (-1216.352) (-1215.357) (-1212.084) [-1210.262] -- 0:00:42 Average standard deviation of split frequencies: 0.011393 320500 -- (-1211.914) (-1211.996) (-1214.212) [-1213.836] * (-1212.834) (-1211.578) [-1210.942] (-1210.704) -- 0:00:42 321000 -- [-1212.242] (-1215.589) (-1215.542) (-1211.171) * (-1215.881) (-1210.624) (-1211.942) [-1210.768] -- 0:00:42 321500 -- (-1212.203) (-1213.151) [-1212.289] (-1213.599) * (-1212.474) (-1212.676) [-1210.888] (-1212.106) -- 0:00:42 322000 -- [-1211.331] (-1211.773) (-1212.694) (-1212.287) * (-1212.169) (-1210.376) [-1210.946] (-1210.329) -- 0:00:42 322500 -- (-1217.473) [-1214.205] (-1212.211) (-1209.890) * (-1213.168) (-1212.349) [-1211.186] (-1215.729) -- 0:00:42 323000 -- (-1212.483) [-1213.928] (-1213.081) (-1209.879) * [-1212.927] (-1214.095) (-1219.303) (-1211.431) -- 0:00:41 323500 -- (-1214.124) (-1210.789) (-1214.639) [-1210.228] * (-1213.204) [-1211.608] (-1219.370) (-1211.579) -- 0:00:41 324000 -- (-1211.743) (-1211.332) [-1212.070] (-1212.769) * (-1210.839) (-1211.854) [-1211.281] (-1211.506) -- 0:00:41 324500 -- (-1212.581) [-1211.182] (-1214.790) (-1214.788) * (-1215.327) (-1211.997) (-1210.974) [-1210.173] -- 0:00:41 325000 -- (-1214.575) (-1213.163) (-1213.995) [-1212.631] * (-1213.099) [-1213.223] (-1211.481) (-1211.803) -- 0:00:41 Average standard deviation of split frequencies: 0.011398 325500 -- (-1213.716) (-1213.194) (-1215.136) [-1214.693] * (-1216.050) (-1212.448) (-1210.287) [-1213.725] -- 0:00:41 326000 -- [-1211.742] (-1211.776) (-1209.938) (-1213.437) * [-1213.061] (-1212.448) (-1210.698) (-1211.936) -- 0:00:41 326500 -- [-1212.746] (-1211.948) (-1211.189) (-1218.087) * (-1216.393) [-1212.419] (-1210.313) (-1210.468) -- 0:00:41 327000 -- (-1212.312) (-1212.155) [-1210.522] (-1211.211) * (-1213.239) [-1213.003] (-1216.542) (-1215.070) -- 0:00:41 327500 -- (-1211.923) (-1213.186) [-1210.842] (-1213.689) * [-1212.770] (-1212.622) (-1212.832) (-1214.458) -- 0:00:41 328000 -- [-1211.592] (-1213.887) (-1213.651) (-1213.083) * (-1211.542) [-1212.588] (-1213.036) (-1217.227) -- 0:00:40 328500 -- (-1211.273) (-1210.643) [-1213.206] (-1212.382) * (-1214.012) (-1213.866) (-1211.273) [-1211.946] -- 0:00:42 329000 -- (-1211.312) (-1213.550) (-1213.790) [-1211.958] * (-1212.478) (-1212.021) [-1211.896] (-1210.797) -- 0:00:42 329500 -- (-1210.667) (-1210.992) (-1214.086) [-1213.573] * (-1212.222) [-1211.268] (-1218.268) (-1212.307) -- 0:00:42 330000 -- (-1211.455) (-1210.082) (-1211.575) [-1219.110] * [-1212.044] (-1212.789) (-1214.284) (-1210.137) -- 0:00:42 Average standard deviation of split frequencies: 0.010650 330500 -- (-1210.956) (-1210.087) (-1210.455) [-1218.336] * (-1211.132) (-1211.380) (-1213.764) [-1210.815] -- 0:00:42 331000 -- (-1212.164) [-1211.354] (-1215.557) (-1216.988) * (-1210.932) (-1214.809) (-1213.595) [-1212.104] -- 0:00:42 331500 -- (-1212.767) [-1212.243] (-1216.073) (-1215.424) * (-1212.837) (-1212.040) [-1212.917] (-1211.712) -- 0:00:42 332000 -- (-1214.730) (-1212.626) (-1214.422) [-1212.028] * (-1214.791) [-1210.607] (-1213.690) (-1211.034) -- 0:00:42 332500 -- [-1211.698] (-1211.516) (-1216.601) (-1211.119) * (-1211.546) (-1212.082) (-1213.052) [-1213.015] -- 0:00:42 333000 -- (-1211.347) [-1210.489] (-1212.727) (-1212.439) * (-1214.456) [-1210.172] (-1211.917) (-1213.648) -- 0:00:42 333500 -- [-1212.010] (-1211.761) (-1213.514) (-1210.808) * [-1210.443] (-1210.780) (-1211.809) (-1210.522) -- 0:00:41 334000 -- (-1210.824) [-1212.162] (-1215.864) (-1212.003) * (-1212.940) (-1210.115) [-1211.545] (-1211.006) -- 0:00:41 334500 -- [-1215.907] (-1210.535) (-1214.445) (-1212.990) * (-1210.649) (-1209.981) [-1213.824] (-1210.826) -- 0:00:41 335000 -- (-1216.080) (-1211.682) [-1214.125] (-1212.147) * [-1211.475] (-1212.854) (-1216.170) (-1210.901) -- 0:00:41 Average standard deviation of split frequencies: 0.011141 335500 -- (-1213.486) (-1210.949) (-1210.933) [-1214.967] * (-1212.088) (-1212.739) (-1212.686) [-1213.551] -- 0:00:41 336000 -- [-1210.998] (-1214.275) (-1211.500) (-1213.156) * (-1213.399) (-1213.258) [-1215.816] (-1212.004) -- 0:00:41 336500 -- (-1211.119) [-1213.132] (-1210.332) (-1211.835) * (-1210.981) [-1213.562] (-1213.146) (-1213.762) -- 0:00:41 337000 -- (-1211.179) (-1212.153) [-1211.805] (-1210.774) * (-1211.909) (-1210.572) (-1213.126) [-1211.605] -- 0:00:41 337500 -- (-1211.214) (-1212.581) (-1212.751) [-1210.913] * (-1211.918) [-1212.092] (-1213.557) (-1212.067) -- 0:00:41 338000 -- (-1211.774) (-1212.989) (-1213.665) [-1210.823] * (-1215.398) (-1211.551) (-1212.840) [-1210.612] -- 0:00:41 338500 -- [-1212.580] (-1215.200) (-1210.311) (-1218.490) * (-1214.304) (-1214.601) (-1211.706) [-1213.449] -- 0:00:41 339000 -- (-1213.194) [-1216.650] (-1214.955) (-1210.957) * [-1212.099] (-1211.695) (-1210.958) (-1212.893) -- 0:00:40 339500 -- (-1211.387) (-1211.515) [-1217.809] (-1213.121) * (-1215.145) (-1211.434) (-1211.338) [-1212.718] -- 0:00:40 340000 -- [-1210.290] (-1213.463) (-1211.626) (-1210.694) * (-1213.996) [-1213.190] (-1211.976) (-1213.387) -- 0:00:40 Average standard deviation of split frequencies: 0.011152 340500 -- [-1210.730] (-1210.781) (-1213.258) (-1210.927) * (-1211.708) (-1214.959) (-1212.375) [-1211.043] -- 0:00:40 341000 -- (-1210.423) [-1209.997] (-1217.502) (-1216.088) * (-1216.035) (-1215.453) (-1217.320) [-1210.774] -- 0:00:40 341500 -- [-1213.159] (-1210.440) (-1217.104) (-1214.211) * [-1213.645] (-1217.660) (-1219.829) (-1211.977) -- 0:00:40 342000 -- (-1213.076) (-1210.469) [-1210.720] (-1210.291) * (-1211.836) (-1212.180) [-1213.455] (-1214.145) -- 0:00:40 342500 -- (-1211.867) [-1211.490] (-1210.877) (-1210.811) * (-1212.563) (-1215.465) (-1213.468) [-1210.952] -- 0:00:40 343000 -- (-1211.722) [-1216.053] (-1210.316) (-1215.056) * (-1212.120) (-1212.485) (-1211.673) [-1210.330] -- 0:00:40 343500 -- (-1211.822) [-1215.058] (-1211.290) (-1212.682) * (-1212.164) [-1211.279] (-1211.971) (-1212.593) -- 0:00:40 344000 -- [-1210.809] (-1214.513) (-1210.760) (-1216.266) * (-1210.852) (-1211.532) [-1212.438] (-1212.503) -- 0:00:40 344500 -- (-1213.530) [-1213.679] (-1211.498) (-1220.689) * (-1210.750) (-1211.122) [-1212.408] (-1212.562) -- 0:00:41 345000 -- [-1211.777] (-1214.307) (-1211.799) (-1218.233) * (-1212.546) (-1211.913) [-1212.465] (-1210.652) -- 0:00:41 Average standard deviation of split frequencies: 0.011051 345500 -- (-1211.884) [-1210.974] (-1210.650) (-1212.201) * (-1212.487) (-1214.222) [-1213.648] (-1210.610) -- 0:00:41 346000 -- (-1212.682) (-1216.610) [-1210.143] (-1212.389) * [-1212.085] (-1209.998) (-1210.423) (-1210.429) -- 0:00:41 346500 -- (-1211.876) [-1214.649] (-1210.142) (-1215.420) * (-1210.574) [-1210.473] (-1212.195) (-1212.061) -- 0:00:41 347000 -- (-1215.812) (-1213.635) [-1213.007] (-1216.601) * (-1210.542) (-1211.008) (-1211.890) [-1211.576] -- 0:00:41 347500 -- (-1211.382) [-1211.098] (-1211.943) (-1217.112) * (-1212.362) [-1212.308] (-1211.152) (-1210.552) -- 0:00:41 348000 -- (-1211.480) (-1212.177) [-1214.679] (-1215.019) * (-1212.100) (-1210.540) [-1210.347] (-1210.580) -- 0:00:41 348500 -- [-1210.759] (-1211.612) (-1214.256) (-1212.351) * (-1210.417) [-1211.249] (-1211.889) (-1213.272) -- 0:00:41 349000 -- (-1210.644) (-1211.664) (-1210.756) [-1212.675] * (-1213.989) (-1210.804) [-1211.889] (-1211.997) -- 0:00:41 349500 -- (-1215.477) (-1214.376) (-1210.455) [-1212.025] * (-1214.010) [-1211.425] (-1212.866) (-1212.449) -- 0:00:40 350000 -- [-1213.540] (-1215.280) (-1210.661) (-1211.392) * (-1216.138) (-1211.720) [-1211.109] (-1213.825) -- 0:00:40 Average standard deviation of split frequencies: 0.010675 350500 -- (-1212.929) (-1212.138) (-1211.253) [-1211.706] * (-1213.420) (-1211.819) [-1210.611] (-1212.879) -- 0:00:40 351000 -- (-1213.264) [-1211.326] (-1211.789) (-1211.707) * (-1213.378) (-1211.760) [-1210.774] (-1211.501) -- 0:00:40 351500 -- [-1212.957] (-1212.776) (-1210.885) (-1217.193) * (-1212.206) (-1213.438) [-1210.916] (-1213.663) -- 0:00:40 352000 -- (-1212.264) (-1212.432) [-1212.585] (-1215.472) * (-1216.929) [-1211.450] (-1209.969) (-1214.464) -- 0:00:40 352500 -- (-1212.367) (-1210.774) [-1211.605] (-1214.844) * (-1211.275) [-1212.858] (-1213.012) (-1215.648) -- 0:00:40 353000 -- [-1211.416] (-1212.219) (-1210.650) (-1211.270) * (-1212.061) [-1214.549] (-1213.556) (-1212.134) -- 0:00:40 353500 -- (-1212.576) [-1212.458] (-1211.711) (-1213.452) * (-1211.212) (-1212.183) [-1210.661] (-1210.443) -- 0:00:40 354000 -- (-1212.052) [-1213.100] (-1212.030) (-1211.226) * [-1213.742] (-1212.947) (-1211.693) (-1212.949) -- 0:00:40 354500 -- (-1212.923) [-1213.224] (-1212.860) (-1211.222) * (-1210.622) (-1212.688) (-1211.260) [-1212.174] -- 0:00:40 355000 -- [-1213.804] (-1212.228) (-1213.921) (-1213.576) * (-1213.847) (-1215.682) (-1211.149) [-1216.129] -- 0:00:39 Average standard deviation of split frequencies: 0.010749 355500 -- (-1211.092) [-1211.014] (-1213.934) (-1211.961) * (-1213.432) (-1217.046) [-1214.180] (-1212.082) -- 0:00:39 356000 -- (-1211.138) [-1212.558] (-1211.645) (-1213.279) * [-1215.778] (-1216.866) (-1211.711) (-1214.732) -- 0:00:39 356500 -- (-1212.641) (-1214.262) [-1210.976] (-1213.264) * (-1218.431) [-1214.020] (-1211.833) (-1211.364) -- 0:00:39 357000 -- (-1212.326) [-1211.740] (-1210.862) (-1212.988) * (-1211.959) (-1215.187) (-1212.181) [-1210.396] -- 0:00:39 357500 -- [-1212.662] (-1210.966) (-1213.344) (-1213.607) * (-1210.910) [-1212.863] (-1211.972) (-1210.911) -- 0:00:39 358000 -- (-1210.596) (-1212.266) (-1215.621) [-1212.912] * (-1210.639) (-1210.164) (-1214.586) [-1214.559] -- 0:00:39 358500 -- (-1211.575) (-1215.414) [-1212.403] (-1213.762) * (-1211.468) (-1210.743) [-1213.529] (-1210.844) -- 0:00:39 359000 -- (-1213.349) (-1216.368) [-1210.845] (-1211.090) * (-1212.527) (-1210.974) (-1210.541) [-1212.985] -- 0:00:39 359500 -- (-1212.277) (-1215.515) [-1212.863] (-1214.254) * (-1211.146) (-1210.595) (-1211.767) [-1211.780] -- 0:00:39 360000 -- (-1211.089) [-1211.512] (-1213.638) (-1214.637) * (-1211.111) (-1211.234) [-1211.123] (-1215.407) -- 0:00:39 Average standard deviation of split frequencies: 0.011917 360500 -- (-1211.805) (-1211.234) [-1212.558] (-1214.900) * [-1210.278] (-1210.741) (-1210.997) (-1210.858) -- 0:00:40 361000 -- (-1212.112) (-1211.481) [-1211.601] (-1214.020) * (-1211.930) (-1211.672) (-1210.676) [-1209.941] -- 0:00:40 361500 -- [-1213.909] (-1210.407) (-1211.256) (-1210.974) * (-1211.298) (-1210.651) [-1213.689] (-1210.762) -- 0:00:40 362000 -- (-1212.744) (-1210.173) [-1212.986] (-1212.890) * [-1211.506] (-1210.576) (-1214.432) (-1212.107) -- 0:00:40 362500 -- [-1212.799] (-1210.749) (-1212.479) (-1214.658) * [-1212.250] (-1212.086) (-1213.192) (-1211.278) -- 0:00:40 363000 -- (-1211.217) (-1210.907) (-1214.495) [-1215.030] * [-1213.839] (-1216.466) (-1215.246) (-1211.000) -- 0:00:40 363500 -- [-1210.547] (-1210.492) (-1215.590) (-1214.601) * (-1213.653) (-1215.873) [-1211.274] (-1210.485) -- 0:00:40 364000 -- (-1211.107) (-1210.390) [-1211.873] (-1211.066) * (-1211.686) (-1213.005) [-1211.899] (-1212.589) -- 0:00:40 364500 -- (-1212.390) (-1210.464) (-1214.007) [-1210.902] * (-1212.478) [-1211.514] (-1210.645) (-1212.184) -- 0:00:40 365000 -- [-1210.139] (-1211.094) (-1212.597) (-1210.800) * (-1214.875) (-1213.229) [-1212.570] (-1211.201) -- 0:00:40 Average standard deviation of split frequencies: 0.012379 365500 -- (-1209.919) (-1211.745) (-1213.283) [-1210.878] * (-1215.451) (-1214.248) (-1212.978) [-1211.110] -- 0:00:39 366000 -- (-1210.590) (-1212.207) [-1214.528] (-1211.246) * (-1214.323) (-1214.495) [-1211.499] (-1210.243) -- 0:00:39 366500 -- (-1210.590) (-1211.616) (-1213.314) [-1211.130] * (-1211.064) (-1215.369) (-1211.002) [-1212.082] -- 0:00:39 367000 -- [-1210.810] (-1210.710) (-1211.698) (-1212.196) * [-1210.158] (-1216.721) (-1211.991) (-1214.295) -- 0:00:39 367500 -- [-1210.816] (-1210.915) (-1210.807) (-1214.477) * (-1214.404) (-1213.240) [-1212.590] (-1214.319) -- 0:00:39 368000 -- (-1211.209) [-1210.461] (-1211.094) (-1215.707) * (-1217.085) (-1210.403) (-1212.192) [-1211.601] -- 0:00:39 368500 -- (-1211.215) (-1211.867) (-1212.200) [-1215.058] * (-1213.203) (-1219.868) (-1211.050) [-1215.901] -- 0:00:39 369000 -- (-1213.216) (-1212.066) [-1211.370] (-1211.893) * (-1213.514) (-1214.127) (-1211.558) [-1213.984] -- 0:00:39 369500 -- [-1212.391] (-1212.835) (-1210.579) (-1211.277) * [-1212.869] (-1212.814) (-1211.324) (-1213.002) -- 0:00:39 370000 -- (-1213.485) (-1212.709) (-1210.509) [-1211.384] * (-1212.783) (-1212.005) [-1211.715] (-1212.609) -- 0:00:39 Average standard deviation of split frequencies: 0.011970 370500 -- (-1212.387) (-1211.882) [-1210.751] (-1211.006) * (-1215.806) (-1212.757) (-1211.047) [-1212.631] -- 0:00:39 371000 -- (-1210.230) [-1215.296] (-1214.526) (-1210.716) * (-1212.976) (-1211.930) (-1210.495) [-1212.186] -- 0:00:38 371500 -- [-1210.710] (-1211.927) (-1215.883) (-1211.581) * (-1211.390) (-1214.999) (-1210.495) [-1211.712] -- 0:00:38 372000 -- (-1210.163) (-1214.267) [-1213.351] (-1211.578) * (-1212.504) (-1217.171) [-1210.493] (-1215.729) -- 0:00:38 372500 -- [-1210.167] (-1210.536) (-1212.926) (-1214.401) * (-1214.068) (-1211.197) (-1210.495) [-1212.315] -- 0:00:38 373000 -- (-1210.885) (-1210.651) (-1211.251) [-1211.249] * (-1213.920) (-1210.190) (-1212.769) [-1211.295] -- 0:00:38 373500 -- (-1213.506) [-1211.335] (-1212.026) (-1212.252) * (-1212.960) [-1210.206] (-1212.899) (-1212.745) -- 0:00:38 374000 -- (-1212.772) [-1213.883] (-1212.188) (-1212.853) * (-1211.677) [-1213.315] (-1212.439) (-1214.336) -- 0:00:38 374500 -- (-1215.404) [-1211.769] (-1212.885) (-1212.419) * (-1211.491) (-1213.345) [-1214.660] (-1213.464) -- 0:00:38 375000 -- (-1213.961) (-1213.009) [-1213.168] (-1212.824) * (-1215.234) [-1211.872] (-1211.456) (-1210.662) -- 0:00:38 Average standard deviation of split frequencies: 0.012616 375500 -- [-1211.937] (-1214.188) (-1212.617) (-1211.504) * (-1212.213) (-1213.258) (-1212.776) [-1212.674] -- 0:00:38 376000 -- (-1212.020) [-1212.941] (-1214.501) (-1212.673) * [-1211.292] (-1214.642) (-1211.737) (-1210.393) -- 0:00:38 376500 -- (-1214.182) [-1212.370] (-1211.859) (-1212.213) * [-1212.202] (-1214.769) (-1211.204) (-1212.458) -- 0:00:39 377000 -- (-1213.894) (-1215.905) (-1213.686) [-1211.940] * (-1215.126) (-1213.534) (-1211.462) [-1213.531] -- 0:00:39 377500 -- [-1211.068] (-1211.958) (-1213.696) (-1211.452) * [-1214.109] (-1214.735) (-1210.407) (-1215.892) -- 0:00:39 378000 -- (-1210.563) (-1210.702) [-1214.863] (-1214.325) * (-1215.352) [-1212.618] (-1214.784) (-1211.159) -- 0:00:39 378500 -- (-1211.173) (-1215.324) [-1212.046] (-1211.781) * (-1218.231) (-1212.314) (-1215.040) [-1211.440] -- 0:00:39 379000 -- [-1210.878] (-1211.496) (-1211.388) (-1213.451) * [-1212.251] (-1211.051) (-1213.421) (-1211.472) -- 0:00:39 379500 -- (-1211.021) (-1210.055) [-1214.251] (-1213.074) * (-1214.127) (-1211.536) (-1212.825) [-1212.445] -- 0:00:39 380000 -- (-1210.553) (-1210.749) [-1212.691] (-1214.935) * [-1211.327] (-1210.543) (-1210.362) (-1212.395) -- 0:00:39 Average standard deviation of split frequencies: 0.012771 380500 -- [-1211.214] (-1214.651) (-1218.229) (-1212.625) * (-1213.061) (-1211.813) (-1211.267) [-1211.415] -- 0:00:39 381000 -- [-1212.105] (-1211.903) (-1214.054) (-1215.460) * [-1211.268] (-1210.197) (-1213.168) (-1211.122) -- 0:00:38 381500 -- [-1211.353] (-1213.475) (-1211.098) (-1213.942) * (-1214.304) (-1211.913) (-1210.498) [-1210.699] -- 0:00:38 382000 -- (-1210.368) [-1211.857] (-1212.498) (-1212.829) * (-1211.165) (-1212.154) (-1211.422) [-1210.988] -- 0:00:38 382500 -- (-1212.642) [-1210.571] (-1215.060) (-1213.392) * (-1212.043) (-1215.303) (-1210.040) [-1212.941] -- 0:00:38 383000 -- (-1210.164) [-1210.092] (-1213.028) (-1210.612) * (-1211.940) (-1213.706) (-1211.645) [-1212.563] -- 0:00:38 383500 -- [-1210.868] (-1210.399) (-1211.472) (-1212.303) * [-1212.461] (-1213.923) (-1211.645) (-1216.105) -- 0:00:38 384000 -- (-1210.520) (-1212.456) (-1212.532) [-1210.839] * (-1214.943) [-1212.526] (-1213.452) (-1214.778) -- 0:00:38 384500 -- (-1210.913) (-1211.962) (-1212.156) [-1211.463] * (-1214.568) (-1211.909) (-1211.529) [-1213.408] -- 0:00:38 385000 -- (-1213.199) [-1210.780] (-1212.847) (-1212.006) * (-1214.339) [-1211.758] (-1209.956) (-1211.376) -- 0:00:38 Average standard deviation of split frequencies: 0.011207 385500 -- [-1210.297] (-1220.878) (-1211.389) (-1213.045) * (-1212.915) (-1210.588) (-1213.140) [-1212.270] -- 0:00:38 386000 -- (-1210.244) (-1215.859) [-1210.148] (-1211.848) * [-1212.444] (-1211.785) (-1210.033) (-1212.016) -- 0:00:38 386500 -- (-1212.595) (-1212.835) [-1209.755] (-1214.363) * (-1213.743) [-1214.524] (-1211.230) (-1211.888) -- 0:00:38 387000 -- [-1212.748] (-1211.321) (-1214.622) (-1212.088) * (-1211.771) (-1211.838) [-1212.769] (-1212.416) -- 0:00:38 387500 -- [-1211.821] (-1214.772) (-1212.422) (-1212.904) * (-1211.169) (-1215.017) [-1212.432] (-1214.070) -- 0:00:37 388000 -- [-1213.602] (-1212.295) (-1212.886) (-1219.394) * (-1211.537) (-1213.457) (-1212.421) [-1213.084] -- 0:00:37 388500 -- (-1210.290) (-1213.084) (-1213.126) [-1211.789] * (-1212.941) (-1213.897) [-1211.871] (-1212.135) -- 0:00:37 389000 -- (-1213.343) (-1213.838) [-1212.763] (-1211.585) * (-1211.942) (-1210.137) [-1210.812] (-1212.832) -- 0:00:37 389500 -- [-1212.710] (-1211.858) (-1211.762) (-1210.693) * (-1210.864) (-1211.587) (-1212.108) [-1214.096] -- 0:00:37 390000 -- (-1211.560) [-1213.272] (-1210.828) (-1213.911) * [-1211.659] (-1212.815) (-1212.480) (-1214.091) -- 0:00:37 Average standard deviation of split frequencies: 0.011991 390500 -- (-1212.676) [-1213.083] (-1213.282) (-1214.917) * (-1212.196) [-1213.678] (-1211.100) (-1214.018) -- 0:00:37 391000 -- (-1213.108) (-1213.946) [-1213.099] (-1213.813) * [-1215.560] (-1215.560) (-1211.781) (-1211.577) -- 0:00:37 391500 -- (-1213.057) (-1213.000) [-1212.085] (-1213.566) * [-1211.768] (-1214.159) (-1210.872) (-1211.568) -- 0:00:37 392000 -- (-1215.056) (-1212.724) (-1212.713) [-1215.715] * (-1213.733) (-1210.495) [-1210.849] (-1212.575) -- 0:00:38 392500 -- (-1214.890) (-1211.572) [-1210.846] (-1212.984) * (-1216.123) (-1210.994) [-1210.834] (-1212.488) -- 0:00:38 393000 -- (-1211.959) (-1210.860) (-1210.884) [-1212.019] * [-1215.037] (-1214.155) (-1211.169) (-1211.361) -- 0:00:38 393500 -- (-1219.198) (-1211.189) [-1212.629] (-1215.014) * (-1214.613) (-1213.588) [-1211.203] (-1211.700) -- 0:00:38 394000 -- (-1212.322) (-1213.555) [-1212.431] (-1214.991) * (-1215.704) (-1212.001) [-1211.757] (-1211.809) -- 0:00:38 394500 -- (-1211.949) [-1210.773] (-1212.822) (-1214.070) * (-1218.291) (-1210.477) [-1212.430] (-1212.649) -- 0:00:38 395000 -- (-1211.994) [-1212.416] (-1214.060) (-1216.559) * [-1214.985] (-1210.299) (-1210.155) (-1213.082) -- 0:00:38 Average standard deviation of split frequencies: 0.012433 395500 -- [-1211.113] (-1215.421) (-1214.021) (-1211.215) * (-1214.800) (-1213.456) (-1213.765) [-1212.227] -- 0:00:38 396000 -- (-1210.838) [-1212.822] (-1213.298) (-1213.022) * (-1211.487) (-1211.935) (-1213.038) [-1212.450] -- 0:00:38 396500 -- (-1210.696) (-1214.431) (-1217.384) [-1213.158] * [-1211.883] (-1210.106) (-1213.581) (-1210.283) -- 0:00:38 397000 -- [-1211.562] (-1211.178) (-1211.142) (-1212.119) * (-1211.657) (-1212.130) (-1213.173) [-1212.124] -- 0:00:37 397500 -- (-1213.491) [-1210.554] (-1211.960) (-1211.545) * (-1210.631) (-1211.428) (-1213.516) [-1212.095] -- 0:00:37 398000 -- (-1214.662) [-1211.814] (-1210.515) (-1211.261) * [-1210.839] (-1212.166) (-1212.961) (-1211.349) -- 0:00:37 398500 -- [-1212.847] (-1211.564) (-1211.449) (-1213.403) * (-1213.636) [-1211.634] (-1213.863) (-1212.145) -- 0:00:37 399000 -- [-1212.808] (-1211.202) (-1210.759) (-1212.788) * [-1211.885] (-1210.035) (-1212.060) (-1210.704) -- 0:00:37 399500 -- (-1216.535) [-1212.668] (-1212.074) (-1211.333) * (-1211.706) (-1216.281) (-1213.757) [-1210.540] -- 0:00:37 400000 -- [-1214.197] (-1212.700) (-1210.992) (-1210.803) * (-1210.729) (-1211.894) (-1214.298) [-1210.804] -- 0:00:37 Average standard deviation of split frequencies: 0.011692 400500 -- (-1211.954) (-1213.201) [-1214.842] (-1210.084) * (-1213.575) [-1210.734] (-1213.348) (-1209.932) -- 0:00:37 401000 -- (-1212.604) (-1216.972) (-1211.230) [-1211.790] * [-1213.006] (-1211.549) (-1210.653) (-1213.635) -- 0:00:37 401500 -- (-1214.047) [-1212.952] (-1214.870) (-1211.985) * (-1212.774) (-1211.553) (-1213.243) [-1213.011] -- 0:00:37 402000 -- (-1213.477) [-1210.242] (-1215.273) (-1212.848) * [-1212.163] (-1210.719) (-1211.453) (-1210.747) -- 0:00:37 402500 -- (-1210.324) (-1213.006) [-1212.159] (-1215.139) * [-1214.350] (-1210.109) (-1212.843) (-1211.220) -- 0:00:37 403000 -- (-1211.034) [-1212.651] (-1212.176) (-1214.011) * (-1212.483) (-1213.476) (-1212.557) [-1211.193] -- 0:00:37 403500 -- (-1210.537) (-1210.637) (-1210.339) [-1212.655] * (-1211.298) (-1214.165) (-1210.477) [-1211.843] -- 0:00:36 404000 -- (-1214.389) (-1211.166) (-1211.741) [-1210.646] * (-1212.242) [-1211.093] (-1210.692) (-1213.040) -- 0:00:36 404500 -- (-1212.024) [-1210.379] (-1212.329) (-1210.462) * [-1214.108] (-1211.320) (-1216.127) (-1213.795) -- 0:00:36 405000 -- (-1212.961) (-1211.404) [-1210.319] (-1212.467) * (-1214.137) (-1211.467) (-1217.601) [-1211.404] -- 0:00:36 Average standard deviation of split frequencies: 0.012499 405500 -- (-1212.974) (-1211.948) (-1212.690) [-1212.523] * (-1213.661) [-1211.808] (-1212.385) (-1211.264) -- 0:00:36 406000 -- (-1210.128) (-1210.852) (-1213.268) [-1213.790] * (-1217.135) (-1211.650) [-1211.636] (-1210.513) -- 0:00:36 406500 -- (-1211.886) [-1210.669] (-1211.146) (-1215.711) * (-1217.962) [-1213.354] (-1212.288) (-1212.708) -- 0:00:36 407000 -- (-1213.167) [-1211.137] (-1215.425) (-1212.044) * (-1211.369) [-1214.129] (-1212.419) (-1212.256) -- 0:00:36 407500 -- (-1210.838) (-1213.813) [-1212.923] (-1213.211) * (-1212.395) (-1213.270) (-1210.195) [-1211.689] -- 0:00:37 408000 -- (-1211.474) [-1212.077] (-1212.719) (-1210.387) * [-1212.524] (-1214.250) (-1212.103) (-1213.112) -- 0:00:37 408500 -- (-1212.834) (-1212.016) [-1215.800] (-1212.747) * (-1211.230) [-1210.196] (-1211.276) (-1213.496) -- 0:00:37 409000 -- [-1211.387] (-1210.782) (-1213.047) (-1211.272) * (-1211.230) (-1210.007) (-1214.195) [-1214.512] -- 0:00:37 409500 -- (-1212.447) (-1213.357) (-1211.329) [-1210.859] * (-1211.210) (-1210.859) [-1214.300] (-1212.604) -- 0:00:37 410000 -- (-1212.363) [-1214.913] (-1211.413) (-1211.213) * (-1212.715) (-1211.933) (-1212.902) [-1215.633] -- 0:00:37 Average standard deviation of split frequencies: 0.011614 410500 -- (-1211.644) (-1214.866) (-1211.912) [-1211.777] * (-1212.177) [-1210.312] (-1212.892) (-1210.898) -- 0:00:37 411000 -- (-1213.109) (-1212.770) (-1213.772) [-1211.901] * (-1214.365) [-1212.833] (-1212.062) (-1211.385) -- 0:00:37 411500 -- [-1213.141] (-1214.917) (-1211.747) (-1211.480) * (-1213.286) [-1211.454] (-1211.606) (-1210.743) -- 0:00:37 412000 -- (-1212.203) (-1214.109) (-1213.098) [-1211.490] * (-1215.062) [-1214.370] (-1211.133) (-1211.230) -- 0:00:37 412500 -- [-1211.909] (-1215.117) (-1211.387) (-1215.504) * (-1213.862) (-1212.550) (-1210.738) [-1212.463] -- 0:00:37 413000 -- (-1212.250) (-1212.746) [-1212.590] (-1216.339) * (-1213.357) [-1211.604] (-1211.621) (-1214.036) -- 0:00:36 413500 -- (-1212.082) (-1212.568) [-1213.852] (-1214.901) * [-1213.484] (-1212.735) (-1214.638) (-1212.361) -- 0:00:36 414000 -- (-1211.072) [-1211.279] (-1210.488) (-1218.229) * (-1215.963) [-1211.741] (-1211.309) (-1211.290) -- 0:00:36 414500 -- (-1211.530) (-1211.765) (-1210.721) [-1212.590] * [-1214.265] (-1210.419) (-1211.114) (-1211.840) -- 0:00:36 415000 -- (-1219.012) [-1210.937] (-1213.021) (-1218.554) * [-1216.977] (-1210.959) (-1211.664) (-1215.820) -- 0:00:36 Average standard deviation of split frequencies: 0.012323 415500 -- (-1212.256) [-1213.403] (-1211.553) (-1212.098) * (-1212.449) [-1211.362] (-1214.011) (-1214.708) -- 0:00:36 416000 -- (-1211.096) (-1214.855) [-1210.298] (-1212.649) * [-1211.049] (-1211.066) (-1210.661) (-1212.781) -- 0:00:36 416500 -- [-1210.608] (-1212.919) (-1212.387) (-1211.317) * (-1211.489) (-1211.659) [-1212.264] (-1212.502) -- 0:00:36 417000 -- [-1211.038] (-1218.544) (-1210.404) (-1213.588) * (-1212.292) (-1212.497) (-1213.258) [-1213.886] -- 0:00:36 417500 -- [-1212.342] (-1214.434) (-1211.324) (-1212.867) * (-1211.711) (-1213.330) (-1213.344) [-1212.251] -- 0:00:36 418000 -- [-1210.839] (-1214.274) (-1211.068) (-1210.965) * (-1214.329) (-1213.451) (-1212.071) [-1210.916] -- 0:00:36 418500 -- [-1211.864] (-1212.112) (-1219.720) (-1211.703) * (-1211.875) (-1212.997) (-1213.447) [-1211.070] -- 0:00:36 419000 -- [-1213.002] (-1210.662) (-1212.141) (-1211.844) * (-1212.337) [-1211.652] (-1209.971) (-1211.152) -- 0:00:36 419500 -- (-1210.850) [-1210.864] (-1211.653) (-1214.449) * (-1218.590) (-1211.767) (-1210.288) [-1211.155] -- 0:00:35 420000 -- [-1210.837] (-1210.359) (-1211.286) (-1215.362) * (-1212.243) (-1215.088) [-1210.611] (-1213.495) -- 0:00:35 Average standard deviation of split frequencies: 0.011136 420500 -- (-1213.577) (-1210.612) [-1212.775] (-1212.595) * [-1211.015] (-1211.423) (-1214.495) (-1215.484) -- 0:00:35 421000 -- (-1214.732) [-1211.199] (-1210.381) (-1212.873) * (-1211.577) (-1211.552) [-1213.017] (-1212.845) -- 0:00:35 421500 -- (-1213.954) [-1214.144] (-1216.377) (-1216.761) * [-1210.742] (-1212.688) (-1211.291) (-1214.374) -- 0:00:35 422000 -- (-1216.162) (-1213.346) [-1211.532] (-1211.747) * [-1211.380] (-1215.135) (-1213.568) (-1213.999) -- 0:00:35 422500 -- (-1212.184) [-1214.156] (-1211.744) (-1213.123) * (-1210.293) (-1215.704) (-1211.732) [-1211.299] -- 0:00:35 423000 -- (-1215.506) (-1212.106) [-1210.506] (-1212.166) * (-1214.965) [-1211.225] (-1211.895) (-1210.546) -- 0:00:35 423500 -- (-1213.708) (-1211.464) (-1212.176) [-1210.468] * (-1214.825) (-1213.031) [-1212.442] (-1210.750) -- 0:00:36 424000 -- (-1212.601) (-1214.120) [-1211.367] (-1211.824) * (-1216.889) (-1213.046) (-1212.468) [-1212.603] -- 0:00:36 424500 -- (-1212.576) [-1213.642] (-1211.935) (-1212.992) * [-1210.583] (-1213.195) (-1212.914) (-1212.605) -- 0:00:36 425000 -- (-1212.932) (-1211.957) (-1212.128) [-1213.233] * (-1211.256) (-1215.825) (-1215.191) [-1212.245] -- 0:00:36 Average standard deviation of split frequencies: 0.011135 425500 -- (-1213.730) (-1213.448) (-1212.231) [-1210.437] * (-1212.794) (-1214.507) [-1212.192] (-1213.456) -- 0:00:36 426000 -- (-1212.210) [-1213.928] (-1213.626) (-1212.326) * (-1214.864) [-1215.264] (-1213.456) (-1212.407) -- 0:00:36 426500 -- [-1213.040] (-1215.242) (-1215.106) (-1213.179) * (-1210.466) (-1214.516) (-1211.557) [-1210.524] -- 0:00:36 427000 -- (-1211.545) [-1212.287] (-1210.607) (-1214.890) * [-1210.654] (-1212.394) (-1212.438) (-1214.451) -- 0:00:36 427500 -- (-1210.526) (-1213.624) (-1212.998) [-1212.798] * (-1210.707) (-1214.775) [-1212.368] (-1210.704) -- 0:00:36 428000 -- (-1211.564) (-1210.556) (-1213.616) [-1212.570] * (-1212.653) (-1212.185) (-1211.825) [-1214.048] -- 0:00:36 428500 -- (-1210.594) (-1211.019) [-1214.949] (-1210.606) * [-1210.215] (-1211.528) (-1214.506) (-1213.584) -- 0:00:36 429000 -- (-1210.728) [-1210.519] (-1216.145) (-1212.246) * [-1211.508] (-1211.322) (-1213.164) (-1214.574) -- 0:00:35 429500 -- (-1210.914) (-1212.954) [-1212.240] (-1211.680) * (-1211.825) [-1211.148] (-1211.909) (-1211.830) -- 0:00:35 430000 -- (-1210.780) (-1211.723) (-1214.439) [-1211.050] * (-1212.027) (-1211.300) [-1212.485] (-1212.145) -- 0:00:35 Average standard deviation of split frequencies: 0.010878 430500 -- (-1210.798) [-1212.093] (-1213.778) (-1210.485) * (-1212.891) (-1211.322) [-1211.196] (-1211.860) -- 0:00:35 431000 -- (-1210.267) (-1213.546) (-1216.037) [-1210.863] * (-1211.587) (-1212.986) (-1216.759) [-1211.959] -- 0:00:35 431500 -- [-1212.407] (-1210.596) (-1219.680) (-1211.010) * (-1214.251) (-1212.605) (-1211.091) [-1210.498] -- 0:00:35 432000 -- (-1212.422) (-1211.515) (-1210.921) [-1211.449] * [-1213.595] (-1216.758) (-1212.690) (-1213.335) -- 0:00:35 432500 -- (-1211.687) (-1211.202) [-1213.272] (-1210.254) * (-1210.351) (-1214.404) [-1211.429] (-1212.358) -- 0:00:35 433000 -- (-1211.739) (-1211.010) (-1211.204) [-1209.854] * (-1212.125) (-1213.719) (-1211.972) [-1215.222] -- 0:00:35 433500 -- (-1210.403) [-1212.222] (-1214.846) (-1213.427) * (-1212.737) (-1212.050) [-1213.932] (-1217.246) -- 0:00:35 434000 -- (-1210.395) (-1214.645) (-1215.575) [-1210.755] * (-1212.960) (-1211.136) (-1211.068) [-1210.779] -- 0:00:35 434500 -- (-1213.063) (-1211.434) (-1214.591) [-1212.827] * [-1212.390] (-1214.666) (-1214.574) (-1210.810) -- 0:00:35 435000 -- (-1210.802) (-1212.043) (-1213.599) [-1213.410] * (-1213.046) [-1210.066] (-1213.136) (-1216.319) -- 0:00:35 Average standard deviation of split frequencies: 0.010609 435500 -- (-1211.934) [-1213.591] (-1215.491) (-1214.539) * (-1211.099) (-1210.151) [-1213.196] (-1219.425) -- 0:00:34 436000 -- (-1213.249) [-1213.008] (-1212.611) (-1212.406) * (-1211.494) (-1210.165) [-1211.533] (-1214.657) -- 0:00:34 436500 -- [-1211.470] (-1213.739) (-1219.102) (-1212.599) * (-1213.450) (-1213.487) [-1211.381] (-1212.265) -- 0:00:34 437000 -- (-1214.859) (-1213.820) (-1211.840) [-1212.574] * (-1213.171) (-1213.540) [-1210.888] (-1213.398) -- 0:00:34 437500 -- (-1212.765) (-1214.995) [-1210.131] (-1210.391) * (-1215.414) (-1215.353) (-1211.259) [-1213.325] -- 0:00:34 438000 -- [-1216.727] (-1214.621) (-1211.926) (-1212.486) * (-1211.757) [-1211.107] (-1210.441) (-1218.769) -- 0:00:34 438500 -- (-1212.466) (-1216.033) (-1211.973) [-1213.802] * (-1211.329) [-1213.597] (-1213.063) (-1217.099) -- 0:00:34 439000 -- (-1212.234) (-1213.674) [-1212.331] (-1209.914) * (-1213.462) (-1212.802) [-1214.681] (-1212.533) -- 0:00:34 439500 -- (-1211.362) (-1212.858) (-1212.708) [-1209.914] * [-1213.388] (-1213.654) (-1210.238) (-1213.524) -- 0:00:35 440000 -- [-1209.952] (-1214.022) (-1214.725) (-1211.578) * [-1214.649] (-1211.897) (-1209.982) (-1212.480) -- 0:00:35 Average standard deviation of split frequencies: 0.010363 440500 -- [-1211.408] (-1213.865) (-1212.412) (-1211.596) * (-1213.974) (-1211.190) (-1210.617) [-1211.416] -- 0:00:35 441000 -- [-1212.300] (-1212.473) (-1212.953) (-1212.847) * (-1211.331) (-1213.429) (-1211.110) [-1213.194] -- 0:00:35 441500 -- (-1218.165) (-1212.332) [-1211.944] (-1213.642) * (-1212.228) (-1211.427) [-1212.314] (-1210.590) -- 0:00:35 442000 -- (-1213.365) (-1215.817) [-1210.116] (-1210.715) * (-1214.933) (-1213.400) [-1210.748] (-1210.365) -- 0:00:35 442500 -- [-1214.482] (-1210.948) (-1211.231) (-1211.936) * (-1214.386) (-1213.502) (-1211.837) [-1209.789] -- 0:00:35 443000 -- (-1210.801) (-1212.013) [-1213.131] (-1212.773) * (-1213.822) [-1214.160] (-1210.883) (-1210.345) -- 0:00:35 443500 -- (-1212.850) (-1212.051) (-1214.162) [-1214.980] * [-1212.872] (-1217.586) (-1210.737) (-1212.815) -- 0:00:35 444000 -- [-1210.684] (-1213.343) (-1210.818) (-1215.421) * (-1214.884) (-1212.856) [-1213.435] (-1212.889) -- 0:00:35 444500 -- (-1213.496) (-1211.594) [-1210.848] (-1216.066) * (-1214.188) (-1211.816) (-1211.046) [-1213.459] -- 0:00:34 445000 -- [-1210.518] (-1212.661) (-1211.004) (-1214.787) * [-1213.136] (-1210.040) (-1213.169) (-1214.477) -- 0:00:34 Average standard deviation of split frequencies: 0.010570 445500 -- (-1212.035) (-1215.294) [-1214.410] (-1214.403) * (-1213.782) (-1210.543) [-1211.185] (-1211.747) -- 0:00:34 446000 -- (-1212.075) (-1212.845) (-1213.862) [-1212.901] * (-1212.334) (-1211.325) [-1210.453] (-1211.096) -- 0:00:34 446500 -- [-1211.677] (-1215.453) (-1215.328) (-1211.514) * (-1214.234) (-1212.113) (-1210.336) [-1212.836] -- 0:00:34 447000 -- (-1210.851) [-1211.701] (-1213.975) (-1212.936) * (-1213.394) [-1211.612] (-1211.257) (-1215.081) -- 0:00:34 447500 -- [-1209.888] (-1211.802) (-1212.964) (-1212.031) * (-1213.060) (-1212.474) (-1211.739) [-1212.255] -- 0:00:34 448000 -- [-1209.896] (-1213.774) (-1212.721) (-1212.573) * [-1213.645] (-1211.947) (-1211.122) (-1214.401) -- 0:00:34 448500 -- [-1212.017] (-1211.548) (-1213.642) (-1211.752) * (-1211.752) (-1212.778) [-1212.395] (-1212.525) -- 0:00:34 449000 -- (-1220.578) [-1212.315] (-1212.070) (-1211.744) * (-1211.303) [-1212.829] (-1215.627) (-1212.847) -- 0:00:34 449500 -- (-1211.625) (-1212.055) (-1210.737) [-1213.463] * [-1211.769] (-1214.926) (-1214.061) (-1212.698) -- 0:00:34 450000 -- [-1212.167] (-1211.241) (-1210.314) (-1212.121) * (-1212.936) [-1216.630] (-1211.761) (-1212.988) -- 0:00:34 Average standard deviation of split frequencies: 0.010526 450500 -- (-1213.118) [-1211.213] (-1213.057) (-1212.629) * (-1212.271) [-1217.098] (-1212.135) (-1212.113) -- 0:00:34 451000 -- (-1214.496) (-1214.827) [-1214.197] (-1213.277) * (-1215.071) (-1214.752) (-1212.014) [-1210.879] -- 0:00:34 451500 -- (-1213.681) (-1216.920) (-1211.964) [-1213.162] * (-1211.848) (-1213.085) [-1210.298] (-1211.306) -- 0:00:34 452000 -- (-1212.770) [-1211.473] (-1211.316) (-1214.867) * [-1212.588] (-1212.948) (-1212.074) (-1212.904) -- 0:00:33 452500 -- (-1216.657) (-1211.337) (-1212.730) [-1210.423] * [-1210.344] (-1214.294) (-1210.372) (-1213.881) -- 0:00:33 453000 -- (-1211.640) [-1212.062] (-1213.191) (-1210.415) * (-1214.206) (-1214.211) (-1211.719) [-1211.361] -- 0:00:33 453500 -- (-1210.595) (-1212.817) (-1212.946) [-1210.018] * (-1210.943) (-1210.421) (-1216.453) [-1212.271] -- 0:00:33 454000 -- (-1210.641) (-1214.326) [-1211.390] (-1212.692) * (-1210.763) (-1212.984) [-1211.860] (-1211.598) -- 0:00:33 454500 -- (-1213.770) (-1210.610) (-1212.380) [-1210.185] * [-1213.415] (-1212.272) (-1211.706) (-1210.669) -- 0:00:33 455000 -- (-1214.607) (-1212.692) [-1212.035] (-1213.398) * (-1211.164) (-1211.325) (-1212.105) [-1210.564] -- 0:00:33 Average standard deviation of split frequencies: 0.010725 455500 -- (-1217.703) [-1211.529] (-1213.125) (-1212.627) * (-1211.318) (-1219.728) (-1216.138) [-1210.230] -- 0:00:34 456000 -- (-1216.998) [-1210.844] (-1218.033) (-1211.824) * (-1211.606) (-1213.943) (-1214.351) [-1210.351] -- 0:00:34 456500 -- (-1214.764) [-1212.693] (-1212.752) (-1213.276) * (-1210.863) [-1210.809] (-1210.729) (-1214.671) -- 0:00:34 457000 -- [-1216.458] (-1212.719) (-1211.810) (-1215.336) * (-1212.091) [-1211.083] (-1213.085) (-1212.754) -- 0:00:34 457500 -- [-1216.161] (-1212.206) (-1213.573) (-1215.849) * (-1212.456) (-1214.811) [-1211.253] (-1216.610) -- 0:00:34 458000 -- (-1213.852) (-1212.471) (-1212.169) [-1211.570] * [-1212.421] (-1216.105) (-1213.972) (-1210.615) -- 0:00:34 458500 -- (-1212.657) [-1212.613] (-1214.395) (-1211.843) * (-1214.618) (-1212.818) (-1210.945) [-1212.653] -- 0:00:34 459000 -- (-1211.029) (-1210.971) (-1217.755) [-1211.722] * (-1210.479) (-1211.121) [-1212.860] (-1212.715) -- 0:00:34 459500 -- (-1213.602) (-1211.700) (-1215.915) [-1212.599] * (-1213.804) (-1210.285) (-1212.838) [-1210.556] -- 0:00:34 460000 -- (-1215.978) (-1211.907) (-1216.912) [-1210.917] * (-1212.302) [-1210.862] (-1212.859) (-1210.549) -- 0:00:34 Average standard deviation of split frequencies: 0.010489 460500 -- (-1210.684) (-1212.229) [-1214.107] (-1211.887) * (-1211.051) (-1212.928) [-1211.121] (-1210.619) -- 0:00:33 461000 -- (-1215.587) [-1210.620] (-1211.802) (-1211.450) * (-1210.629) [-1210.062] (-1211.470) (-1214.240) -- 0:00:33 461500 -- (-1214.810) (-1210.662) (-1211.308) [-1211.711] * (-1211.079) (-1210.093) [-1211.280] (-1214.901) -- 0:00:33 462000 -- (-1212.432) [-1210.759] (-1213.663) (-1211.375) * (-1217.649) (-1210.655) (-1211.110) [-1211.553] -- 0:00:33 462500 -- (-1215.455) (-1211.413) [-1211.650] (-1211.742) * (-1216.596) [-1210.966] (-1211.036) (-1210.694) -- 0:00:33 463000 -- (-1210.668) (-1213.062) (-1210.723) [-1213.591] * (-1210.872) [-1210.670] (-1212.984) (-1210.300) -- 0:00:33 463500 -- [-1211.562] (-1212.970) (-1212.913) (-1214.012) * (-1212.498) (-1211.491) (-1212.790) [-1210.606] -- 0:00:33 464000 -- [-1210.990] (-1211.686) (-1218.691) (-1211.384) * (-1212.940) (-1213.520) [-1213.274] (-1212.247) -- 0:00:33 464500 -- [-1210.526] (-1210.500) (-1216.714) (-1211.422) * (-1211.686) (-1215.693) (-1210.267) [-1212.213] -- 0:00:33 465000 -- (-1211.860) [-1219.835] (-1211.381) (-1210.315) * (-1214.592) (-1212.316) [-1211.692] (-1211.021) -- 0:00:33 Average standard deviation of split frequencies: 0.010811 465500 -- [-1216.532] (-1212.194) (-1210.370) (-1215.393) * (-1213.012) (-1210.313) [-1210.642] (-1212.013) -- 0:00:33 466000 -- [-1211.019] (-1212.169) (-1214.145) (-1216.134) * (-1212.536) (-1212.294) [-1209.941] (-1212.161) -- 0:00:33 466500 -- (-1211.743) (-1213.715) [-1212.558] (-1213.716) * (-1213.254) [-1212.389] (-1210.080) (-1211.545) -- 0:00:33 467000 -- (-1210.807) (-1211.699) (-1211.572) [-1210.160] * [-1212.071] (-1211.317) (-1212.946) (-1214.138) -- 0:00:33 467500 -- (-1217.264) (-1212.160) [-1210.804] (-1213.845) * (-1211.560) (-1213.761) (-1213.577) [-1212.247] -- 0:00:33 468000 -- (-1213.599) (-1211.019) [-1210.117] (-1215.383) * (-1211.568) (-1210.697) [-1214.375] (-1218.710) -- 0:00:32 468500 -- (-1214.668) [-1211.560] (-1210.456) (-1212.367) * (-1212.206) [-1212.040] (-1210.474) (-1211.481) -- 0:00:32 469000 -- [-1212.361] (-1210.057) (-1213.395) (-1212.994) * [-1212.967] (-1210.392) (-1211.221) (-1212.206) -- 0:00:32 469500 -- (-1211.123) (-1210.949) [-1213.213] (-1215.399) * (-1214.630) [-1210.749] (-1211.033) (-1212.552) -- 0:00:32 470000 -- (-1211.712) (-1212.296) [-1210.650] (-1213.612) * (-1210.865) [-1212.133] (-1210.932) (-1211.473) -- 0:00:32 Average standard deviation of split frequencies: 0.011268 470500 -- (-1210.203) (-1215.544) (-1211.842) [-1213.559] * (-1211.507) (-1211.690) [-1210.405] (-1211.517) -- 0:00:33 471000 -- [-1210.508] (-1215.187) (-1213.800) (-1214.288) * (-1210.567) (-1211.788) [-1210.332] (-1212.650) -- 0:00:33 471500 -- (-1209.904) (-1212.962) [-1210.723] (-1210.410) * (-1213.910) (-1212.309) [-1210.951] (-1211.658) -- 0:00:33 472000 -- (-1210.935) (-1210.325) [-1211.169] (-1216.833) * [-1211.769] (-1217.415) (-1212.898) (-1210.990) -- 0:00:33 472500 -- (-1211.537) [-1211.317] (-1214.887) (-1212.300) * (-1214.796) [-1214.211] (-1212.508) (-1210.856) -- 0:00:33 473000 -- (-1212.495) (-1211.986) (-1213.620) [-1211.114] * (-1212.996) [-1212.966] (-1210.658) (-1214.432) -- 0:00:33 473500 -- (-1211.420) [-1211.338] (-1212.881) (-1212.636) * [-1210.423] (-1214.514) (-1210.471) (-1215.136) -- 0:00:33 474000 -- [-1210.726] (-1213.816) (-1210.706) (-1215.676) * (-1210.531) [-1216.674] (-1213.090) (-1221.392) -- 0:00:33 474500 -- (-1211.545) (-1211.182) [-1211.563] (-1213.262) * [-1211.459] (-1212.274) (-1212.490) (-1218.500) -- 0:00:33 475000 -- (-1214.331) (-1211.529) [-1212.852] (-1213.857) * (-1212.044) [-1211.867] (-1211.080) (-1213.504) -- 0:00:33 Average standard deviation of split frequencies: 0.011884 475500 -- (-1211.098) (-1212.152) [-1211.638] (-1211.213) * (-1214.888) (-1212.284) [-1210.407] (-1214.524) -- 0:00:33 476000 -- [-1212.351] (-1211.453) (-1210.057) (-1213.535) * (-1214.966) (-1212.142) [-1212.586] (-1215.385) -- 0:00:33 476500 -- [-1212.229] (-1210.337) (-1211.677) (-1212.571) * (-1212.846) (-1210.192) (-1215.742) [-1214.764] -- 0:00:32 477000 -- (-1214.179) (-1211.383) (-1210.890) [-1210.675] * (-1211.822) [-1211.681] (-1213.927) (-1212.060) -- 0:00:32 477500 -- [-1211.593] (-1212.666) (-1216.150) (-1211.864) * [-1211.299] (-1212.040) (-1213.425) (-1210.940) -- 0:00:32 478000 -- (-1211.515) (-1212.733) (-1213.550) [-1210.778] * (-1216.074) [-1212.856] (-1213.289) (-1211.913) -- 0:00:32 478500 -- (-1211.541) (-1214.433) (-1213.128) [-1213.081] * (-1213.132) [-1213.848] (-1212.689) (-1213.025) -- 0:00:32 479000 -- (-1210.438) [-1210.254] (-1214.633) (-1212.016) * [-1210.473] (-1211.969) (-1211.221) (-1211.044) -- 0:00:32 479500 -- (-1214.112) [-1210.692] (-1214.602) (-1212.350) * [-1211.762] (-1211.411) (-1211.365) (-1215.309) -- 0:00:32 480000 -- (-1211.998) (-1212.519) [-1219.914] (-1211.275) * (-1212.800) (-1211.241) (-1211.916) [-1213.152] -- 0:00:32 Average standard deviation of split frequencies: 0.011891 480500 -- (-1210.497) (-1211.263) (-1212.326) [-1211.909] * (-1213.374) [-1212.193] (-1210.947) (-1212.587) -- 0:00:32 481000 -- [-1211.081] (-1212.060) (-1211.490) (-1211.988) * (-1213.362) [-1212.865] (-1210.726) (-1215.750) -- 0:00:32 481500 -- (-1210.058) [-1212.954] (-1211.907) (-1212.282) * (-1213.507) (-1213.830) (-1210.889) [-1214.818] -- 0:00:32 482000 -- (-1213.007) (-1212.565) [-1210.912] (-1212.086) * (-1215.613) (-1214.930) [-1211.755] (-1215.773) -- 0:00:32 482500 -- (-1211.637) (-1211.738) [-1213.008] (-1210.772) * (-1216.608) (-1214.266) (-1210.220) [-1215.740] -- 0:00:32 483000 -- (-1210.569) (-1216.565) (-1212.005) [-1211.668] * (-1210.255) (-1210.977) [-1211.154] (-1212.548) -- 0:00:32 483500 -- (-1210.725) [-1214.851] (-1213.647) (-1216.011) * (-1210.570) (-1210.977) (-1211.334) [-1211.448] -- 0:00:32 484000 -- [-1211.891] (-1211.462) (-1211.212) (-1217.653) * (-1217.052) (-1214.849) (-1212.588) [-1212.816] -- 0:00:31 484500 -- (-1213.183) [-1211.402] (-1213.736) (-1211.630) * (-1214.715) [-1214.477] (-1214.027) (-1212.237) -- 0:00:31 485000 -- [-1211.825] (-1211.300) (-1211.900) (-1210.726) * [-1212.629] (-1216.511) (-1213.886) (-1211.852) -- 0:00:31 Average standard deviation of split frequencies: 0.011579 485500 -- (-1211.817) (-1212.713) (-1212.281) [-1214.730] * (-1212.021) (-1213.335) (-1215.602) [-1212.971] -- 0:00:32 486000 -- (-1219.836) [-1212.377] (-1217.993) (-1213.582) * (-1211.612) (-1213.362) (-1210.319) [-1214.185] -- 0:00:32 486500 -- (-1213.171) (-1212.209) (-1219.007) [-1211.449] * [-1211.276] (-1215.270) (-1212.382) (-1212.154) -- 0:00:32 487000 -- (-1212.642) (-1211.730) [-1211.809] (-1213.555) * (-1215.674) (-1212.348) (-1213.671) [-1211.933] -- 0:00:32 487500 -- (-1210.708) (-1215.076) (-1214.008) [-1211.420] * (-1211.544) (-1211.165) [-1211.941] (-1213.030) -- 0:00:32 488000 -- (-1212.522) (-1212.696) [-1211.610] (-1211.260) * (-1213.330) (-1211.050) (-1210.098) [-1211.206] -- 0:00:32 488500 -- [-1210.938] (-1213.364) (-1213.110) (-1213.357) * [-1212.181] (-1210.568) (-1210.323) (-1214.180) -- 0:00:32 489000 -- (-1210.685) (-1214.272) [-1212.502] (-1210.514) * (-1212.665) [-1212.644] (-1210.279) (-1212.242) -- 0:00:32 489500 -- (-1211.320) (-1214.075) (-1214.767) [-1212.108] * [-1210.797] (-1213.307) (-1211.404) (-1211.185) -- 0:00:32 490000 -- (-1213.507) [-1212.644] (-1218.864) (-1212.108) * (-1212.575) [-1212.364] (-1210.519) (-1211.122) -- 0:00:32 Average standard deviation of split frequencies: 0.011589 490500 -- (-1217.997) [-1212.770] (-1216.388) (-1212.307) * (-1212.723) [-1211.675] (-1210.873) (-1213.493) -- 0:00:32 491000 -- [-1212.681] (-1212.207) (-1212.939) (-1211.959) * (-1212.940) (-1211.836) [-1210.123] (-1215.225) -- 0:00:32 491500 -- (-1210.890) [-1212.681] (-1212.736) (-1210.657) * (-1214.530) (-1215.108) (-1215.897) [-1215.232] -- 0:00:32 492000 -- (-1211.321) (-1210.978) [-1211.187] (-1211.530) * (-1212.557) [-1211.773] (-1213.828) (-1211.458) -- 0:00:32 492500 -- (-1210.815) (-1211.597) (-1213.189) [-1211.478] * (-1210.225) [-1211.551] (-1213.358) (-1212.191) -- 0:00:31 493000 -- (-1212.963) (-1210.320) [-1212.746] (-1211.304) * [-1210.830] (-1210.579) (-1214.282) (-1210.904) -- 0:00:31 493500 -- [-1211.743] (-1210.528) (-1214.324) (-1211.969) * (-1214.312) [-1210.090] (-1217.094) (-1212.803) -- 0:00:31 494000 -- (-1210.928) [-1212.581] (-1213.608) (-1212.617) * (-1218.264) (-1214.332) (-1212.306) [-1210.930] -- 0:00:31 494500 -- (-1212.141) [-1212.275] (-1210.575) (-1212.617) * [-1210.686] (-1220.858) (-1213.761) (-1213.099) -- 0:00:31 495000 -- (-1211.430) (-1211.581) (-1210.197) [-1210.721] * (-1211.164) (-1214.498) (-1211.942) [-1211.307] -- 0:00:31 Average standard deviation of split frequencies: 0.011702 495500 -- (-1214.682) (-1216.595) [-1210.513] (-1211.428) * (-1213.032) [-1210.527] (-1212.866) (-1210.517) -- 0:00:31 496000 -- [-1215.690] (-1215.645) (-1210.585) (-1215.336) * (-1210.104) [-1209.837] (-1211.127) (-1210.530) -- 0:00:31 496500 -- (-1211.861) (-1212.948) (-1211.032) [-1212.144] * [-1212.941] (-1209.837) (-1211.271) (-1210.680) -- 0:00:31 497000 -- (-1212.160) (-1211.526) [-1213.122] (-1213.607) * (-1212.594) [-1209.895] (-1211.910) (-1212.464) -- 0:00:31 497500 -- (-1210.626) [-1217.630] (-1212.343) (-1214.602) * (-1213.090) (-1212.029) [-1210.665] (-1211.495) -- 0:00:31 498000 -- (-1210.693) (-1213.219) (-1216.334) [-1211.594] * (-1214.379) [-1212.223] (-1210.885) (-1213.461) -- 0:00:32 498500 -- (-1211.463) [-1210.896] (-1215.065) (-1213.439) * [-1213.674] (-1211.405) (-1210.902) (-1214.405) -- 0:00:32 499000 -- [-1212.833] (-1211.743) (-1210.909) (-1214.044) * (-1213.819) [-1211.157] (-1213.498) (-1212.711) -- 0:00:32 499500 -- (-1214.350) [-1212.939] (-1213.220) (-1212.913) * (-1214.413) [-1212.682] (-1214.271) (-1213.034) -- 0:00:32 500000 -- (-1212.191) (-1213.820) [-1213.285] (-1216.631) * (-1211.648) (-1214.785) [-1212.048] (-1213.493) -- 0:00:32 Average standard deviation of split frequencies: 0.011357 500500 -- (-1214.337) (-1212.674) (-1212.131) [-1212.735] * (-1214.224) (-1212.624) [-1211.214] (-1215.801) -- 0:00:31 501000 -- (-1212.105) (-1212.034) [-1212.398] (-1212.371) * (-1214.292) (-1211.751) [-1212.516] (-1213.423) -- 0:00:31 501500 -- [-1210.353] (-1211.100) (-1214.632) (-1212.124) * (-1213.620) [-1211.986] (-1211.544) (-1210.716) -- 0:00:31 502000 -- (-1212.678) (-1212.934) (-1214.112) [-1210.885] * [-1210.359] (-1211.383) (-1210.914) (-1211.677) -- 0:00:31 502500 -- (-1213.143) (-1213.445) [-1211.831] (-1210.617) * (-1209.956) (-1211.698) (-1211.691) [-1210.665] -- 0:00:31 503000 -- [-1210.318] (-1212.605) (-1215.492) (-1210.533) * [-1213.245] (-1210.415) (-1212.310) (-1210.710) -- 0:00:31 503500 -- [-1213.597] (-1212.527) (-1216.764) (-1211.683) * [-1212.840] (-1214.925) (-1213.210) (-1211.682) -- 0:00:31 504000 -- (-1214.693) (-1211.559) [-1214.311] (-1215.958) * (-1213.190) [-1211.657] (-1210.976) (-1211.924) -- 0:00:31 504500 -- [-1213.322] (-1210.475) (-1212.918) (-1215.442) * [-1213.182] (-1213.704) (-1212.280) (-1211.143) -- 0:00:31 505000 -- [-1213.299] (-1216.736) (-1212.963) (-1213.955) * (-1210.610) (-1212.426) [-1211.796] (-1211.138) -- 0:00:31 Average standard deviation of split frequencies: 0.010888 505500 -- (-1215.197) (-1214.589) [-1211.239] (-1212.977) * (-1211.392) (-1211.372) (-1211.004) [-1210.589] -- 0:00:31 506000 -- (-1215.241) [-1215.092] (-1212.323) (-1211.868) * (-1211.981) (-1211.944) (-1212.360) [-1210.612] -- 0:00:31 506500 -- [-1213.248] (-1213.081) (-1215.280) (-1213.487) * (-1216.921) (-1213.344) (-1210.479) [-1211.305] -- 0:00:31 507000 -- (-1211.612) (-1214.198) (-1212.235) [-1211.263] * [-1210.503] (-1211.302) (-1211.330) (-1212.806) -- 0:00:31 507500 -- (-1211.007) (-1212.805) [-1211.454] (-1210.811) * [-1210.012] (-1211.060) (-1213.538) (-1211.265) -- 0:00:31 508000 -- (-1212.304) [-1211.579] (-1212.509) (-1214.323) * (-1214.125) [-1211.363] (-1215.095) (-1210.867) -- 0:00:30 508500 -- (-1213.375) [-1211.756] (-1213.377) (-1210.074) * (-1211.312) (-1211.311) (-1212.585) [-1210.364] -- 0:00:30 509000 -- (-1210.299) (-1210.962) [-1212.132] (-1210.028) * (-1211.005) (-1212.159) (-1211.713) [-1213.117] -- 0:00:30 509500 -- (-1210.609) [-1212.518] (-1213.704) (-1213.772) * (-1210.085) (-1211.020) [-1210.240] (-1216.810) -- 0:00:30 510000 -- (-1212.688) [-1212.093] (-1210.700) (-1214.976) * (-1210.656) [-1211.227] (-1213.795) (-1210.754) -- 0:00:30 Average standard deviation of split frequencies: 0.010962 510500 -- (-1210.263) [-1212.184] (-1213.663) (-1212.429) * [-1211.757] (-1212.146) (-1213.868) (-1214.439) -- 0:00:30 511000 -- [-1210.296] (-1211.661) (-1213.419) (-1211.249) * [-1210.080] (-1214.224) (-1215.260) (-1212.452) -- 0:00:31 511500 -- [-1210.719] (-1211.350) (-1211.834) (-1215.879) * [-1212.163] (-1210.613) (-1212.398) (-1212.550) -- 0:00:31 512000 -- (-1214.513) (-1210.537) (-1214.864) [-1210.770] * (-1213.560) (-1213.015) (-1210.717) [-1215.769] -- 0:00:31 512500 -- (-1214.342) (-1213.972) [-1214.188] (-1211.283) * (-1211.153) (-1213.902) [-1211.619] (-1215.518) -- 0:00:31 513000 -- (-1211.215) (-1212.241) (-1215.831) [-1218.865] * [-1214.096] (-1212.693) (-1211.924) (-1218.085) -- 0:00:31 513500 -- [-1211.577] (-1212.355) (-1212.474) (-1219.390) * (-1211.997) (-1212.584) (-1214.211) [-1211.417] -- 0:00:31 514000 -- (-1213.409) (-1212.770) [-1211.036] (-1213.182) * (-1214.362) (-1216.951) [-1211.349] (-1211.427) -- 0:00:31 514500 -- (-1214.709) (-1215.136) [-1211.459] (-1211.584) * (-1212.921) (-1211.501) (-1210.985) [-1211.730] -- 0:00:31 515000 -- [-1213.355] (-1212.903) (-1211.683) (-1211.650) * (-1211.442) (-1212.088) [-1214.230] (-1212.635) -- 0:00:31 Average standard deviation of split frequencies: 0.010849 515500 -- (-1212.889) (-1212.029) (-1211.639) [-1211.945] * [-1213.580] (-1212.172) (-1211.351) (-1217.908) -- 0:00:31 516000 -- (-1217.133) (-1216.026) (-1210.549) [-1210.119] * [-1214.701] (-1210.156) (-1215.282) (-1212.011) -- 0:00:30 516500 -- [-1212.214] (-1214.035) (-1210.215) (-1211.789) * (-1211.334) (-1210.118) (-1211.735) [-1211.141] -- 0:00:30 517000 -- (-1220.515) (-1213.356) (-1211.135) [-1212.449] * (-1211.627) (-1214.607) [-1213.051] (-1210.818) -- 0:00:30 517500 -- [-1223.611] (-1211.846) (-1214.472) (-1212.328) * (-1211.832) [-1212.125] (-1217.360) (-1211.196) -- 0:00:30 518000 -- (-1215.056) (-1216.076) (-1211.683) [-1216.827] * (-1212.008) (-1210.813) [-1210.922] (-1210.962) -- 0:00:30 518500 -- (-1215.042) [-1213.874] (-1210.116) (-1213.007) * (-1216.777) (-1212.373) [-1211.723] (-1212.268) -- 0:00:30 519000 -- (-1211.358) [-1211.229] (-1211.486) (-1216.096) * (-1215.065) (-1212.332) [-1210.877] (-1214.659) -- 0:00:30 519500 -- (-1214.577) (-1210.621) [-1214.379] (-1211.039) * (-1211.129) [-1213.800] (-1210.584) (-1211.464) -- 0:00:30 520000 -- (-1215.162) (-1214.960) (-1210.619) [-1213.118] * (-1210.488) (-1211.910) [-1213.622] (-1211.415) -- 0:00:30 Average standard deviation of split frequencies: 0.011034 520500 -- (-1211.520) (-1212.472) [-1212.350] (-1213.739) * (-1212.439) [-1214.447] (-1213.876) (-1211.390) -- 0:00:30 521000 -- (-1213.810) (-1210.760) (-1211.952) [-1213.339] * (-1210.932) [-1210.263] (-1211.174) (-1213.645) -- 0:00:30 521500 -- (-1213.947) [-1213.666] (-1213.246) (-1212.129) * (-1215.212) (-1210.858) [-1213.876] (-1211.256) -- 0:00:30 522000 -- (-1210.851) [-1215.847] (-1215.656) (-1214.215) * [-1211.466] (-1211.107) (-1212.447) (-1213.018) -- 0:00:30 522500 -- (-1213.402) (-1212.535) (-1220.518) [-1212.352] * (-1212.068) (-1211.931) (-1210.873) [-1211.390] -- 0:00:30 523000 -- (-1215.712) [-1213.521] (-1215.780) (-1212.659) * [-1210.802] (-1217.234) (-1211.098) (-1210.920) -- 0:00:30 523500 -- (-1211.680) (-1215.427) [-1210.834] (-1212.688) * (-1214.289) [-1210.345] (-1210.929) (-1210.942) -- 0:00:30 524000 -- (-1213.866) (-1211.196) [-1213.877] (-1214.093) * (-1213.083) (-1210.789) (-1211.445) [-1211.468] -- 0:00:30 524500 -- (-1211.462) [-1211.868] (-1211.009) (-1217.013) * (-1215.218) (-1211.576) [-1210.700] (-1210.600) -- 0:00:30 525000 -- (-1212.885) [-1210.289] (-1213.150) (-1212.220) * [-1211.357] (-1212.874) (-1210.556) (-1212.988) -- 0:00:30 Average standard deviation of split frequencies: 0.011763 525500 -- (-1215.947) (-1214.303) [-1210.226] (-1211.651) * (-1212.515) [-1214.277] (-1211.755) (-1210.124) -- 0:00:30 526000 -- (-1213.726) [-1212.278] (-1210.706) (-1212.420) * (-1211.758) (-1213.096) [-1210.749] (-1212.861) -- 0:00:30 526500 -- (-1211.690) (-1214.540) [-1211.152] (-1211.961) * (-1211.617) [-1212.526] (-1212.177) (-1212.464) -- 0:00:30 527000 -- (-1212.109) (-1211.960) [-1210.918] (-1211.335) * (-1213.888) (-1211.917) (-1212.532) [-1212.510] -- 0:00:30 527500 -- (-1211.774) (-1213.322) (-1210.452) [-1210.130] * [-1210.551] (-1215.974) (-1212.186) (-1213.891) -- 0:00:30 528000 -- (-1212.228) [-1214.113] (-1211.152) (-1211.602) * (-1211.234) (-1214.400) [-1211.319] (-1214.063) -- 0:00:30 528500 -- [-1216.828] (-1212.077) (-1211.183) (-1213.627) * (-1211.136) (-1214.380) (-1213.513) [-1211.365] -- 0:00:30 529000 -- (-1212.334) (-1210.369) (-1213.064) [-1210.655] * (-1212.882) (-1213.367) [-1213.346] (-1211.298) -- 0:00:30 529500 -- (-1211.776) [-1211.062] (-1213.108) (-1212.039) * (-1211.155) [-1212.687] (-1210.247) (-1211.601) -- 0:00:30 530000 -- (-1213.732) (-1213.665) [-1212.009] (-1212.451) * (-1211.258) [-1211.154] (-1210.604) (-1210.607) -- 0:00:30 Average standard deviation of split frequencies: 0.011371 530500 -- (-1211.064) (-1217.890) (-1214.619) [-1212.561] * [-1212.909] (-1210.058) (-1218.556) (-1211.677) -- 0:00:30 531000 -- (-1214.653) (-1217.149) [-1213.190] (-1214.711) * (-1214.999) (-1216.108) (-1212.167) [-1213.019] -- 0:00:30 531500 -- (-1212.583) (-1213.499) (-1211.673) [-1210.247] * [-1214.519] (-1213.686) (-1213.434) (-1212.088) -- 0:00:29 532000 -- (-1214.337) (-1213.209) [-1213.296] (-1211.980) * (-1211.474) (-1212.570) [-1211.154] (-1213.576) -- 0:00:29 532500 -- (-1211.783) [-1215.118] (-1213.468) (-1210.646) * (-1211.626) (-1213.248) [-1210.577] (-1212.574) -- 0:00:29 533000 -- (-1211.464) (-1214.672) (-1213.091) [-1210.487] * (-1212.604) (-1213.548) (-1214.098) [-1210.029] -- 0:00:29 533500 -- (-1212.778) (-1210.544) (-1212.955) [-1210.423] * (-1212.614) (-1217.206) [-1210.959] (-1210.251) -- 0:00:29 534000 -- (-1214.650) [-1213.198] (-1213.168) (-1214.886) * (-1210.592) (-1212.825) (-1213.727) [-1210.604] -- 0:00:29 534500 -- (-1217.301) (-1213.106) [-1213.171] (-1214.249) * (-1212.791) (-1211.982) [-1211.593] (-1210.431) -- 0:00:29 535000 -- (-1215.873) (-1212.575) [-1212.452] (-1212.200) * (-1211.650) [-1210.075] (-1213.031) (-1211.769) -- 0:00:29 Average standard deviation of split frequencies: 0.011257 535500 -- (-1216.821) (-1214.289) [-1212.161] (-1211.085) * (-1211.929) [-1214.423] (-1211.826) (-1214.489) -- 0:00:29 536000 -- (-1211.274) (-1211.747) [-1210.510] (-1212.262) * (-1215.707) (-1213.678) [-1212.210] (-1211.975) -- 0:00:29 536500 -- (-1213.588) (-1211.234) [-1210.510] (-1211.086) * [-1210.974] (-1215.293) (-1212.993) (-1213.448) -- 0:00:30 537000 -- (-1210.967) (-1212.087) (-1211.809) [-1213.654] * (-1212.585) (-1212.705) [-1214.158] (-1218.859) -- 0:00:30 537500 -- (-1213.063) (-1210.903) (-1212.347) [-1215.430] * (-1211.750) (-1213.072) [-1212.508] (-1212.644) -- 0:00:30 538000 -- [-1210.862] (-1210.822) (-1213.253) (-1212.292) * (-1212.795) (-1213.010) (-1210.340) [-1211.582] -- 0:00:30 538500 -- (-1212.305) (-1212.754) (-1211.395) [-1212.631] * (-1211.088) (-1211.050) (-1210.477) [-1212.607] -- 0:00:29 539000 -- (-1209.919) (-1210.407) (-1211.756) [-1214.559] * (-1213.254) [-1211.693] (-1212.688) (-1213.336) -- 0:00:29 539500 -- (-1212.254) (-1211.463) (-1213.826) [-1213.456] * (-1212.924) (-1210.507) [-1211.665] (-1214.678) -- 0:00:29 540000 -- (-1213.659) [-1211.117] (-1210.653) (-1211.293) * [-1212.483] (-1212.622) (-1213.447) (-1214.824) -- 0:00:29 Average standard deviation of split frequencies: 0.011102 540500 -- (-1214.394) (-1210.978) [-1211.211] (-1212.605) * (-1210.562) (-1210.911) (-1212.589) [-1212.295] -- 0:00:29 541000 -- (-1210.263) (-1211.175) [-1211.403] (-1216.121) * (-1212.516) [-1212.037] (-1212.291) (-1214.133) -- 0:00:29 541500 -- (-1212.125) (-1211.695) [-1211.403] (-1214.736) * (-1212.241) (-1214.725) (-1211.797) [-1211.637] -- 0:00:29 542000 -- (-1212.385) (-1211.563) (-1216.045) [-1212.776] * [-1213.747] (-1211.815) (-1212.525) (-1213.044) -- 0:00:29 542500 -- (-1214.327) (-1213.896) (-1211.238) [-1211.676] * (-1212.794) [-1210.573] (-1211.235) (-1217.338) -- 0:00:29 543000 -- (-1217.467) [-1212.514] (-1213.718) (-1210.675) * (-1211.205) (-1210.905) [-1212.639] (-1215.211) -- 0:00:29 543500 -- (-1214.574) (-1215.709) [-1214.626] (-1216.260) * [-1211.140] (-1213.647) (-1211.985) (-1213.141) -- 0:00:29 544000 -- [-1211.231] (-1211.286) (-1212.077) (-1212.344) * (-1213.486) (-1210.976) [-1211.502] (-1212.881) -- 0:00:29 544500 -- (-1212.889) (-1214.216) (-1214.031) [-1214.995] * (-1210.332) [-1211.182] (-1215.676) (-1212.865) -- 0:00:29 545000 -- (-1214.555) (-1211.531) (-1214.291) [-1213.377] * [-1211.479] (-1211.182) (-1213.695) (-1213.969) -- 0:00:29 Average standard deviation of split frequencies: 0.011339 545500 -- (-1212.801) (-1212.041) (-1210.206) [-1211.695] * [-1210.022] (-1212.151) (-1213.665) (-1212.634) -- 0:00:29 546000 -- (-1216.883) [-1212.042] (-1210.240) (-1211.450) * (-1212.756) [-1210.371] (-1213.970) (-1211.992) -- 0:00:29 546500 -- (-1211.391) (-1212.455) (-1210.701) [-1210.071] * [-1212.038] (-1214.175) (-1211.318) (-1214.742) -- 0:00:29 547000 -- (-1210.523) [-1213.013] (-1211.853) (-1210.456) * (-1212.825) (-1210.952) [-1211.626] (-1212.580) -- 0:00:28 547500 -- (-1213.015) (-1211.768) [-1212.429] (-1211.061) * [-1211.206] (-1210.194) (-1212.864) (-1211.098) -- 0:00:28 548000 -- (-1214.126) (-1212.609) [-1211.902] (-1213.753) * (-1210.353) [-1210.656] (-1212.594) (-1212.402) -- 0:00:28 548500 -- (-1211.624) (-1210.505) (-1212.246) [-1210.652] * (-1212.624) [-1211.327] (-1212.517) (-1212.047) -- 0:00:28 549000 -- (-1211.640) [-1210.829] (-1212.337) (-1214.439) * (-1212.419) (-1210.575) (-1211.735) [-1213.391] -- 0:00:28 549500 -- [-1210.756] (-1212.482) (-1213.396) (-1212.065) * (-1210.513) (-1210.421) [-1211.630] (-1214.580) -- 0:00:28 550000 -- [-1210.736] (-1215.505) (-1211.892) (-1213.401) * [-1211.038] (-1211.346) (-1213.861) (-1215.862) -- 0:00:28 Average standard deviation of split frequencies: 0.011528 550500 -- [-1211.531] (-1213.655) (-1213.339) (-1213.021) * (-1211.957) (-1210.953) [-1212.451] (-1213.775) -- 0:00:28 551000 -- [-1211.060] (-1210.918) (-1210.522) (-1211.014) * [-1211.841] (-1212.208) (-1212.832) (-1210.661) -- 0:00:28 551500 -- (-1210.669) (-1212.888) (-1212.595) [-1212.295] * (-1211.834) (-1211.151) (-1214.320) [-1211.615] -- 0:00:29 552000 -- (-1210.515) (-1212.608) (-1215.149) [-1211.502] * (-1213.502) (-1210.630) (-1212.592) [-1214.993] -- 0:00:29 552500 -- [-1212.474] (-1211.464) (-1210.705) (-1211.145) * (-1213.934) (-1212.813) (-1212.273) [-1213.324] -- 0:00:29 553000 -- [-1213.401] (-1210.698) (-1211.930) (-1210.520) * (-1214.380) [-1213.471] (-1212.260) (-1222.028) -- 0:00:29 553500 -- [-1211.145] (-1210.521) (-1210.844) (-1213.783) * (-1217.515) (-1215.174) (-1210.456) [-1213.157] -- 0:00:29 554000 -- (-1213.513) [-1213.168] (-1211.544) (-1211.841) * (-1213.060) (-1212.373) [-1212.649] (-1213.634) -- 0:00:28 554500 -- (-1211.244) [-1214.811] (-1215.628) (-1212.089) * (-1219.334) (-1211.552) [-1211.839] (-1213.486) -- 0:00:28 555000 -- (-1212.605) [-1212.269] (-1210.393) (-1214.260) * (-1210.711) [-1211.089] (-1210.918) (-1214.226) -- 0:00:28 Average standard deviation of split frequencies: 0.011305 555500 -- [-1210.531] (-1211.162) (-1210.391) (-1215.882) * (-1213.566) (-1212.695) (-1212.879) [-1212.020] -- 0:00:28 556000 -- (-1212.483) (-1213.800) [-1212.540] (-1217.225) * (-1213.146) [-1210.597] (-1222.076) (-1210.962) -- 0:00:28 556500 -- (-1210.393) (-1211.219) [-1214.344] (-1211.579) * (-1212.053) (-1210.445) (-1216.169) [-1212.010] -- 0:00:28 557000 -- [-1213.007] (-1210.795) (-1210.003) (-1213.091) * (-1216.288) (-1210.334) (-1216.292) [-1213.695] -- 0:00:28 557500 -- (-1213.666) (-1212.112) [-1212.058] (-1213.158) * (-1210.823) (-1210.982) (-1215.971) [-1212.150] -- 0:00:28 558000 -- [-1214.965] (-1213.321) (-1212.025) (-1212.372) * [-1213.500] (-1211.960) (-1215.946) (-1210.373) -- 0:00:28 558500 -- (-1210.435) (-1210.919) [-1212.667] (-1212.838) * (-1212.648) (-1212.772) [-1212.685] (-1211.718) -- 0:00:28 559000 -- (-1213.953) (-1211.870) [-1210.120] (-1211.901) * (-1212.191) (-1210.620) [-1211.011] (-1211.043) -- 0:00:28 559500 -- [-1211.795] (-1216.052) (-1214.301) (-1213.703) * (-1213.690) [-1211.225] (-1212.068) (-1210.567) -- 0:00:28 560000 -- (-1210.915) (-1216.575) [-1211.172] (-1211.833) * (-1213.635) (-1212.256) [-1212.808] (-1212.463) -- 0:00:28 Average standard deviation of split frequencies: 0.010562 560500 -- (-1212.555) (-1214.181) [-1214.114] (-1212.873) * (-1212.571) (-1213.954) [-1211.255] (-1216.769) -- 0:00:28 561000 -- (-1211.183) [-1213.611] (-1213.452) (-1213.054) * (-1212.434) (-1211.748) [-1210.349] (-1212.058) -- 0:00:28 561500 -- (-1213.528) [-1213.596] (-1216.873) (-1210.804) * (-1216.772) (-1213.782) [-1211.103] (-1210.804) -- 0:00:28 562000 -- (-1211.348) (-1214.816) (-1214.145) [-1212.916] * [-1211.300] (-1210.851) (-1211.154) (-1211.669) -- 0:00:28 562500 -- (-1211.969) (-1211.926) (-1211.161) [-1212.787] * (-1220.868) (-1212.181) [-1211.857] (-1210.508) -- 0:00:28 563000 -- (-1211.625) (-1219.144) (-1215.544) [-1211.397] * (-1215.426) (-1213.174) (-1213.184) [-1210.455] -- 0:00:27 563500 -- [-1211.808] (-1213.147) (-1215.585) (-1211.972) * [-1212.165] (-1215.105) (-1213.306) (-1211.787) -- 0:00:27 564000 -- [-1211.651] (-1213.723) (-1210.990) (-1212.045) * [-1211.880] (-1213.129) (-1210.441) (-1213.343) -- 0:00:27 564500 -- (-1212.242) (-1213.070) (-1210.613) [-1211.831] * (-1211.308) [-1210.579] (-1212.640) (-1213.834) -- 0:00:27 565000 -- (-1213.506) [-1210.573] (-1210.857) (-1212.751) * [-1211.196] (-1210.503) (-1212.691) (-1212.740) -- 0:00:27 Average standard deviation of split frequencies: 0.010484 565500 -- [-1212.856] (-1210.693) (-1212.109) (-1213.901) * (-1211.307) (-1211.263) [-1210.527] (-1212.658) -- 0:00:27 566000 -- (-1212.181) [-1210.519] (-1212.279) (-1210.779) * (-1214.351) [-1211.185] (-1213.156) (-1214.185) -- 0:00:27 566500 -- (-1213.088) (-1211.589) (-1210.344) [-1211.487] * (-1215.294) (-1213.093) [-1211.007] (-1213.515) -- 0:00:27 567000 -- (-1213.490) (-1213.358) [-1210.947] (-1213.991) * [-1212.434] (-1211.263) (-1211.172) (-1211.206) -- 0:00:27 567500 -- [-1212.390] (-1214.624) (-1214.487) (-1214.227) * (-1213.407) (-1210.825) (-1211.579) [-1214.412] -- 0:00:27 568000 -- [-1213.180] (-1211.963) (-1214.506) (-1212.609) * (-1212.962) (-1215.368) [-1213.344] (-1218.135) -- 0:00:28 568500 -- [-1210.748] (-1211.842) (-1213.948) (-1211.489) * (-1213.013) (-1213.364) (-1213.335) [-1213.187] -- 0:00:28 569000 -- [-1210.636] (-1216.241) (-1212.468) (-1211.738) * (-1215.242) (-1213.759) [-1213.339] (-1212.413) -- 0:00:28 569500 -- (-1212.439) (-1210.774) (-1213.194) [-1210.237] * (-1210.637) (-1214.860) [-1210.910] (-1211.515) -- 0:00:27 570000 -- (-1211.344) [-1210.358] (-1211.314) (-1212.786) * (-1211.561) [-1214.416] (-1210.794) (-1213.328) -- 0:00:27 Average standard deviation of split frequencies: 0.010636 570500 -- (-1211.070) [-1211.096] (-1210.029) (-1215.022) * (-1212.770) [-1214.500] (-1212.059) (-1215.300) -- 0:00:27 571000 -- (-1211.273) (-1211.103) [-1211.500] (-1211.893) * (-1210.773) [-1211.596] (-1216.306) (-1214.602) -- 0:00:27 571500 -- [-1213.285] (-1218.263) (-1210.512) (-1210.932) * [-1212.824] (-1211.143) (-1212.779) (-1212.228) -- 0:00:27 572000 -- [-1214.396] (-1210.225) (-1212.378) (-1214.982) * (-1212.746) (-1211.023) (-1212.779) [-1211.440] -- 0:00:27 572500 -- [-1210.429] (-1210.941) (-1211.958) (-1211.255) * (-1210.856) (-1211.551) (-1212.846) [-1211.640] -- 0:00:27 573000 -- (-1211.968) (-1213.425) (-1211.935) [-1211.308] * (-1210.016) (-1211.546) (-1212.799) [-1211.490] -- 0:00:27 573500 -- (-1212.023) (-1214.391) [-1213.564] (-1213.553) * (-1210.923) (-1219.414) (-1215.317) [-1210.754] -- 0:00:27 574000 -- (-1214.949) (-1212.945) [-1213.756] (-1214.362) * (-1211.663) [-1211.299] (-1215.971) (-1211.300) -- 0:00:27 574500 -- (-1215.921) (-1217.712) [-1214.133] (-1211.288) * (-1211.702) (-1211.286) [-1215.044] (-1213.187) -- 0:00:27 575000 -- (-1214.380) [-1213.075] (-1217.353) (-1211.033) * (-1214.633) (-1210.923) [-1218.023] (-1214.801) -- 0:00:27 Average standard deviation of split frequencies: 0.010281 575500 -- [-1212.044] (-1214.300) (-1210.354) (-1210.735) * (-1211.711) [-1210.682] (-1211.559) (-1215.025) -- 0:00:27 576000 -- (-1211.850) (-1213.102) [-1212.821] (-1211.724) * [-1211.353] (-1210.723) (-1213.400) (-1211.531) -- 0:00:27 576500 -- (-1212.527) (-1211.233) [-1210.231] (-1211.663) * [-1213.185] (-1210.146) (-1212.248) (-1212.158) -- 0:00:27 577000 -- (-1211.733) (-1212.190) [-1211.965] (-1211.311) * (-1211.552) (-1210.959) [-1210.846] (-1210.255) -- 0:00:27 577500 -- (-1210.247) (-1212.374) (-1211.319) [-1210.236] * (-1213.216) [-1212.589] (-1213.730) (-1211.513) -- 0:00:27 578000 -- (-1210.163) (-1212.718) (-1218.701) [-1211.526] * [-1213.161] (-1216.280) (-1210.635) (-1213.191) -- 0:00:27 578500 -- (-1209.905) (-1212.949) [-1211.148] (-1213.664) * [-1213.581] (-1211.002) (-1210.003) (-1211.920) -- 0:00:26 579000 -- [-1209.902] (-1212.617) (-1211.669) (-1210.759) * [-1215.063] (-1215.519) (-1211.119) (-1211.194) -- 0:00:26 579500 -- [-1213.222] (-1214.293) (-1211.916) (-1211.439) * (-1216.258) (-1214.760) (-1210.350) [-1213.974] -- 0:00:26 580000 -- (-1213.656) (-1212.703) [-1209.918] (-1211.008) * (-1210.976) [-1211.241] (-1210.350) (-1216.555) -- 0:00:26 Average standard deviation of split frequencies: 0.010402 580500 -- (-1214.590) (-1212.174) (-1212.508) [-1210.207] * (-1214.456) [-1210.715] (-1210.070) (-1215.711) -- 0:00:26 581000 -- (-1211.860) (-1211.725) (-1212.027) [-1212.409] * [-1214.530] (-1210.453) (-1211.778) (-1213.175) -- 0:00:26 581500 -- (-1212.671) (-1210.682) [-1214.057] (-1212.342) * [-1211.836] (-1211.179) (-1211.059) (-1215.382) -- 0:00:26 582000 -- (-1215.519) (-1210.275) [-1211.254] (-1214.888) * (-1210.003) (-1211.839) (-1211.676) [-1216.350] -- 0:00:26 582500 -- (-1216.682) (-1211.921) (-1211.604) [-1210.949] * (-1209.751) [-1210.755] (-1215.131) (-1215.094) -- 0:00:26 583000 -- (-1216.825) (-1210.002) [-1210.897] (-1210.864) * [-1209.929] (-1210.688) (-1214.104) (-1213.132) -- 0:00:26 583500 -- (-1212.689) (-1210.778) [-1212.760] (-1211.592) * (-1211.204) (-1210.803) (-1210.786) [-1210.684] -- 0:00:26 584000 -- [-1210.448] (-1212.773) (-1212.349) (-1211.115) * (-1210.754) (-1211.969) (-1211.139) [-1212.598] -- 0:00:27 584500 -- (-1215.145) (-1211.453) (-1213.195) [-1211.082] * (-1210.189) [-1212.051] (-1211.725) (-1213.302) -- 0:00:27 585000 -- (-1213.134) (-1211.802) (-1215.672) [-1212.693] * (-1215.266) (-1212.563) (-1211.004) [-1212.197] -- 0:00:26 Average standard deviation of split frequencies: 0.010005 585500 -- [-1212.850] (-1212.022) (-1213.994) (-1216.409) * (-1212.098) (-1215.260) (-1211.103) [-1211.119] -- 0:00:26 586000 -- [-1215.652] (-1210.490) (-1210.713) (-1212.586) * (-1212.825) [-1211.517] (-1212.959) (-1217.497) -- 0:00:26 586500 -- (-1214.653) (-1210.217) (-1210.458) [-1213.131] * (-1212.078) (-1214.807) [-1210.955] (-1214.389) -- 0:00:26 587000 -- (-1211.758) [-1210.281] (-1210.507) (-1214.999) * [-1212.020] (-1212.015) (-1210.942) (-1212.403) -- 0:00:26 587500 -- (-1216.490) (-1210.804) [-1213.946] (-1213.094) * (-1210.074) (-1211.219) (-1211.679) [-1213.205] -- 0:00:26 588000 -- (-1212.955) (-1211.743) [-1213.797] (-1211.129) * (-1213.520) [-1212.002] (-1215.571) (-1213.845) -- 0:00:26 588500 -- (-1216.748) (-1211.790) (-1213.989) [-1211.316] * (-1216.990) (-1212.725) (-1214.713) [-1211.381] -- 0:00:26 589000 -- (-1213.470) (-1213.212) (-1213.509) [-1211.585] * [-1212.061] (-1212.860) (-1212.270) (-1211.545) -- 0:00:26 589500 -- (-1211.000) [-1212.217] (-1212.880) (-1211.750) * [-1211.912] (-1214.846) (-1210.204) (-1211.373) -- 0:00:26 590000 -- (-1214.087) (-1214.432) [-1211.540] (-1212.234) * (-1212.495) (-1213.847) (-1212.935) [-1210.452] -- 0:00:26 Average standard deviation of split frequencies: 0.009328 590500 -- (-1214.770) [-1214.657] (-1212.737) (-1211.384) * (-1211.360) (-1213.338) (-1212.913) [-1210.477] -- 0:00:26 591000 -- (-1211.732) [-1211.818] (-1212.664) (-1210.417) * (-1213.148) [-1213.302] (-1210.818) (-1212.282) -- 0:00:26 591500 -- (-1212.151) (-1211.684) [-1212.607] (-1216.207) * (-1212.066) (-1211.696) [-1211.184] (-1210.247) -- 0:00:26 592000 -- (-1211.966) (-1214.765) [-1213.263] (-1219.614) * (-1210.687) (-1211.198) [-1211.048] (-1210.791) -- 0:00:26 592500 -- (-1216.273) (-1214.990) [-1210.766] (-1214.488) * [-1211.932] (-1213.885) (-1210.779) (-1216.873) -- 0:00:26 593000 -- (-1215.279) (-1220.180) (-1213.278) [-1213.035] * (-1213.166) (-1212.399) [-1210.947] (-1210.311) -- 0:00:26 593500 -- (-1215.276) (-1214.184) (-1213.130) [-1217.246] * (-1213.155) (-1211.586) [-1210.444] (-1213.608) -- 0:00:26 594000 -- [-1211.036] (-1212.783) (-1211.416) (-1212.919) * (-1211.368) [-1211.519] (-1211.558) (-1213.678) -- 0:00:25 594500 -- (-1210.542) [-1214.231] (-1210.798) (-1210.590) * (-1211.374) (-1214.963) (-1215.100) [-1212.413] -- 0:00:25 595000 -- [-1210.720] (-1212.943) (-1210.371) (-1210.987) * [-1214.001] (-1210.286) (-1210.291) (-1211.845) -- 0:00:25 Average standard deviation of split frequencies: 0.008849 595500 -- (-1210.591) (-1212.881) (-1213.419) [-1214.680] * (-1214.587) (-1212.244) [-1211.805] (-1215.050) -- 0:00:25 596000 -- (-1210.013) [-1214.413] (-1210.355) (-1213.975) * (-1211.962) (-1212.634) [-1211.989] (-1213.010) -- 0:00:25 596500 -- (-1214.166) [-1210.527] (-1210.136) (-1211.384) * [-1212.350] (-1214.144) (-1214.036) (-1213.317) -- 0:00:25 597000 -- (-1213.124) (-1212.207) [-1210.458] (-1210.125) * [-1213.521] (-1214.974) (-1213.639) (-1212.717) -- 0:00:25 597500 -- (-1209.896) (-1212.617) (-1217.983) [-1211.343] * (-1210.635) [-1212.314] (-1213.736) (-1211.520) -- 0:00:25 598000 -- [-1209.931] (-1211.945) (-1212.681) (-1211.801) * (-1217.696) (-1211.248) [-1214.253] (-1212.686) -- 0:00:25 598500 -- [-1209.941] (-1212.936) (-1213.400) (-1211.474) * (-1214.632) (-1213.677) [-1212.542] (-1210.629) -- 0:00:25 599000 -- (-1211.754) (-1213.202) [-1212.395] (-1211.698) * (-1213.715) (-1213.401) [-1211.425] (-1211.137) -- 0:00:25 599500 -- (-1215.617) (-1215.295) [-1211.309] (-1212.404) * (-1212.450) [-1211.740] (-1211.457) (-1215.128) -- 0:00:25 600000 -- [-1215.662] (-1217.575) (-1212.021) (-1212.541) * [-1210.019] (-1210.857) (-1212.650) (-1220.305) -- 0:00:25 Average standard deviation of split frequencies: 0.009516 600500 -- (-1215.349) (-1216.501) (-1210.763) [-1214.231] * (-1210.103) (-1211.359) [-1211.494] (-1214.356) -- 0:00:25 601000 -- (-1219.469) (-1211.130) (-1214.383) [-1213.214] * (-1212.271) [-1212.408] (-1210.328) (-1213.392) -- 0:00:25 601500 -- (-1215.224) [-1210.791] (-1210.624) (-1214.287) * (-1211.006) (-1213.616) (-1211.143) [-1214.066] -- 0:00:25 602000 -- (-1210.961) (-1212.972) [-1210.665] (-1217.473) * (-1212.876) (-1211.197) [-1212.713] (-1214.612) -- 0:00:25 602500 -- (-1213.884) [-1212.025] (-1210.527) (-1216.467) * (-1212.715) [-1214.550] (-1213.228) (-1212.523) -- 0:00:25 603000 -- (-1219.196) (-1220.675) (-1211.451) [-1210.889] * (-1210.733) (-1212.450) [-1212.081] (-1213.918) -- 0:00:25 603500 -- (-1214.257) (-1212.859) (-1212.055) [-1211.234] * (-1211.792) [-1212.821] (-1212.375) (-1213.533) -- 0:00:25 604000 -- [-1213.220] (-1213.945) (-1213.792) (-1214.289) * (-1214.225) (-1211.342) (-1211.336) [-1213.199] -- 0:00:25 604500 -- [-1213.053] (-1213.966) (-1210.266) (-1211.187) * [-1212.878] (-1213.209) (-1213.665) (-1210.763) -- 0:00:25 605000 -- (-1214.291) [-1215.016] (-1212.717) (-1213.740) * [-1211.608] (-1213.292) (-1212.362) (-1212.892) -- 0:00:25 Average standard deviation of split frequencies: 0.009335 605500 -- (-1213.612) (-1215.452) [-1210.340] (-1212.870) * (-1212.169) (-1213.728) [-1212.143] (-1212.782) -- 0:00:25 606000 -- [-1214.947] (-1216.822) (-1211.470) (-1213.791) * (-1214.924) (-1212.259) [-1211.978] (-1213.773) -- 0:00:25 606500 -- (-1211.538) (-1212.215) [-1210.145] (-1211.212) * (-1216.497) [-1211.245] (-1210.807) (-1212.956) -- 0:00:25 607000 -- [-1211.624] (-1210.963) (-1211.733) (-1212.276) * (-1210.878) [-1210.090] (-1210.000) (-1214.028) -- 0:00:25 607500 -- (-1213.992) (-1211.085) (-1213.741) [-1211.300] * (-1213.626) (-1212.981) [-1214.112] (-1211.660) -- 0:00:25 608000 -- (-1217.464) (-1210.931) [-1211.365] (-1212.884) * (-1212.922) [-1213.376] (-1212.850) (-1212.020) -- 0:00:25 608500 -- (-1210.358) [-1211.666] (-1211.885) (-1211.176) * [-1211.620] (-1211.435) (-1210.772) (-1211.412) -- 0:00:25 609000 -- (-1211.868) (-1211.633) [-1212.869] (-1214.611) * (-1211.987) [-1210.959] (-1216.578) (-1213.651) -- 0:00:25 609500 -- (-1212.760) (-1211.232) [-1213.795] (-1211.918) * [-1212.478] (-1214.510) (-1217.993) (-1211.253) -- 0:00:24 610000 -- (-1215.667) [-1211.686] (-1212.603) (-1212.235) * (-1212.660) [-1211.560] (-1213.763) (-1213.775) -- 0:00:24 Average standard deviation of split frequencies: 0.008829 610500 -- [-1212.599] (-1213.167) (-1214.453) (-1212.144) * [-1213.051] (-1211.900) (-1213.749) (-1214.146) -- 0:00:24 611000 -- (-1213.061) (-1213.586) [-1212.356] (-1213.516) * (-1214.754) (-1211.148) [-1214.064] (-1212.811) -- 0:00:24 611500 -- (-1210.685) [-1211.321] (-1211.309) (-1218.405) * (-1212.449) (-1212.213) [-1213.478] (-1213.619) -- 0:00:24 612000 -- [-1211.302] (-1211.893) (-1213.599) (-1215.010) * (-1212.275) (-1211.853) [-1211.749] (-1214.568) -- 0:00:24 612500 -- (-1210.105) [-1213.694] (-1212.200) (-1214.387) * (-1211.472) [-1211.916] (-1217.074) (-1210.988) -- 0:00:24 613000 -- [-1211.121] (-1211.731) (-1215.038) (-1213.195) * (-1211.492) (-1214.455) [-1213.737] (-1211.035) -- 0:00:24 613500 -- (-1211.791) (-1212.719) [-1212.269] (-1212.686) * [-1212.608] (-1215.501) (-1211.251) (-1214.265) -- 0:00:24 614000 -- (-1214.958) (-1215.679) [-1212.766] (-1215.616) * (-1214.232) [-1210.865] (-1213.631) (-1212.767) -- 0:00:24 614500 -- [-1211.308] (-1213.644) (-1210.642) (-1210.612) * (-1214.515) (-1211.182) (-1218.522) [-1210.606] -- 0:00:24 615000 -- (-1212.256) [-1212.501] (-1214.901) (-1210.467) * (-1212.767) (-1213.219) [-1210.267] (-1210.526) -- 0:00:24 Average standard deviation of split frequencies: 0.009231 615500 -- (-1213.653) (-1211.511) [-1215.032] (-1212.707) * (-1211.522) [-1211.642] (-1210.798) (-1210.001) -- 0:00:24 616000 -- [-1212.255] (-1210.944) (-1213.582) (-1211.521) * (-1214.317) (-1212.777) (-1213.069) [-1212.453] -- 0:00:24 616500 -- (-1213.843) [-1210.298] (-1215.758) (-1213.519) * (-1212.905) [-1214.343] (-1211.223) (-1212.195) -- 0:00:24 617000 -- (-1214.972) [-1210.607] (-1210.760) (-1211.065) * [-1210.977] (-1212.551) (-1211.334) (-1211.129) -- 0:00:24 617500 -- [-1211.809] (-1211.149) (-1216.058) (-1211.194) * (-1215.765) (-1210.820) [-1210.242] (-1211.159) -- 0:00:24 618000 -- (-1210.850) [-1210.577] (-1212.824) (-1211.868) * (-1210.225) [-1213.697] (-1210.974) (-1212.858) -- 0:00:24 618500 -- [-1211.959] (-1211.109) (-1212.963) (-1211.855) * [-1210.600] (-1211.272) (-1210.053) (-1212.082) -- 0:00:24 619000 -- (-1214.082) (-1211.576) (-1221.978) [-1212.855] * (-1210.934) (-1211.026) [-1212.263] (-1211.522) -- 0:00:24 619500 -- (-1214.238) (-1211.516) (-1216.180) [-1212.292] * (-1210.696) (-1211.613) (-1212.509) [-1211.275] -- 0:00:24 620000 -- (-1210.855) (-1211.731) (-1215.602) [-1210.494] * (-1210.946) [-1211.494] (-1210.698) (-1211.328) -- 0:00:24 Average standard deviation of split frequencies: 0.008829 620500 -- (-1210.970) [-1210.837] (-1210.182) (-1211.912) * (-1212.666) (-1212.005) [-1210.788] (-1211.311) -- 0:00:24 621000 -- (-1210.752) (-1210.831) [-1210.021] (-1213.155) * (-1212.730) (-1213.006) [-1211.747] (-1211.578) -- 0:00:24 621500 -- [-1211.714] (-1211.842) (-1211.538) (-1210.375) * (-1211.288) (-1214.531) (-1211.419) [-1214.758] -- 0:00:24 622000 -- (-1210.240) (-1214.375) (-1211.955) [-1212.148] * (-1210.088) [-1211.969] (-1213.452) (-1214.840) -- 0:00:24 622500 -- (-1210.578) [-1213.741] (-1214.231) (-1214.464) * (-1210.346) [-1211.792] (-1213.512) (-1216.644) -- 0:00:24 623000 -- [-1212.544] (-1211.502) (-1210.473) (-1213.112) * [-1210.389] (-1212.146) (-1213.915) (-1210.991) -- 0:00:24 623500 -- (-1212.622) (-1212.725) [-1210.752] (-1212.074) * (-1210.602) [-1211.697] (-1213.260) (-1211.379) -- 0:00:24 624000 -- [-1210.914] (-1211.785) (-1212.171) (-1213.306) * [-1210.339] (-1213.323) (-1211.762) (-1212.750) -- 0:00:24 624500 -- [-1211.533] (-1211.333) (-1213.920) (-1213.936) * [-1210.427] (-1212.668) (-1211.092) (-1210.679) -- 0:00:24 625000 -- (-1211.479) (-1212.267) (-1215.397) [-1213.308] * (-1213.019) (-1213.205) (-1211.133) [-1212.446] -- 0:00:24 Average standard deviation of split frequencies: 0.008707 625500 -- (-1213.347) (-1210.749) (-1217.070) [-1213.267] * (-1210.962) (-1211.590) (-1213.680) [-1214.588] -- 0:00:23 626000 -- (-1213.468) (-1211.309) (-1212.745) [-1211.114] * (-1214.158) (-1214.981) [-1212.669] (-1211.155) -- 0:00:23 626500 -- (-1214.663) [-1210.558] (-1212.603) (-1210.403) * (-1211.836) [-1210.987] (-1212.393) (-1213.931) -- 0:00:23 627000 -- (-1216.880) [-1210.587] (-1213.134) (-1217.034) * (-1212.990) (-1210.339) (-1212.604) [-1214.662] -- 0:00:23 627500 -- (-1219.491) (-1210.569) (-1214.267) [-1214.943] * [-1216.008] (-1211.566) (-1212.365) (-1211.522) -- 0:00:23 628000 -- (-1216.095) [-1215.265] (-1215.872) (-1213.356) * (-1214.194) (-1211.184) [-1212.718] (-1212.846) -- 0:00:23 628500 -- (-1211.066) (-1213.616) [-1212.953] (-1213.582) * (-1211.752) [-1213.014] (-1213.779) (-1211.486) -- 0:00:23 629000 -- [-1212.806] (-1215.178) (-1210.629) (-1210.335) * (-1212.673) [-1212.926] (-1216.367) (-1210.997) -- 0:00:23 629500 -- (-1214.584) [-1214.151] (-1211.589) (-1211.436) * (-1211.622) (-1215.752) (-1214.503) [-1212.531] -- 0:00:23 630000 -- [-1211.073] (-1210.930) (-1214.173) (-1213.613) * (-1211.175) [-1213.220] (-1214.048) (-1211.089) -- 0:00:23 Average standard deviation of split frequencies: 0.008876 630500 -- [-1211.898] (-1213.211) (-1214.774) (-1213.631) * [-1210.476] (-1212.364) (-1212.562) (-1211.740) -- 0:00:23 631000 -- [-1214.081] (-1211.565) (-1214.838) (-1212.631) * (-1214.681) (-1212.584) (-1214.115) [-1213.679] -- 0:00:23 631500 -- (-1214.883) (-1210.566) [-1214.588] (-1210.610) * (-1213.595) (-1212.979) (-1210.977) [-1210.798] -- 0:00:23 632000 -- [-1214.875] (-1211.932) (-1212.293) (-1211.316) * [-1215.020] (-1215.590) (-1212.246) (-1210.624) -- 0:00:23 632500 -- [-1211.214] (-1211.309) (-1212.696) (-1212.407) * (-1212.304) [-1212.084] (-1211.647) (-1212.071) -- 0:00:23 633000 -- (-1213.333) [-1210.607] (-1210.739) (-1212.333) * (-1215.889) [-1210.276] (-1211.021) (-1213.187) -- 0:00:23 633500 -- (-1213.928) (-1211.292) (-1213.192) [-1210.496] * (-1211.541) (-1217.603) (-1211.806) [-1210.566] -- 0:00:23 634000 -- (-1213.228) (-1210.537) [-1212.079] (-1213.588) * (-1211.734) [-1214.820] (-1214.891) (-1210.865) -- 0:00:23 634500 -- [-1213.261] (-1212.844) (-1212.008) (-1217.333) * (-1212.549) (-1214.406) (-1214.578) [-1210.738] -- 0:00:23 635000 -- (-1215.845) (-1212.155) (-1210.398) [-1219.287] * (-1211.325) [-1216.838] (-1212.589) (-1216.132) -- 0:00:23 Average standard deviation of split frequencies: 0.008616 635500 -- (-1215.177) [-1212.775] (-1215.828) (-1214.116) * (-1213.054) (-1216.312) [-1212.733] (-1211.424) -- 0:00:23 636000 -- (-1213.129) [-1210.214] (-1211.984) (-1210.877) * (-1212.109) (-1217.793) (-1213.415) [-1212.922] -- 0:00:23 636500 -- [-1211.072] (-1210.455) (-1212.380) (-1213.373) * (-1216.591) (-1210.200) (-1212.994) [-1211.961] -- 0:00:23 637000 -- [-1211.475] (-1210.549) (-1215.125) (-1211.875) * [-1213.896] (-1215.234) (-1212.475) (-1215.409) -- 0:00:23 637500 -- (-1214.637) (-1210.549) [-1211.821] (-1210.447) * (-1213.275) [-1210.000] (-1215.108) (-1213.749) -- 0:00:23 638000 -- (-1210.209) (-1215.101) (-1211.930) [-1211.200] * (-1210.664) (-1213.340) (-1214.324) [-1213.768] -- 0:00:23 638500 -- (-1212.261) (-1213.021) [-1212.862] (-1210.836) * [-1210.834] (-1212.144) (-1212.987) (-1217.874) -- 0:00:23 639000 -- (-1212.567) (-1211.746) [-1211.350] (-1212.390) * (-1213.449) [-1211.748] (-1217.191) (-1218.033) -- 0:00:23 639500 -- (-1214.596) [-1211.803] (-1213.604) (-1212.313) * [-1211.125] (-1210.629) (-1215.234) (-1217.445) -- 0:00:23 640000 -- [-1212.831] (-1211.710) (-1213.969) (-1212.989) * (-1210.657) (-1210.048) (-1211.415) [-1211.271] -- 0:00:23 Average standard deviation of split frequencies: 0.008324 640500 -- (-1211.007) [-1212.111] (-1214.166) (-1213.454) * (-1212.651) (-1210.152) [-1211.805] (-1211.805) -- 0:00:23 641000 -- (-1211.482) [-1212.277] (-1212.829) (-1212.276) * (-1210.942) (-1212.034) [-1211.430] (-1211.204) -- 0:00:22 641500 -- (-1210.735) (-1216.783) [-1211.191] (-1211.473) * (-1211.736) [-1211.693] (-1212.772) (-1210.357) -- 0:00:22 642000 -- [-1213.729] (-1211.334) (-1211.119) (-1213.277) * (-1212.107) [-1212.223] (-1210.016) (-1210.201) -- 0:00:22 642500 -- (-1212.138) [-1210.475] (-1213.003) (-1211.718) * (-1211.005) (-1214.479) [-1210.592] (-1213.104) -- 0:00:22 643000 -- (-1212.117) [-1212.649] (-1213.831) (-1212.947) * (-1211.365) (-1212.201) [-1211.117] (-1214.257) -- 0:00:22 643500 -- [-1212.054] (-1214.018) (-1210.941) (-1212.986) * (-1211.007) (-1214.006) [-1213.386] (-1214.575) -- 0:00:22 644000 -- (-1210.209) [-1212.471] (-1210.378) (-1211.153) * (-1212.030) [-1215.565] (-1212.178) (-1211.601) -- 0:00:22 644500 -- (-1211.381) (-1212.246) [-1210.435] (-1212.723) * (-1210.699) (-1215.790) [-1210.883] (-1212.107) -- 0:00:22 645000 -- (-1213.283) (-1215.056) [-1211.254] (-1211.088) * [-1212.235] (-1211.539) (-1218.582) (-1211.287) -- 0:00:22 Average standard deviation of split frequencies: 0.008346 645500 -- [-1211.642] (-1210.960) (-1210.086) (-1211.141) * (-1213.049) (-1214.491) (-1212.140) [-1211.287] -- 0:00:22 646000 -- (-1210.001) (-1215.073) [-1212.865] (-1211.696) * (-1210.608) (-1216.787) (-1212.173) [-1211.271] -- 0:00:22 646500 -- (-1217.005) (-1213.342) (-1211.902) [-1211.370] * (-1213.952) (-1219.490) (-1214.467) [-1212.322] -- 0:00:22 647000 -- (-1211.037) (-1210.968) (-1213.933) [-1210.635] * [-1211.366] (-1214.036) (-1211.216) (-1211.275) -- 0:00:22 647500 -- (-1217.304) [-1212.732] (-1214.995) (-1210.613) * [-1212.063] (-1211.259) (-1215.487) (-1211.090) -- 0:00:22 648000 -- (-1213.607) (-1211.270) [-1214.643] (-1209.860) * (-1212.013) [-1211.321] (-1210.552) (-1212.221) -- 0:00:22 648500 -- [-1211.119] (-1210.532) (-1212.022) (-1209.894) * (-1211.867) (-1211.573) [-1210.724] (-1214.250) -- 0:00:22 649000 -- (-1210.259) (-1211.041) (-1212.993) [-1219.575] * (-1219.526) (-1213.767) [-1212.711] (-1212.781) -- 0:00:22 649500 -- [-1211.853] (-1212.276) (-1215.248) (-1220.077) * (-1210.316) (-1211.614) [-1211.673] (-1211.861) -- 0:00:22 650000 -- [-1210.139] (-1215.520) (-1213.099) (-1219.089) * (-1210.148) (-1211.655) [-1213.376] (-1211.195) -- 0:00:22 Average standard deviation of split frequencies: 0.008151 650500 -- (-1215.005) [-1211.440] (-1211.279) (-1212.485) * (-1210.401) [-1212.614] (-1213.247) (-1214.744) -- 0:00:22 651000 -- (-1212.402) [-1212.516] (-1213.393) (-1211.423) * [-1212.346] (-1211.348) (-1215.785) (-1216.210) -- 0:00:22 651500 -- (-1212.468) (-1210.553) [-1210.992] (-1211.213) * (-1211.929) [-1212.916] (-1212.983) (-1213.778) -- 0:00:22 652000 -- (-1217.962) (-1211.636) (-1215.959) [-1211.597] * (-1213.572) (-1212.660) [-1210.349] (-1211.903) -- 0:00:22 652500 -- (-1215.557) (-1215.065) (-1213.160) [-1212.044] * (-1209.848) [-1211.139] (-1211.346) (-1213.648) -- 0:00:22 653000 -- (-1214.752) (-1213.672) (-1211.745) [-1214.500] * (-1210.920) [-1210.310] (-1210.812) (-1213.358) -- 0:00:22 653500 -- (-1213.401) (-1211.564) [-1210.508] (-1215.993) * (-1213.343) (-1210.438) [-1211.571] (-1216.747) -- 0:00:22 654000 -- (-1212.614) (-1211.300) [-1211.670] (-1215.844) * [-1212.754] (-1211.254) (-1211.767) (-1214.298) -- 0:00:22 654500 -- (-1212.438) (-1211.231) [-1216.426] (-1210.997) * (-1215.064) (-1210.827) (-1213.157) [-1213.179] -- 0:00:22 655000 -- (-1213.123) [-1212.748] (-1210.676) (-1211.181) * (-1214.036) (-1212.678) (-1212.864) [-1213.663] -- 0:00:22 Average standard deviation of split frequencies: 0.007860 655500 -- (-1211.620) (-1211.166) [-1210.843] (-1211.379) * (-1213.848) (-1214.806) [-1211.602] (-1211.935) -- 0:00:22 656000 -- (-1214.743) [-1210.815] (-1211.490) (-1211.671) * [-1213.626] (-1212.019) (-1212.456) (-1215.350) -- 0:00:22 656500 -- (-1214.546) [-1212.185] (-1211.281) (-1212.167) * (-1214.281) (-1213.350) (-1212.180) [-1213.156] -- 0:00:21 657000 -- (-1212.753) [-1211.160] (-1215.812) (-1217.064) * [-1214.474] (-1211.010) (-1213.050) (-1215.129) -- 0:00:21 657500 -- (-1213.524) (-1213.269) [-1213.159] (-1213.284) * (-1212.032) [-1210.346] (-1213.745) (-1214.420) -- 0:00:21 658000 -- (-1211.986) (-1212.172) [-1211.958] (-1210.373) * (-1217.050) (-1210.383) [-1216.374] (-1213.664) -- 0:00:21 658500 -- (-1211.749) (-1210.647) [-1211.001] (-1211.050) * (-1213.098) (-1211.196) [-1217.807] (-1211.649) -- 0:00:21 659000 -- (-1213.172) [-1210.227] (-1212.744) (-1210.935) * [-1211.860] (-1213.668) (-1213.199) (-1214.195) -- 0:00:21 659500 -- [-1212.830] (-1210.539) (-1211.955) (-1210.923) * (-1211.792) (-1213.440) [-1210.543] (-1220.076) -- 0:00:21 660000 -- (-1210.262) [-1210.375] (-1212.544) (-1213.007) * (-1213.066) [-1213.851] (-1211.512) (-1213.123) -- 0:00:21 Average standard deviation of split frequencies: 0.007715 660500 -- (-1210.239) (-1213.228) (-1212.501) [-1210.542] * (-1210.796) (-1220.255) (-1211.788) [-1213.029] -- 0:00:21 661000 -- (-1212.505) [-1214.005] (-1211.594) (-1211.171) * [-1211.162] (-1215.508) (-1211.395) (-1213.727) -- 0:00:21 661500 -- [-1211.535] (-1214.096) (-1212.612) (-1213.559) * (-1213.077) (-1212.105) (-1214.494) [-1213.439] -- 0:00:21 662000 -- [-1211.230] (-1211.671) (-1214.441) (-1211.866) * [-1214.909] (-1212.916) (-1211.568) (-1211.850) -- 0:00:21 662500 -- (-1211.055) [-1211.699] (-1211.717) (-1211.585) * (-1211.067) (-1212.452) (-1211.379) [-1211.473] -- 0:00:21 663000 -- [-1211.517] (-1212.158) (-1212.559) (-1211.626) * (-1210.946) (-1212.244) (-1211.000) [-1213.381] -- 0:00:21 663500 -- (-1212.066) [-1216.315] (-1212.540) (-1214.334) * (-1210.966) (-1215.866) [-1210.057] (-1212.714) -- 0:00:21 664000 -- (-1212.938) (-1212.179) (-1214.740) [-1212.364] * (-1212.446) [-1211.491] (-1217.419) (-1211.991) -- 0:00:21 664500 -- [-1214.376] (-1212.286) (-1210.609) (-1210.690) * (-1211.258) [-1211.433] (-1214.467) (-1211.926) -- 0:00:21 665000 -- (-1212.011) (-1211.713) [-1214.047] (-1212.828) * (-1211.331) [-1211.996] (-1214.580) (-1211.651) -- 0:00:21 Average standard deviation of split frequencies: 0.008317 665500 -- [-1211.931] (-1212.826) (-1213.648) (-1211.227) * (-1212.804) (-1212.680) (-1212.423) [-1214.152] -- 0:00:21 666000 -- [-1214.782] (-1211.940) (-1214.457) (-1221.065) * (-1211.831) [-1215.065] (-1213.723) (-1215.655) -- 0:00:21 666500 -- (-1212.567) [-1210.463] (-1213.911) (-1215.987) * [-1211.189] (-1216.415) (-1212.591) (-1215.163) -- 0:00:21 667000 -- (-1212.589) [-1213.172] (-1213.602) (-1216.351) * (-1212.082) [-1212.843] (-1211.923) (-1215.776) -- 0:00:21 667500 -- [-1213.439] (-1213.998) (-1213.888) (-1211.759) * (-1211.505) (-1211.655) (-1210.452) [-1212.409] -- 0:00:21 668000 -- (-1212.253) [-1211.426] (-1211.386) (-1212.108) * [-1214.017] (-1211.270) (-1211.015) (-1211.637) -- 0:00:21 668500 -- (-1213.318) (-1210.722) [-1211.855] (-1211.582) * (-1214.324) [-1211.116] (-1211.189) (-1210.529) -- 0:00:21 669000 -- (-1213.601) [-1211.468] (-1212.272) (-1211.580) * (-1213.554) (-1211.606) (-1212.258) [-1212.252] -- 0:00:21 669500 -- (-1211.328) [-1211.754] (-1211.901) (-1215.045) * [-1211.055] (-1210.240) (-1215.028) (-1210.429) -- 0:00:21 670000 -- (-1212.158) [-1211.585] (-1214.653) (-1214.553) * (-1214.529) [-1211.852] (-1210.971) (-1213.134) -- 0:00:21 Average standard deviation of split frequencies: 0.008391 670500 -- (-1212.923) [-1211.824] (-1213.988) (-1211.630) * (-1210.890) [-1210.886] (-1213.721) (-1212.365) -- 0:00:21 671000 -- (-1211.338) (-1212.530) (-1212.302) [-1210.463] * (-1213.613) [-1212.228] (-1215.631) (-1215.040) -- 0:00:21 671500 -- (-1211.770) (-1215.516) (-1213.959) [-1210.585] * [-1213.688] (-1213.302) (-1215.051) (-1215.671) -- 0:00:21 672000 -- (-1212.286) (-1217.040) (-1214.365) [-1210.951] * (-1217.546) [-1215.427] (-1213.195) (-1213.503) -- 0:00:20 672500 -- [-1212.935] (-1216.640) (-1212.413) (-1210.229) * [-1210.343] (-1216.771) (-1212.921) (-1215.955) -- 0:00:20 673000 -- (-1211.614) (-1210.950) [-1213.947] (-1212.537) * [-1214.317] (-1211.901) (-1214.442) (-1212.576) -- 0:00:20 673500 -- (-1211.674) (-1213.099) [-1215.348] (-1215.167) * (-1212.800) [-1210.751] (-1212.179) (-1212.592) -- 0:00:20 674000 -- (-1216.636) (-1211.323) (-1212.062) [-1214.095] * (-1210.156) [-1212.686] (-1212.871) (-1210.953) -- 0:00:20 674500 -- [-1210.112] (-1210.806) (-1211.478) (-1212.693) * (-1211.638) (-1214.571) [-1212.201] (-1211.456) -- 0:00:20 675000 -- (-1211.363) (-1211.482) [-1213.685] (-1213.226) * (-1211.548) (-1214.700) [-1211.855] (-1216.123) -- 0:00:20 Average standard deviation of split frequencies: 0.008019 675500 -- (-1214.695) (-1212.433) (-1211.372) [-1214.443] * [-1214.471] (-1213.777) (-1210.409) (-1211.512) -- 0:00:20 676000 -- [-1212.098] (-1215.083) (-1215.730) (-1213.251) * (-1215.163) (-1210.418) [-1210.781] (-1216.623) -- 0:00:20 676500 -- (-1212.601) (-1212.181) (-1210.691) [-1212.963] * (-1212.029) (-1210.940) [-1212.653] (-1212.317) -- 0:00:20 677000 -- (-1212.330) [-1213.366] (-1211.066) (-1210.788) * [-1211.910] (-1213.941) (-1211.643) (-1213.009) -- 0:00:20 677500 -- [-1214.765] (-1214.541) (-1212.945) (-1211.788) * (-1210.100) [-1214.545] (-1211.296) (-1215.411) -- 0:00:20 678000 -- (-1212.738) (-1213.713) [-1211.363] (-1211.711) * (-1218.886) [-1212.884] (-1210.792) (-1215.741) -- 0:00:20 678500 -- (-1214.977) (-1212.791) [-1217.433] (-1212.926) * (-1213.376) [-1210.211] (-1210.775) (-1215.266) -- 0:00:20 679000 -- [-1215.037] (-1211.086) (-1212.642) (-1213.128) * (-1212.990) (-1210.700) (-1210.764) [-1212.948] -- 0:00:20 679500 -- (-1214.147) [-1210.979] (-1214.225) (-1211.657) * [-1211.477] (-1210.702) (-1216.130) (-1213.155) -- 0:00:20 680000 -- (-1211.255) (-1211.007) (-1212.225) [-1212.850] * [-1211.653] (-1215.828) (-1212.644) (-1213.441) -- 0:00:20 Average standard deviation of split frequencies: 0.007791 680500 -- (-1214.059) (-1213.409) (-1211.878) [-1214.153] * (-1212.095) (-1215.744) (-1210.991) [-1213.735] -- 0:00:20 681000 -- (-1212.637) (-1212.278) [-1210.825] (-1213.832) * (-1213.567) (-1216.028) (-1213.237) [-1213.757] -- 0:00:20 681500 -- (-1215.529) [-1211.709] (-1212.834) (-1213.835) * [-1211.594] (-1212.011) (-1210.422) (-1213.129) -- 0:00:20 682000 -- (-1213.318) [-1211.540] (-1211.992) (-1219.954) * (-1213.614) (-1211.198) [-1211.654] (-1210.493) -- 0:00:20 682500 -- (-1212.456) [-1212.612] (-1214.234) (-1210.588) * (-1213.816) (-1212.251) [-1213.228] (-1210.471) -- 0:00:20 683000 -- (-1214.871) (-1209.969) (-1213.597) [-1211.208] * [-1212.354] (-1212.024) (-1213.365) (-1210.642) -- 0:00:20 683500 -- (-1213.493) (-1210.074) [-1210.046] (-1214.935) * (-1210.745) (-1213.294) (-1212.424) [-1213.393] -- 0:00:20 684000 -- [-1213.450] (-1210.658) (-1212.337) (-1219.240) * [-1210.105] (-1214.442) (-1215.433) (-1213.124) -- 0:00:20 684500 -- (-1211.389) [-1212.188] (-1214.469) (-1215.322) * (-1211.357) (-1210.776) [-1211.528] (-1210.088) -- 0:00:20 685000 -- [-1211.241] (-1213.564) (-1209.970) (-1213.123) * (-1211.601) (-1212.132) [-1212.239] (-1213.028) -- 0:00:20 Average standard deviation of split frequencies: 0.008461 685500 -- (-1212.460) (-1214.833) (-1213.757) [-1210.488] * (-1213.108) (-1210.146) [-1215.428] (-1214.216) -- 0:00:20 686000 -- (-1212.542) [-1212.160] (-1212.810) (-1213.587) * (-1211.385) (-1209.978) [-1212.729] (-1211.955) -- 0:00:20 686500 -- (-1210.855) (-1212.386) (-1212.240) [-1214.924] * (-1211.708) (-1211.176) (-1214.540) [-1212.486] -- 0:00:20 687000 -- (-1212.510) (-1215.858) [-1214.889] (-1214.902) * (-1210.983) (-1210.438) (-1212.163) [-1211.595] -- 0:00:20 687500 -- (-1214.943) (-1220.458) (-1215.810) [-1212.203] * (-1211.243) [-1210.470] (-1211.609) (-1212.555) -- 0:00:20 688000 -- (-1215.220) (-1216.766) (-1212.803) [-1210.771] * (-1212.901) (-1212.780) (-1211.480) [-1210.560] -- 0:00:19 688500 -- (-1212.435) (-1211.230) (-1213.701) [-1216.536] * [-1212.104] (-1211.106) (-1210.719) (-1215.700) -- 0:00:19 689000 -- (-1214.639) [-1212.116] (-1216.417) (-1211.118) * (-1211.357) [-1211.212] (-1212.193) (-1212.376) -- 0:00:19 689500 -- [-1212.712] (-1210.717) (-1216.845) (-1210.793) * [-1212.396] (-1213.572) (-1212.652) (-1211.315) -- 0:00:19 690000 -- [-1211.643] (-1213.521) (-1211.243) (-1216.123) * (-1210.595) (-1211.978) (-1212.621) [-1215.720] -- 0:00:19 Average standard deviation of split frequencies: 0.009373 690500 -- [-1212.841] (-1214.550) (-1210.584) (-1210.894) * [-1212.266] (-1210.877) (-1212.266) (-1212.743) -- 0:00:19 691000 -- (-1213.995) [-1215.520] (-1213.844) (-1210.924) * (-1212.825) (-1211.866) [-1213.617] (-1212.444) -- 0:00:19 691500 -- (-1214.433) [-1210.533] (-1212.580) (-1216.839) * (-1212.106) [-1211.448] (-1213.409) (-1212.925) -- 0:00:19 692000 -- [-1211.521] (-1210.355) (-1211.366) (-1213.333) * (-1214.537) (-1210.122) [-1213.673] (-1210.108) -- 0:00:19 692500 -- (-1211.902) [-1211.953] (-1211.535) (-1221.990) * (-1213.582) (-1211.871) [-1211.420] (-1214.874) -- 0:00:19 693000 -- (-1212.235) [-1211.584] (-1210.136) (-1212.612) * (-1212.035) (-1210.178) [-1211.621] (-1212.419) -- 0:00:19 693500 -- [-1212.232] (-1211.181) (-1210.773) (-1218.762) * (-1213.430) (-1212.593) (-1213.426) [-1212.047] -- 0:00:19 694000 -- (-1210.892) (-1212.700) (-1211.854) [-1215.755] * [-1212.734] (-1213.086) (-1213.692) (-1211.031) -- 0:00:19 694500 -- (-1213.811) (-1211.151) [-1213.207] (-1214.675) * [-1213.347] (-1210.291) (-1213.210) (-1210.569) -- 0:00:19 695000 -- (-1216.120) (-1212.319) (-1213.192) [-1210.161] * (-1215.240) (-1210.205) (-1212.111) [-1210.493] -- 0:00:19 Average standard deviation of split frequencies: 0.009618 695500 -- (-1212.970) (-1212.428) (-1210.364) [-1211.350] * (-1212.601) (-1210.668) (-1211.435) [-1211.551] -- 0:00:19 696000 -- (-1212.258) (-1212.637) (-1210.541) [-1212.206] * (-1218.075) (-1210.357) (-1211.200) [-1211.693] -- 0:00:19 696500 -- (-1211.586) [-1213.912] (-1210.734) (-1211.252) * (-1210.482) [-1210.991] (-1213.120) (-1211.221) -- 0:00:19 697000 -- (-1212.080) (-1215.105) [-1210.477] (-1211.116) * (-1212.353) (-1210.471) [-1211.187] (-1212.738) -- 0:00:19 697500 -- (-1212.537) [-1213.104] (-1211.302) (-1214.730) * (-1212.842) (-1211.609) [-1211.107] (-1210.431) -- 0:00:19 698000 -- (-1211.993) (-1213.103) (-1216.455) [-1211.428] * (-1210.251) [-1212.720] (-1210.736) (-1211.084) -- 0:00:19 698500 -- [-1212.421] (-1210.512) (-1218.839) (-1212.302) * (-1212.769) [-1211.850] (-1212.494) (-1211.806) -- 0:00:19 699000 -- (-1217.765) [-1211.535] (-1212.242) (-1213.085) * [-1212.302] (-1211.350) (-1212.908) (-1212.638) -- 0:00:19 699500 -- (-1211.270) [-1211.438] (-1210.823) (-1212.536) * (-1213.065) (-1211.104) [-1214.289] (-1213.801) -- 0:00:19 700000 -- (-1217.260) (-1212.823) [-1213.660] (-1215.162) * (-1212.989) (-1213.984) (-1214.919) [-1213.122] -- 0:00:19 Average standard deviation of split frequencies: 0.009015 700500 -- (-1212.049) (-1210.793) [-1211.349] (-1211.079) * [-1211.220] (-1212.000) (-1213.163) (-1213.873) -- 0:00:19 701000 -- (-1217.703) [-1212.192] (-1215.541) (-1210.948) * [-1210.941] (-1212.295) (-1216.499) (-1211.521) -- 0:00:19 701500 -- [-1213.850] (-1210.410) (-1211.829) (-1212.456) * (-1211.321) (-1213.165) (-1212.162) [-1211.689] -- 0:00:19 702000 -- [-1214.387] (-1211.568) (-1211.984) (-1211.875) * (-1214.093) (-1214.359) (-1212.328) [-1211.289] -- 0:00:19 702500 -- (-1216.021) (-1212.531) [-1211.508] (-1213.565) * (-1216.271) (-1210.155) (-1217.368) [-1214.096] -- 0:00:19 703000 -- (-1215.298) (-1211.051) (-1212.707) [-1213.241] * (-1221.166) (-1214.997) [-1211.181] (-1213.038) -- 0:00:19 703500 -- (-1213.935) [-1212.625] (-1212.437) (-1211.218) * (-1211.583) (-1212.881) (-1211.617) [-1211.890] -- 0:00:18 704000 -- (-1211.152) [-1212.628] (-1214.455) (-1213.389) * (-1217.089) (-1214.242) (-1214.972) [-1210.154] -- 0:00:18 704500 -- [-1211.017] (-1212.419) (-1213.542) (-1214.208) * (-1213.678) (-1212.003) (-1212.938) [-1211.330] -- 0:00:18 705000 -- (-1211.384) (-1211.994) [-1212.396] (-1213.530) * (-1212.219) (-1212.799) (-1213.759) [-1213.609] -- 0:00:18 Average standard deviation of split frequencies: 0.008947 705500 -- [-1212.172] (-1211.009) (-1210.847) (-1219.517) * (-1211.154) (-1212.747) (-1212.694) [-1211.248] -- 0:00:18 706000 -- (-1211.974) [-1212.160] (-1210.949) (-1214.296) * (-1209.995) [-1211.344] (-1212.909) (-1210.985) -- 0:00:18 706500 -- [-1214.266] (-1211.905) (-1211.310) (-1213.639) * (-1211.797) (-1211.514) [-1211.025] (-1213.814) -- 0:00:18 707000 -- (-1214.694) (-1212.171) (-1215.239) [-1213.510] * (-1212.530) [-1211.053] (-1211.454) (-1211.946) -- 0:00:18 707500 -- (-1214.159) (-1215.095) (-1218.491) [-1214.720] * [-1210.218] (-1212.551) (-1210.349) (-1214.305) -- 0:00:18 708000 -- (-1213.731) (-1214.419) [-1211.256] (-1211.931) * (-1210.513) (-1211.274) [-1211.829] (-1210.628) -- 0:00:18 708500 -- (-1210.971) (-1210.802) [-1210.845] (-1212.996) * [-1211.425] (-1213.122) (-1211.321) (-1211.249) -- 0:00:18 709000 -- (-1214.184) (-1211.043) [-1210.712] (-1213.662) * [-1211.216] (-1215.267) (-1211.743) (-1210.473) -- 0:00:18 709500 -- [-1210.863] (-1210.647) (-1211.322) (-1212.808) * (-1216.051) [-1212.175] (-1212.414) (-1212.677) -- 0:00:18 710000 -- (-1212.785) [-1211.134] (-1210.782) (-1211.920) * (-1211.534) [-1212.237] (-1211.989) (-1212.449) -- 0:00:18 Average standard deviation of split frequencies: 0.009242 710500 -- (-1213.795) (-1211.815) (-1212.235) [-1212.439] * (-1213.956) (-1217.564) [-1211.568] (-1212.072) -- 0:00:18 711000 -- [-1212.344] (-1212.351) (-1212.058) (-1214.416) * [-1213.516] (-1211.981) (-1212.855) (-1212.127) -- 0:00:18 711500 -- (-1210.568) [-1213.309] (-1211.020) (-1211.947) * (-1214.813) [-1211.401] (-1210.943) (-1215.235) -- 0:00:18 712000 -- (-1215.324) [-1211.132] (-1212.016) (-1213.114) * (-1218.871) (-1214.813) [-1210.681] (-1211.778) -- 0:00:18 712500 -- (-1213.732) (-1210.909) [-1211.640] (-1216.510) * (-1213.907) [-1211.424] (-1210.786) (-1211.338) -- 0:00:18 713000 -- (-1210.938) (-1214.059) [-1211.551] (-1213.302) * (-1212.936) (-1212.978) (-1210.509) [-1214.054] -- 0:00:18 713500 -- [-1211.871] (-1210.499) (-1211.940) (-1212.724) * (-1212.662) (-1214.422) [-1212.873] (-1210.306) -- 0:00:18 714000 -- (-1214.303) (-1213.458) [-1210.998] (-1210.808) * (-1210.593) [-1213.300] (-1211.842) (-1212.222) -- 0:00:18 714500 -- (-1216.068) (-1211.492) (-1212.222) [-1215.613] * (-1210.588) (-1219.286) [-1211.866] (-1212.951) -- 0:00:18 715000 -- (-1210.758) (-1214.108) (-1211.628) [-1212.626] * (-1212.769) [-1219.647] (-1212.137) (-1211.704) -- 0:00:18 Average standard deviation of split frequencies: 0.009393 715500 -- [-1214.581] (-1213.364) (-1211.413) (-1211.630) * [-1211.868] (-1214.365) (-1214.670) (-1210.842) -- 0:00:18 716000 -- (-1213.129) (-1211.780) (-1211.318) [-1210.236] * [-1211.619] (-1216.803) (-1216.379) (-1215.378) -- 0:00:18 716500 -- (-1211.127) (-1211.406) (-1212.648) [-1210.689] * (-1210.395) (-1217.956) [-1212.644] (-1210.478) -- 0:00:18 717000 -- (-1215.009) (-1211.374) [-1211.218] (-1211.639) * (-1212.246) (-1216.926) [-1210.595] (-1215.647) -- 0:00:18 717500 -- [-1211.088] (-1211.867) (-1211.124) (-1210.211) * (-1214.457) [-1212.251] (-1212.529) (-1211.405) -- 0:00:18 718000 -- (-1211.088) (-1210.636) (-1211.522) [-1213.390] * (-1213.924) (-1210.578) (-1211.364) [-1211.229] -- 0:00:18 718500 -- (-1213.764) (-1212.633) [-1212.224] (-1211.346) * [-1211.853] (-1210.722) (-1210.651) (-1212.000) -- 0:00:18 719000 -- (-1212.386) (-1210.688) (-1211.909) [-1211.696] * [-1211.505] (-1213.546) (-1214.697) (-1210.654) -- 0:00:17 719500 -- (-1210.694) (-1211.717) [-1211.112] (-1211.207) * (-1210.779) (-1213.763) (-1214.722) [-1215.802] -- 0:00:17 720000 -- (-1212.604) [-1211.940] (-1211.890) (-1215.165) * (-1211.992) (-1211.411) [-1212.285] (-1212.648) -- 0:00:17 Average standard deviation of split frequencies: 0.009594 720500 -- (-1210.498) (-1210.874) (-1214.255) [-1212.197] * (-1213.092) (-1210.371) [-1210.784] (-1210.943) -- 0:00:17 721000 -- (-1217.639) [-1212.623] (-1212.404) (-1216.581) * (-1213.604) (-1214.245) [-1210.938] (-1213.170) -- 0:00:17 721500 -- (-1212.715) [-1215.005] (-1211.104) (-1215.704) * [-1211.582] (-1215.103) (-1212.952) (-1214.554) -- 0:00:17 722000 -- [-1213.081] (-1213.495) (-1214.045) (-1214.711) * (-1211.432) (-1214.776) [-1210.680] (-1211.994) -- 0:00:17 722500 -- (-1212.901) (-1213.749) (-1212.430) [-1212.626] * [-1210.470] (-1213.699) (-1210.859) (-1212.052) -- 0:00:17 723000 -- (-1210.524) [-1214.568] (-1211.860) (-1210.690) * (-1210.741) [-1211.014] (-1210.131) (-1214.880) -- 0:00:17 723500 -- [-1214.716] (-1214.701) (-1212.017) (-1211.905) * (-1210.631) (-1216.187) (-1216.259) [-1213.827] -- 0:00:17 724000 -- (-1220.208) (-1215.044) (-1212.606) [-1214.840] * (-1212.156) (-1214.675) [-1210.660] (-1212.369) -- 0:00:17 724500 -- (-1216.412) (-1213.545) [-1211.443] (-1212.174) * (-1211.568) (-1213.570) (-1213.398) [-1212.284] -- 0:00:17 725000 -- (-1211.507) [-1213.552] (-1210.169) (-1212.632) * (-1214.316) [-1213.565] (-1214.006) (-1210.183) -- 0:00:17 Average standard deviation of split frequencies: 0.009350 725500 -- (-1210.714) (-1210.948) [-1212.439] (-1210.172) * (-1214.599) [-1212.003] (-1210.863) (-1210.775) -- 0:00:17 726000 -- (-1212.015) [-1210.679] (-1211.674) (-1212.704) * (-1214.181) (-1212.283) [-1210.365] (-1211.160) -- 0:00:17 726500 -- (-1212.349) (-1210.857) (-1210.473) [-1211.256] * (-1211.713) (-1210.690) [-1211.842] (-1211.055) -- 0:00:17 727000 -- [-1213.238] (-1211.642) (-1210.972) (-1211.401) * [-1211.821] (-1210.574) (-1215.127) (-1210.278) -- 0:00:17 727500 -- (-1214.354) [-1210.485] (-1211.067) (-1213.089) * (-1212.082) (-1211.402) (-1215.062) [-1210.385] -- 0:00:17 728000 -- [-1211.448] (-1211.774) (-1211.266) (-1210.776) * (-1211.624) (-1210.812) [-1210.123] (-1211.492) -- 0:00:17 728500 -- [-1212.578] (-1213.331) (-1213.942) (-1214.097) * (-1211.329) (-1211.314) (-1212.175) [-1212.377] -- 0:00:17 729000 -- [-1213.034] (-1210.682) (-1212.471) (-1210.355) * (-1210.883) (-1212.370) (-1218.024) [-1214.897] -- 0:00:17 729500 -- (-1212.854) (-1212.537) (-1212.249) [-1210.355] * (-1211.251) (-1210.734) [-1211.933] (-1211.850) -- 0:00:17 730000 -- (-1213.552) [-1214.178] (-1212.089) (-1216.299) * (-1209.784) (-1210.917) (-1216.088) [-1212.266] -- 0:00:17 Average standard deviation of split frequencies: 0.009075 730500 -- (-1212.557) (-1214.213) (-1218.050) [-1212.677] * [-1210.248] (-1212.791) (-1212.730) (-1212.159) -- 0:00:17 731000 -- (-1211.385) [-1211.881] (-1221.083) (-1216.220) * [-1211.268] (-1213.758) (-1211.661) (-1211.687) -- 0:00:17 731500 -- (-1212.813) (-1212.115) (-1222.560) [-1212.779] * (-1211.647) (-1213.003) (-1212.629) [-1210.795] -- 0:00:17 732000 -- (-1211.945) (-1210.525) [-1211.142] (-1211.386) * [-1214.148] (-1214.186) (-1213.490) (-1212.424) -- 0:00:17 732500 -- (-1210.968) (-1213.657) (-1211.244) [-1210.907] * (-1210.431) [-1212.190] (-1212.861) (-1213.577) -- 0:00:17 733000 -- [-1212.547] (-1212.828) (-1211.492) (-1210.958) * (-1210.684) (-1213.797) (-1214.000) [-1212.973] -- 0:00:17 733500 -- (-1212.664) (-1214.922) [-1211.340] (-1210.538) * (-1214.213) [-1211.147] (-1215.751) (-1214.536) -- 0:00:17 734000 -- [-1210.180] (-1213.524) (-1213.696) (-1213.083) * (-1212.731) [-1211.187] (-1212.417) (-1211.864) -- 0:00:17 734500 -- (-1211.005) (-1212.519) [-1210.486] (-1212.632) * [-1213.695] (-1212.370) (-1211.376) (-1211.483) -- 0:00:16 735000 -- (-1213.469) [-1211.655] (-1213.108) (-1211.421) * (-1212.802) [-1212.452] (-1213.447) (-1210.642) -- 0:00:16 Average standard deviation of split frequencies: 0.008711 735500 -- [-1210.893] (-1213.486) (-1212.615) (-1210.997) * (-1211.439) (-1212.018) [-1215.238] (-1211.468) -- 0:00:16 736000 -- (-1210.510) (-1210.655) (-1212.739) [-1212.865] * (-1215.651) (-1211.242) [-1210.179] (-1212.716) -- 0:00:16 736500 -- (-1211.127) (-1211.732) [-1211.464] (-1215.741) * (-1210.443) (-1211.959) (-1211.283) [-1212.807] -- 0:00:16 737000 -- [-1212.110] (-1214.493) (-1213.236) (-1213.256) * [-1211.025] (-1211.469) (-1211.812) (-1211.813) -- 0:00:16 737500 -- [-1211.988] (-1213.335) (-1213.005) (-1215.292) * (-1210.611) [-1212.488] (-1211.717) (-1213.590) -- 0:00:16 738000 -- (-1212.121) (-1211.355) (-1213.548) [-1212.469] * (-1210.706) (-1210.414) (-1210.619) [-1212.177] -- 0:00:16 738500 -- [-1210.848] (-1211.254) (-1213.299) (-1211.761) * (-1212.858) (-1211.290) [-1210.382] (-1210.586) -- 0:00:16 739000 -- (-1210.613) [-1211.653] (-1213.502) (-1212.811) * (-1214.915) (-1212.514) (-1212.498) [-1209.937] -- 0:00:16 739500 -- (-1211.156) (-1213.834) [-1212.265] (-1213.917) * (-1212.347) [-1211.159] (-1210.180) (-1211.592) -- 0:00:16 740000 -- (-1210.719) (-1213.954) [-1211.170] (-1212.217) * (-1212.216) (-1212.496) [-1210.543] (-1213.058) -- 0:00:16 Average standard deviation of split frequencies: 0.008401 740500 -- (-1213.895) (-1211.263) [-1210.355] (-1214.577) * [-1212.082] (-1213.371) (-1211.219) (-1213.273) -- 0:00:16 741000 -- (-1212.947) (-1211.485) (-1212.583) [-1215.241] * (-1211.955) (-1212.556) (-1210.677) [-1214.471] -- 0:00:16 741500 -- (-1211.817) (-1210.884) [-1212.123] (-1216.002) * (-1213.254) (-1214.459) [-1210.950] (-1213.400) -- 0:00:16 742000 -- (-1212.806) (-1212.797) (-1211.993) [-1212.871] * (-1212.813) (-1213.611) (-1213.164) [-1212.190] -- 0:00:16 742500 -- (-1212.968) (-1212.652) [-1211.496] (-1213.100) * (-1214.254) (-1210.998) [-1212.477] (-1211.904) -- 0:00:16 743000 -- [-1211.861] (-1213.465) (-1211.692) (-1215.071) * (-1214.211) (-1210.447) [-1211.714] (-1210.497) -- 0:00:16 743500 -- (-1212.030) (-1212.664) [-1212.053] (-1210.078) * (-1217.390) [-1212.349] (-1211.447) (-1212.214) -- 0:00:16 744000 -- (-1213.437) (-1211.265) (-1215.147) [-1210.226] * (-1215.721) [-1211.737] (-1216.560) (-1211.129) -- 0:00:16 744500 -- (-1210.556) (-1213.767) (-1212.476) [-1212.219] * (-1214.743) [-1212.844] (-1213.853) (-1210.206) -- 0:00:16 745000 -- [-1210.518] (-1213.197) (-1211.139) (-1212.596) * (-1212.885) (-1214.323) (-1213.802) [-1212.396] -- 0:00:16 Average standard deviation of split frequencies: 0.008131 745500 -- (-1212.211) [-1210.927] (-1216.213) (-1210.533) * (-1212.951) (-1215.196) [-1210.568] (-1211.391) -- 0:00:16 746000 -- [-1211.272] (-1211.981) (-1212.357) (-1210.871) * (-1212.195) (-1215.463) [-1211.828] (-1215.613) -- 0:00:16 746500 -- (-1211.560) (-1212.481) (-1210.850) [-1210.863] * (-1212.172) (-1212.103) [-1212.038] (-1214.003) -- 0:00:16 747000 -- (-1210.969) [-1211.580] (-1214.391) (-1211.402) * [-1211.823] (-1213.091) (-1211.453) (-1213.325) -- 0:00:16 747500 -- (-1213.404) (-1212.514) (-1217.314) [-1211.919] * (-1210.165) (-1211.954) (-1212.234) [-1211.520] -- 0:00:16 748000 -- (-1212.870) (-1211.596) (-1210.988) [-1217.126] * (-1214.283) (-1212.733) [-1210.194] (-1211.398) -- 0:00:16 748500 -- (-1213.618) [-1210.836] (-1212.384) (-1213.442) * [-1210.809] (-1212.347) (-1213.282) (-1211.104) -- 0:00:16 749000 -- (-1214.083) (-1211.226) (-1211.216) [-1211.056] * (-1211.749) [-1211.106] (-1214.737) (-1210.309) -- 0:00:16 749500 -- [-1216.922] (-1211.406) (-1216.133) (-1211.861) * (-1212.511) (-1212.446) [-1211.492] (-1211.235) -- 0:00:16 750000 -- (-1214.290) [-1211.206] (-1214.578) (-1212.593) * [-1213.100] (-1213.538) (-1212.110) (-1211.009) -- 0:00:16 Average standard deviation of split frequencies: 0.008499 750500 -- (-1218.339) (-1213.474) (-1211.361) [-1211.966] * (-1214.052) (-1211.202) [-1211.513] (-1211.183) -- 0:00:15 751000 -- (-1215.771) [-1213.377] (-1211.774) (-1210.615) * (-1210.597) (-1212.934) [-1211.428] (-1211.914) -- 0:00:15 751500 -- (-1210.735) (-1210.872) [-1213.702] (-1212.029) * [-1210.378] (-1211.587) (-1213.777) (-1210.936) -- 0:00:15 752000 -- [-1213.121] (-1210.925) (-1217.614) (-1212.210) * (-1212.852) [-1210.545] (-1216.712) (-1213.266) -- 0:00:15 752500 -- (-1212.374) (-1210.011) (-1216.089) [-1212.252] * (-1213.290) (-1213.922) [-1212.137] (-1212.922) -- 0:00:15 753000 -- (-1214.207) [-1214.025] (-1213.426) (-1211.946) * [-1211.535] (-1212.293) (-1211.264) (-1212.077) -- 0:00:15 753500 -- [-1212.400] (-1213.133) (-1213.373) (-1210.970) * (-1211.274) (-1210.444) [-1213.098] (-1211.096) -- 0:00:15 754000 -- (-1213.675) (-1210.147) (-1210.586) [-1210.734] * (-1214.021) [-1212.507] (-1211.948) (-1213.835) -- 0:00:15 754500 -- (-1214.289) (-1217.007) (-1210.870) [-1210.839] * (-1212.666) (-1212.745) (-1211.535) [-1221.543] -- 0:00:15 755000 -- (-1210.779) (-1211.691) [-1210.007] (-1210.186) * (-1211.327) (-1215.399) [-1212.142] (-1213.237) -- 0:00:15 Average standard deviation of split frequencies: 0.008938 755500 -- (-1210.411) [-1212.423] (-1213.085) (-1210.595) * (-1210.747) (-1210.450) [-1213.571] (-1213.761) -- 0:00:15 756000 -- [-1211.446] (-1212.214) (-1212.646) (-1210.136) * [-1210.654] (-1213.853) (-1212.938) (-1211.721) -- 0:00:15 756500 -- [-1215.043] (-1210.710) (-1211.396) (-1210.297) * (-1212.919) (-1214.411) [-1211.403] (-1213.070) -- 0:00:15 757000 -- (-1213.154) [-1211.021] (-1214.281) (-1212.420) * (-1211.093) (-1212.673) [-1210.096] (-1210.930) -- 0:00:15 757500 -- (-1211.980) (-1211.993) (-1212.836) [-1210.580] * [-1212.278] (-1212.967) (-1214.205) (-1210.689) -- 0:00:15 758000 -- (-1213.244) (-1210.822) (-1214.944) [-1212.763] * (-1214.011) (-1212.674) (-1212.091) [-1210.166] -- 0:00:15 758500 -- [-1213.095] (-1211.200) (-1212.962) (-1211.589) * (-1214.996) (-1211.422) (-1212.742) [-1211.213] -- 0:00:15 759000 -- [-1212.694] (-1210.670) (-1215.270) (-1211.753) * (-1214.733) (-1212.256) (-1212.470) [-1211.680] -- 0:00:15 759500 -- (-1215.567) [-1212.518] (-1213.086) (-1211.293) * [-1213.162] (-1212.254) (-1215.836) (-1211.065) -- 0:00:15 760000 -- (-1212.511) (-1211.806) [-1210.999] (-1211.223) * (-1211.547) (-1211.001) [-1213.739] (-1211.587) -- 0:00:15 Average standard deviation of split frequencies: 0.008470 760500 -- (-1214.181) [-1212.134] (-1216.327) (-1210.809) * (-1211.130) [-1214.286] (-1211.237) (-1210.382) -- 0:00:15 761000 -- (-1210.174) [-1211.626] (-1213.209) (-1210.452) * (-1213.209) (-1211.540) [-1214.684] (-1211.608) -- 0:00:15 761500 -- [-1210.315] (-1211.271) (-1220.526) (-1213.529) * (-1215.103) [-1212.411] (-1212.427) (-1212.796) -- 0:00:15 762000 -- (-1211.464) (-1211.892) (-1213.552) [-1211.469] * (-1215.138) [-1217.192] (-1211.201) (-1214.044) -- 0:00:15 762500 -- (-1210.955) [-1213.290] (-1211.633) (-1212.498) * (-1213.032) (-1211.861) (-1211.095) [-1211.219] -- 0:00:15 763000 -- (-1213.357) (-1214.083) [-1211.055] (-1214.670) * (-1210.856) (-1215.612) (-1211.149) [-1211.724] -- 0:00:15 763500 -- (-1216.623) (-1210.949) (-1214.740) [-1212.106] * (-1213.043) [-1213.053] (-1210.498) (-1211.561) -- 0:00:15 764000 -- [-1213.264] (-1213.035) (-1212.175) (-1211.243) * (-1211.069) (-1212.631) (-1210.776) [-1212.202] -- 0:00:15 764500 -- (-1211.645) (-1213.136) (-1212.351) [-1211.596] * (-1214.440) [-1211.031] (-1213.509) (-1213.418) -- 0:00:15 765000 -- (-1213.620) (-1217.811) [-1211.013] (-1212.575) * (-1214.209) [-1211.443] (-1210.691) (-1213.043) -- 0:00:15 Average standard deviation of split frequencies: 0.008329 765500 -- (-1211.833) (-1211.485) (-1213.755) [-1211.439] * (-1210.027) (-1211.263) [-1216.250] (-1215.796) -- 0:00:15 766000 -- (-1216.506) (-1212.883) (-1211.191) [-1210.274] * [-1212.983] (-1212.015) (-1217.685) (-1211.629) -- 0:00:14 766500 -- (-1212.634) (-1212.280) (-1210.096) [-1213.099] * (-1213.067) (-1210.098) (-1215.299) [-1213.106] -- 0:00:14 767000 -- (-1211.446) (-1213.229) (-1213.400) [-1213.058] * (-1216.331) (-1213.923) (-1211.888) [-1211.557] -- 0:00:14 767500 -- (-1212.878) [-1212.968] (-1211.903) (-1212.365) * (-1214.046) (-1210.640) (-1212.062) [-1211.857] -- 0:00:14 768000 -- (-1211.097) [-1212.340] (-1212.502) (-1211.245) * (-1212.151) (-1212.004) [-1209.872] (-1210.265) -- 0:00:14 768500 -- [-1212.121] (-1217.097) (-1213.142) (-1210.106) * (-1211.701) [-1211.986] (-1212.273) (-1217.356) -- 0:00:14 769000 -- (-1212.698) (-1209.847) [-1211.501] (-1210.057) * (-1210.144) (-1211.183) [-1212.974] (-1215.694) -- 0:00:14 769500 -- (-1212.190) (-1212.171) (-1215.256) [-1210.649] * [-1210.193] (-1211.325) (-1210.699) (-1215.294) -- 0:00:14 770000 -- (-1211.703) (-1212.043) (-1213.708) [-1211.361] * (-1211.471) [-1210.080] (-1212.404) (-1211.061) -- 0:00:14 Average standard deviation of split frequencies: 0.008115 770500 -- (-1215.861) [-1211.986] (-1213.512) (-1212.547) * (-1211.127) (-1210.297) (-1213.411) [-1210.471] -- 0:00:14 771000 -- (-1212.906) (-1211.602) (-1217.667) [-1212.764] * (-1213.086) [-1210.340] (-1212.432) (-1210.391) -- 0:00:14 771500 -- [-1216.246] (-1214.877) (-1210.903) (-1212.096) * (-1210.416) (-1210.430) (-1212.261) [-1211.425] -- 0:00:14 772000 -- (-1212.023) (-1212.988) (-1212.422) [-1211.826] * (-1213.251) (-1211.295) (-1211.357) [-1212.689] -- 0:00:14 772500 -- (-1211.211) [-1213.520] (-1212.639) (-1210.424) * (-1211.356) (-1211.588) (-1214.183) [-1213.219] -- 0:00:14 773000 -- (-1211.407) (-1213.961) [-1210.682] (-1211.157) * [-1210.506] (-1210.464) (-1215.212) (-1214.129) -- 0:00:14 773500 -- (-1211.560) (-1211.336) [-1210.592] (-1212.940) * (-1210.294) [-1210.884] (-1212.468) (-1217.051) -- 0:00:14 774000 -- [-1213.617] (-1215.762) (-1213.021) (-1212.905) * (-1212.061) (-1214.553) (-1211.389) [-1212.547] -- 0:00:14 774500 -- (-1211.569) (-1213.479) (-1212.375) [-1211.339] * (-1210.694) (-1212.858) (-1216.109) [-1210.267] -- 0:00:14 775000 -- (-1210.628) (-1214.183) [-1212.834] (-1211.192) * (-1211.880) [-1211.036] (-1210.865) (-1211.478) -- 0:00:14 Average standard deviation of split frequencies: 0.007857 775500 -- (-1211.569) (-1214.646) [-1212.425] (-1212.013) * [-1213.002] (-1214.519) (-1211.681) (-1211.068) -- 0:00:14 776000 -- [-1210.278] (-1212.866) (-1214.373) (-1223.321) * (-1211.237) [-1211.918] (-1212.005) (-1212.563) -- 0:00:14 776500 -- (-1212.327) (-1212.959) [-1215.304] (-1216.904) * (-1210.819) [-1212.600] (-1210.549) (-1216.105) -- 0:00:14 777000 -- (-1211.973) (-1214.168) (-1213.855) [-1214.610] * (-1212.448) (-1211.988) [-1215.057] (-1211.749) -- 0:00:14 777500 -- (-1213.675) [-1211.527] (-1216.760) (-1218.857) * (-1212.252) (-1211.427) [-1212.851] (-1211.802) -- 0:00:14 778000 -- (-1215.110) (-1215.697) [-1210.206] (-1215.578) * (-1214.488) (-1214.075) (-1213.548) [-1212.550] -- 0:00:14 778500 -- (-1213.370) (-1210.573) [-1210.822] (-1215.804) * (-1211.022) (-1213.066) [-1211.319] (-1210.861) -- 0:00:14 779000 -- (-1213.619) (-1213.059) [-1211.695] (-1220.323) * (-1211.848) (-1211.842) [-1214.626] (-1210.676) -- 0:00:14 779500 -- (-1216.190) [-1211.743] (-1210.794) (-1224.760) * [-1210.854] (-1211.232) (-1210.502) (-1212.657) -- 0:00:14 780000 -- (-1211.411) (-1211.015) (-1211.253) [-1215.521] * (-1210.765) (-1211.275) [-1210.343] (-1212.634) -- 0:00:14 Average standard deviation of split frequencies: 0.007689 780500 -- [-1210.521] (-1213.442) (-1211.377) (-1225.517) * (-1211.811) (-1210.838) [-1211.513] (-1210.970) -- 0:00:14 781000 -- [-1210.914] (-1219.165) (-1211.962) (-1225.035) * (-1212.065) (-1212.849) [-1211.588] (-1210.903) -- 0:00:14 781500 -- [-1212.383] (-1213.159) (-1213.609) (-1217.557) * [-1211.412] (-1210.024) (-1212.896) (-1211.406) -- 0:00:13 782000 -- (-1211.686) [-1211.686] (-1212.200) (-1211.188) * [-1213.457] (-1214.263) (-1213.543) (-1211.649) -- 0:00:13 782500 -- (-1211.219) (-1211.743) (-1209.880) [-1214.974] * (-1210.917) (-1214.123) [-1213.443] (-1212.585) -- 0:00:13 783000 -- (-1211.349) (-1211.598) [-1209.880] (-1211.777) * [-1211.003] (-1213.117) (-1213.356) (-1213.498) -- 0:00:13 783500 -- (-1211.145) (-1214.017) (-1214.154) [-1213.028] * [-1214.545] (-1213.838) (-1214.633) (-1215.705) -- 0:00:13 784000 -- [-1210.963] (-1212.004) (-1212.769) (-1215.314) * [-1214.279] (-1222.382) (-1211.496) (-1211.220) -- 0:00:13 784500 -- (-1211.073) (-1210.334) [-1210.596] (-1212.684) * (-1212.805) [-1213.771] (-1210.671) (-1211.960) -- 0:00:13 785000 -- (-1212.646) (-1211.476) [-1211.066] (-1212.148) * [-1212.544] (-1212.354) (-1210.796) (-1216.606) -- 0:00:13 Average standard deviation of split frequencies: 0.007647 785500 -- (-1212.461) (-1215.175) (-1210.723) [-1212.912] * (-1212.849) (-1214.864) (-1215.175) [-1211.314] -- 0:00:13 786000 -- (-1211.694) [-1211.667] (-1210.884) (-1212.811) * (-1210.886) (-1213.072) [-1212.489] (-1210.467) -- 0:00:13 786500 -- (-1211.851) [-1212.868] (-1210.007) (-1211.720) * (-1212.587) (-1210.972) (-1211.866) [-1211.840] -- 0:00:13 787000 -- (-1210.908) (-1217.175) (-1210.704) [-1211.231] * (-1212.527) (-1210.546) [-1210.824] (-1210.311) -- 0:00:13 787500 -- (-1210.133) (-1217.176) [-1210.712] (-1212.069) * (-1213.721) (-1211.383) (-1211.748) [-1210.335] -- 0:00:13 788000 -- (-1210.704) [-1211.676] (-1211.555) (-1212.712) * (-1212.003) [-1210.689] (-1213.751) (-1213.260) -- 0:00:13 788500 -- (-1211.686) (-1213.632) (-1212.667) [-1214.569] * (-1212.284) (-1212.809) (-1215.327) [-1211.148] -- 0:00:13 789000 -- (-1211.802) [-1212.780] (-1212.675) (-1211.347) * (-1211.735) [-1211.907] (-1214.688) (-1211.760) -- 0:00:13 789500 -- (-1211.708) (-1213.904) (-1213.994) [-1210.540] * (-1214.481) (-1212.943) [-1212.386] (-1210.284) -- 0:00:13 790000 -- [-1212.604] (-1210.911) (-1212.030) (-1210.555) * (-1212.981) (-1212.916) [-1213.396] (-1210.309) -- 0:00:13 Average standard deviation of split frequencies: 0.007676 790500 -- (-1212.511) (-1210.839) (-1211.154) [-1210.489] * (-1212.676) [-1212.467] (-1213.646) (-1212.440) -- 0:00:13 791000 -- (-1211.260) (-1212.131) [-1211.749] (-1212.623) * (-1212.834) (-1215.750) (-1211.201) [-1212.894] -- 0:00:13 791500 -- [-1217.326] (-1211.259) (-1211.022) (-1210.927) * [-1212.493] (-1211.132) (-1210.403) (-1213.115) -- 0:00:13 792000 -- (-1211.728) (-1212.665) (-1212.388) [-1211.142] * [-1212.060] (-1213.840) (-1210.399) (-1215.087) -- 0:00:13 792500 -- (-1213.074) [-1213.219] (-1212.241) (-1214.045) * (-1210.598) (-1214.945) [-1210.139] (-1213.353) -- 0:00:13 793000 -- [-1212.276] (-1212.264) (-1212.074) (-1214.895) * (-1212.233) (-1213.524) [-1212.590] (-1212.873) -- 0:00:13 793500 -- (-1214.969) (-1214.818) (-1210.767) [-1210.699] * (-1218.619) (-1211.217) (-1210.481) [-1210.903] -- 0:00:13 794000 -- (-1211.650) (-1212.136) (-1211.779) [-1210.243] * (-1214.444) [-1213.502] (-1213.971) (-1211.413) -- 0:00:13 794500 -- (-1214.292) [-1213.339] (-1213.263) (-1214.469) * (-1211.108) [-1213.407] (-1215.333) (-1211.996) -- 0:00:13 795000 -- (-1212.927) (-1216.543) (-1210.999) [-1214.001] * (-1211.383) [-1210.802] (-1214.021) (-1213.852) -- 0:00:13 Average standard deviation of split frequencies: 0.007995 795500 -- (-1212.028) [-1213.552] (-1211.267) (-1213.113) * [-1210.951] (-1211.174) (-1212.832) (-1211.140) -- 0:00:13 796000 -- [-1210.216] (-1210.172) (-1212.715) (-1209.959) * (-1211.736) (-1210.456) (-1210.189) [-1210.357] -- 0:00:13 796500 -- (-1211.551) (-1213.778) (-1211.432) [-1211.900] * (-1212.518) (-1210.470) [-1211.738] (-1210.934) -- 0:00:13 797000 -- (-1212.001) (-1212.558) [-1211.819] (-1212.882) * (-1215.137) [-1211.718] (-1210.602) (-1215.720) -- 0:00:12 797500 -- [-1211.940] (-1216.327) (-1213.337) (-1212.866) * (-1212.125) [-1210.502] (-1213.092) (-1214.731) -- 0:00:12 798000 -- (-1209.955) (-1212.664) [-1213.378] (-1212.175) * [-1211.703] (-1214.090) (-1212.458) (-1218.159) -- 0:00:12 798500 -- (-1212.897) [-1211.701] (-1212.393) (-1214.301) * (-1211.430) (-1212.586) (-1212.949) [-1219.035] -- 0:00:12 799000 -- (-1212.902) (-1211.333) [-1214.229] (-1211.894) * [-1212.904] (-1212.343) (-1212.906) (-1217.588) -- 0:00:12 799500 -- (-1211.032) (-1212.873) [-1210.874] (-1212.356) * (-1211.982) (-1211.168) [-1213.002] (-1211.726) -- 0:00:12 800000 -- (-1212.216) [-1211.769] (-1215.086) (-1211.008) * (-1212.297) [-1213.083] (-1210.921) (-1211.542) -- 0:00:12 Average standard deviation of split frequencies: 0.007458 800500 -- [-1211.982] (-1210.483) (-1213.888) (-1214.579) * [-1214.628] (-1212.625) (-1214.932) (-1218.717) -- 0:00:12 801000 -- (-1212.474) [-1211.614] (-1217.572) (-1212.304) * (-1215.390) (-1212.275) (-1215.027) [-1212.924] -- 0:00:12 801500 -- (-1212.522) (-1212.850) (-1210.802) [-1211.221] * (-1210.937) (-1210.426) [-1212.228] (-1211.959) -- 0:00:12 802000 -- [-1212.675] (-1211.443) (-1211.607) (-1215.548) * (-1214.102) (-1210.978) [-1211.793] (-1211.867) -- 0:00:12 802500 -- (-1215.390) (-1211.202) [-1214.565] (-1211.620) * (-1212.630) (-1212.918) (-1212.479) [-1210.123] -- 0:00:12 803000 -- (-1227.699) (-1211.838) (-1216.516) [-1210.806] * (-1213.096) [-1211.188] (-1216.919) (-1210.230) -- 0:00:12 803500 -- (-1213.317) (-1213.446) [-1212.653] (-1211.857) * [-1211.971] (-1210.919) (-1213.343) (-1213.073) -- 0:00:12 804000 -- (-1213.348) (-1211.169) [-1210.631] (-1209.909) * (-1213.399) [-1210.883] (-1215.166) (-1214.024) -- 0:00:12 804500 -- (-1215.530) (-1214.063) [-1215.867] (-1210.210) * (-1218.610) (-1213.120) [-1211.266] (-1219.826) -- 0:00:12 805000 -- (-1215.272) [-1211.483] (-1212.036) (-1210.663) * (-1214.691) (-1212.789) (-1211.210) [-1211.152] -- 0:00:12 Average standard deviation of split frequencies: 0.007525 805500 -- (-1216.378) [-1210.965] (-1211.363) (-1210.178) * [-1214.645] (-1217.616) (-1211.709) (-1210.496) -- 0:00:12 806000 -- (-1210.619) (-1211.301) [-1212.838] (-1214.281) * (-1217.327) [-1211.498] (-1214.336) (-1211.604) -- 0:00:12 806500 -- (-1210.485) (-1213.920) [-1212.511] (-1211.516) * (-1212.323) [-1209.998] (-1211.564) (-1211.614) -- 0:00:12 807000 -- (-1210.634) [-1210.623] (-1212.752) (-1212.877) * (-1211.379) [-1211.146] (-1211.246) (-1212.173) -- 0:00:12 807500 -- [-1211.617] (-1213.313) (-1214.822) (-1212.269) * (-1210.816) (-1212.412) (-1212.242) [-1216.901] -- 0:00:12 808000 -- (-1210.204) [-1212.656] (-1211.389) (-1211.771) * (-1210.745) (-1214.913) [-1216.757] (-1212.334) -- 0:00:12 808500 -- (-1210.524) [-1212.156] (-1210.966) (-1213.398) * [-1211.124] (-1212.990) (-1212.876) (-1213.955) -- 0:00:12 809000 -- [-1210.307] (-1210.565) (-1211.531) (-1211.461) * (-1212.604) [-1211.471] (-1211.658) (-1212.247) -- 0:00:12 809500 -- (-1214.510) (-1211.506) (-1215.015) [-1211.942] * [-1212.173] (-1210.937) (-1212.447) (-1212.912) -- 0:00:12 810000 -- (-1213.493) [-1212.774] (-1218.238) (-1213.288) * (-1210.932) (-1210.864) [-1217.059] (-1214.233) -- 0:00:12 Average standard deviation of split frequencies: 0.007450 810500 -- [-1211.981] (-1211.740) (-1213.006) (-1213.156) * (-1213.956) [-1211.338] (-1216.742) (-1213.108) -- 0:00:12 811000 -- [-1211.122] (-1211.085) (-1214.542) (-1210.683) * [-1213.479] (-1212.659) (-1211.733) (-1210.732) -- 0:00:12 811500 -- [-1210.545] (-1212.326) (-1218.772) (-1210.638) * (-1210.753) (-1213.486) (-1213.241) [-1210.870] -- 0:00:12 812000 -- [-1212.708] (-1211.726) (-1213.402) (-1211.037) * [-1214.877] (-1213.359) (-1211.613) (-1211.218) -- 0:00:12 812500 -- [-1210.960] (-1215.323) (-1212.320) (-1214.463) * [-1216.749] (-1212.209) (-1212.397) (-1212.740) -- 0:00:12 813000 -- (-1215.449) (-1212.777) [-1215.676] (-1213.783) * [-1212.943] (-1214.797) (-1212.516) (-1213.179) -- 0:00:11 813500 -- [-1210.953] (-1211.023) (-1210.620) (-1211.753) * (-1212.811) [-1211.442] (-1216.049) (-1211.406) -- 0:00:11 814000 -- (-1211.033) (-1210.832) (-1211.318) [-1210.535] * (-1211.123) [-1213.862] (-1216.081) (-1213.179) -- 0:00:11 814500 -- (-1212.066) (-1211.436) [-1212.832] (-1211.558) * (-1212.994) [-1211.018] (-1211.515) (-1212.024) -- 0:00:11 815000 -- [-1211.833] (-1211.042) (-1214.412) (-1212.760) * (-1212.716) (-1210.064) (-1210.291) [-1214.872] -- 0:00:11 Average standard deviation of split frequencies: 0.007221 815500 -- [-1212.444] (-1209.886) (-1214.162) (-1213.109) * (-1212.179) (-1210.936) [-1210.400] (-1212.320) -- 0:00:11 816000 -- (-1210.699) (-1209.883) (-1213.191) [-1210.360] * [-1210.684] (-1212.605) (-1213.595) (-1210.814) -- 0:00:11 816500 -- (-1210.521) (-1210.579) [-1210.301] (-1212.144) * (-1210.954) [-1214.198] (-1211.423) (-1212.440) -- 0:00:11 817000 -- [-1210.077] (-1211.210) (-1212.423) (-1211.098) * (-1211.645) (-1211.526) [-1212.117] (-1211.001) -- 0:00:11 817500 -- (-1211.044) (-1215.836) (-1212.019) [-1210.121] * (-1215.341) [-1210.956] (-1211.501) (-1216.042) -- 0:00:11 818000 -- (-1212.797) (-1215.538) (-1211.291) [-1215.276] * (-1216.845) (-1212.723) [-1213.416] (-1215.218) -- 0:00:11 818500 -- [-1212.243] (-1214.604) (-1210.535) (-1210.868) * (-1211.261) (-1212.523) [-1211.615] (-1213.777) -- 0:00:11 819000 -- (-1212.938) (-1215.472) (-1211.450) [-1211.381] * [-1213.614] (-1211.945) (-1210.129) (-1211.573) -- 0:00:11 819500 -- (-1214.673) [-1212.910] (-1216.281) (-1211.544) * [-1212.887] (-1213.924) (-1210.445) (-1210.458) -- 0:00:11 820000 -- [-1211.920] (-1213.310) (-1211.730) (-1211.884) * [-1211.004] (-1214.065) (-1211.150) (-1212.669) -- 0:00:11 Average standard deviation of split frequencies: 0.007396 820500 -- (-1211.857) (-1212.165) (-1210.375) [-1210.831] * [-1213.287] (-1211.888) (-1211.434) (-1216.980) -- 0:00:11 821000 -- (-1215.054) (-1213.057) (-1211.424) [-1210.302] * (-1210.299) (-1211.660) [-1213.891] (-1216.968) -- 0:00:11 821500 -- (-1219.427) (-1212.345) [-1211.313] (-1210.994) * [-1210.835] (-1211.814) (-1215.758) (-1213.810) -- 0:00:11 822000 -- (-1211.942) [-1215.192] (-1213.423) (-1216.548) * (-1210.534) [-1211.679] (-1217.139) (-1212.362) -- 0:00:11 822500 -- (-1212.506) (-1211.381) (-1212.510) [-1212.778] * (-1210.461) (-1212.492) (-1212.775) [-1213.590] -- 0:00:11 823000 -- (-1213.973) (-1211.380) [-1213.163] (-1210.639) * (-1215.765) [-1210.178] (-1211.441) (-1216.378) -- 0:00:11 823500 -- (-1213.531) (-1212.598) [-1210.932] (-1211.029) * (-1214.171) (-1212.051) [-1211.365] (-1212.689) -- 0:00:11 824000 -- (-1212.578) [-1211.530] (-1210.865) (-1211.787) * (-1211.488) [-1210.420] (-1211.887) (-1212.552) -- 0:00:11 824500 -- (-1211.026) (-1217.450) [-1210.442] (-1216.410) * [-1214.268] (-1211.115) (-1213.643) (-1216.749) -- 0:00:11 825000 -- (-1210.533) (-1216.987) [-1211.743] (-1213.256) * (-1210.880) [-1212.255] (-1210.741) (-1212.333) -- 0:00:11 Average standard deviation of split frequencies: 0.007633 825500 -- [-1216.074] (-1215.122) (-1211.194) (-1211.594) * (-1214.826) (-1213.411) [-1210.114] (-1212.997) -- 0:00:11 826000 -- [-1211.283] (-1220.516) (-1212.065) (-1210.555) * (-1211.188) (-1213.018) [-1210.096] (-1210.771) -- 0:00:11 826500 -- (-1211.402) (-1211.016) [-1213.562] (-1212.744) * (-1210.643) (-1212.236) (-1210.421) [-1210.575] -- 0:00:11 827000 -- (-1210.993) (-1211.978) [-1214.985] (-1211.255) * (-1211.919) [-1213.891] (-1212.073) (-1217.587) -- 0:00:11 827500 -- (-1214.758) (-1211.458) [-1211.367] (-1211.720) * (-1210.279) (-1212.178) [-1213.204] (-1212.210) -- 0:00:11 828000 -- (-1212.934) [-1210.109] (-1210.446) (-1220.279) * (-1211.235) (-1216.139) (-1211.808) [-1212.524] -- 0:00:11 828500 -- (-1218.428) [-1215.717] (-1215.341) (-1211.516) * (-1211.485) [-1211.242] (-1212.720) (-1211.991) -- 0:00:10 829000 -- (-1214.363) (-1211.351) (-1211.068) [-1215.155] * (-1211.411) [-1210.944] (-1211.287) (-1211.086) -- 0:00:10 829500 -- (-1210.805) (-1211.075) [-1210.759] (-1213.140) * (-1211.538) (-1211.259) [-1211.183] (-1212.991) -- 0:00:10 830000 -- [-1211.312] (-1218.158) (-1212.138) (-1213.014) * (-1211.842) [-1212.770] (-1210.672) (-1212.314) -- 0:00:10 Average standard deviation of split frequencies: 0.007642 830500 -- (-1210.427) (-1213.832) (-1210.847) [-1211.481] * [-1214.173] (-1211.249) (-1214.628) (-1210.780) -- 0:00:10 831000 -- (-1210.774) (-1212.740) (-1210.751) [-1211.529] * (-1211.962) (-1213.719) (-1214.792) [-1211.633] -- 0:00:10 831500 -- (-1213.701) (-1214.311) [-1216.484] (-1217.367) * [-1211.719] (-1211.012) (-1215.542) (-1214.515) -- 0:00:10 832000 -- (-1210.112) (-1211.174) (-1213.369) [-1216.814] * [-1213.500] (-1212.532) (-1210.771) (-1211.129) -- 0:00:10 832500 -- (-1209.805) (-1211.729) (-1213.424) [-1210.596] * [-1213.464] (-1214.089) (-1214.514) (-1211.609) -- 0:00:10 833000 -- (-1211.489) (-1220.028) (-1210.577) [-1212.322] * (-1211.892) (-1211.153) (-1215.045) [-1210.072] -- 0:00:10 833500 -- (-1213.942) (-1213.984) (-1210.846) [-1211.899] * (-1215.198) (-1211.292) [-1213.396] (-1214.406) -- 0:00:10 834000 -- [-1210.449] (-1211.939) (-1213.085) (-1213.736) * [-1210.443] (-1211.787) (-1213.604) (-1214.116) -- 0:00:10 834500 -- (-1213.995) [-1210.726] (-1214.078) (-1219.177) * [-1211.019] (-1211.788) (-1213.237) (-1210.712) -- 0:00:10 835000 -- (-1213.399) (-1214.936) (-1213.905) [-1210.317] * (-1211.014) [-1210.323] (-1212.760) (-1211.501) -- 0:00:10 Average standard deviation of split frequencies: 0.007669 835500 -- (-1211.635) [-1212.060] (-1214.980) (-1211.058) * (-1210.602) (-1210.552) [-1212.711] (-1213.662) -- 0:00:10 836000 -- (-1211.307) [-1217.942] (-1213.081) (-1210.903) * (-1211.495) (-1213.930) (-1213.462) [-1211.394] -- 0:00:10 836500 -- [-1210.570] (-1215.536) (-1212.396) (-1211.053) * (-1211.111) [-1211.178] (-1215.453) (-1212.257) -- 0:00:10 837000 -- (-1212.559) (-1217.417) (-1211.141) [-1212.901] * (-1217.145) [-1211.810] (-1210.103) (-1214.485) -- 0:00:10 837500 -- [-1213.559] (-1213.448) (-1210.789) (-1211.815) * (-1215.679) (-1212.996) [-1213.551] (-1214.447) -- 0:00:10 838000 -- (-1213.799) [-1210.509] (-1210.247) (-1211.792) * (-1216.668) (-1214.445) [-1211.148] (-1215.714) -- 0:00:10 838500 -- (-1211.586) [-1211.311] (-1210.788) (-1214.782) * (-1212.444) (-1211.634) (-1211.851) [-1210.795] -- 0:00:10 839000 -- (-1211.249) (-1211.979) [-1212.209] (-1215.075) * (-1212.848) [-1211.468] (-1211.347) (-1210.578) -- 0:00:10 839500 -- (-1213.228) (-1212.030) [-1214.868] (-1211.384) * (-1210.681) [-1211.095] (-1211.739) (-1211.052) -- 0:00:10 840000 -- (-1211.657) (-1211.698) [-1210.051] (-1211.470) * [-1212.021] (-1211.209) (-1212.284) (-1214.160) -- 0:00:10 Average standard deviation of split frequencies: 0.007477 840500 -- (-1212.348) (-1211.572) (-1211.683) [-1214.100] * (-1211.916) (-1211.522) [-1211.953] (-1212.993) -- 0:00:10 841000 -- (-1210.021) (-1212.694) [-1211.874] (-1214.625) * [-1211.046] (-1212.736) (-1214.888) (-1218.655) -- 0:00:10 841500 -- (-1209.842) [-1211.172] (-1212.226) (-1213.842) * (-1211.738) (-1214.576) (-1212.481) [-1214.021] -- 0:00:10 842000 -- (-1210.012) (-1214.702) (-1213.593) [-1213.280] * [-1211.709] (-1212.527) (-1210.556) (-1214.474) -- 0:00:10 842500 -- (-1211.228) (-1214.789) (-1215.671) [-1210.287] * (-1211.688) (-1213.376) (-1211.665) [-1212.023] -- 0:00:10 843000 -- (-1212.109) (-1215.573) (-1211.697) [-1212.739] * (-1212.810) (-1213.401) [-1210.386] (-1212.170) -- 0:00:10 843500 -- (-1211.873) [-1211.929] (-1214.132) (-1214.172) * (-1211.691) [-1211.487] (-1211.332) (-1210.291) -- 0:00:10 844000 -- (-1211.496) [-1211.787] (-1215.888) (-1211.474) * (-1211.223) (-1211.730) (-1213.552) [-1212.048] -- 0:00:09 844500 -- (-1211.035) (-1211.963) (-1215.499) [-1213.806] * (-1211.267) [-1213.080] (-1211.971) (-1213.147) -- 0:00:09 845000 -- [-1210.712] (-1210.265) (-1215.889) (-1211.914) * (-1210.757) [-1215.844] (-1211.139) (-1217.222) -- 0:00:09 Average standard deviation of split frequencies: 0.007430 845500 -- (-1211.269) (-1214.670) (-1216.824) [-1212.032] * (-1212.946) (-1210.780) (-1210.527) [-1210.819] -- 0:00:09 846000 -- [-1212.894] (-1217.495) (-1211.182) (-1212.781) * (-1212.382) (-1211.583) (-1211.769) [-1212.893] -- 0:00:09 846500 -- [-1214.564] (-1216.478) (-1212.164) (-1211.643) * [-1211.659] (-1211.721) (-1213.499) (-1212.213) -- 0:00:09 847000 -- (-1213.553) (-1212.853) (-1216.473) [-1213.242] * (-1210.337) (-1211.720) (-1210.218) [-1210.713] -- 0:00:09 847500 -- [-1212.119] (-1216.008) (-1211.635) (-1213.246) * [-1210.487] (-1211.422) (-1210.301) (-1212.606) -- 0:00:09 848000 -- [-1211.752] (-1211.803) (-1213.126) (-1211.736) * (-1212.161) (-1210.146) [-1211.897] (-1214.464) -- 0:00:09 848500 -- (-1211.707) (-1212.752) (-1214.815) [-1213.550] * (-1215.123) (-1212.609) [-1213.559] (-1210.760) -- 0:00:09 849000 -- (-1211.660) (-1214.132) [-1212.581] (-1212.958) * (-1211.855) (-1210.744) (-1214.061) [-1212.104] -- 0:00:09 849500 -- (-1217.900) (-1212.033) [-1211.301] (-1212.512) * (-1218.248) [-1212.438] (-1210.692) (-1217.177) -- 0:00:09 850000 -- (-1212.312) (-1211.141) [-1211.250] (-1212.734) * [-1217.918] (-1210.857) (-1211.903) (-1213.768) -- 0:00:09 Average standard deviation of split frequencies: 0.007241 850500 -- (-1209.888) (-1213.336) [-1213.990] (-1212.145) * (-1215.094) [-1212.413] (-1210.858) (-1212.220) -- 0:00:09 851000 -- (-1212.226) (-1212.404) [-1210.749] (-1212.526) * [-1211.521] (-1211.714) (-1211.406) (-1212.785) -- 0:00:09 851500 -- (-1212.418) [-1212.289] (-1212.047) (-1213.708) * (-1210.954) [-1210.803] (-1211.013) (-1211.671) -- 0:00:09 852000 -- (-1213.812) (-1211.949) (-1211.853) [-1210.186] * (-1212.621) (-1213.500) [-1213.775] (-1215.292) -- 0:00:09 852500 -- [-1213.504] (-1210.898) (-1218.892) (-1215.760) * [-1213.068] (-1213.917) (-1211.519) (-1215.278) -- 0:00:09 853000 -- (-1212.487) [-1211.558] (-1212.569) (-1211.483) * (-1212.456) (-1217.817) [-1210.633] (-1211.913) -- 0:00:09 853500 -- [-1214.416] (-1212.609) (-1214.624) (-1210.826) * [-1212.747] (-1211.301) (-1210.879) (-1212.340) -- 0:00:09 854000 -- (-1214.854) (-1211.588) [-1210.826] (-1211.330) * (-1211.430) (-1213.220) [-1210.671] (-1211.184) -- 0:00:09 854500 -- [-1211.324] (-1211.423) (-1211.702) (-1210.877) * [-1213.751] (-1214.113) (-1210.782) (-1211.145) -- 0:00:09 855000 -- (-1213.554) (-1211.246) (-1210.452) [-1211.257] * (-1211.985) (-1212.977) (-1213.636) [-1211.785] -- 0:00:09 Average standard deviation of split frequencies: 0.007416 855500 -- (-1213.130) (-1211.367) (-1209.946) [-1212.579] * (-1212.838) [-1211.484] (-1213.506) (-1215.537) -- 0:00:09 856000 -- [-1210.464] (-1213.042) (-1213.331) (-1213.352) * (-1218.906) (-1212.757) [-1213.641] (-1216.731) -- 0:00:09 856500 -- (-1211.128) (-1213.768) [-1213.147] (-1212.379) * [-1213.756] (-1212.094) (-1216.491) (-1212.872) -- 0:00:09 857000 -- (-1210.984) (-1212.296) [-1213.527] (-1211.170) * (-1213.569) (-1212.031) (-1215.183) [-1212.603] -- 0:00:09 857500 -- (-1211.249) [-1211.333] (-1211.874) (-1211.052) * [-1216.108] (-1216.016) (-1212.335) (-1215.857) -- 0:00:09 858000 -- [-1211.589] (-1212.869) (-1215.122) (-1211.462) * (-1211.195) (-1212.300) [-1212.222] (-1211.626) -- 0:00:09 858500 -- (-1212.813) (-1211.656) [-1210.953] (-1211.923) * (-1211.525) (-1211.415) (-1213.440) [-1214.166] -- 0:00:09 859000 -- (-1211.459) (-1212.063) [-1212.892] (-1214.355) * (-1210.894) (-1211.177) (-1211.682) [-1212.271] -- 0:00:09 859500 -- (-1212.829) [-1212.609] (-1212.171) (-1212.205) * (-1210.935) (-1210.417) [-1214.389] (-1213.759) -- 0:00:08 860000 -- (-1213.976) [-1213.110] (-1212.482) (-1212.352) * [-1212.935] (-1212.995) (-1214.950) (-1212.492) -- 0:00:08 Average standard deviation of split frequencies: 0.007339 860500 -- (-1210.953) [-1210.991] (-1214.774) (-1216.537) * [-1210.900] (-1211.547) (-1211.740) (-1211.459) -- 0:00:08 861000 -- [-1211.524] (-1213.158) (-1211.887) (-1212.754) * (-1217.667) (-1213.029) [-1211.933] (-1212.658) -- 0:00:08 861500 -- (-1210.926) [-1212.979] (-1211.801) (-1211.304) * (-1216.442) (-1214.536) (-1210.908) [-1211.323] -- 0:00:08 862000 -- (-1211.046) (-1212.549) [-1210.488] (-1212.897) * (-1215.220) (-1210.654) [-1213.423] (-1211.125) -- 0:00:08 862500 -- (-1211.798) [-1210.516] (-1219.591) (-1213.964) * (-1210.739) [-1211.743] (-1210.750) (-1211.602) -- 0:00:08 863000 -- (-1212.555) (-1213.928) (-1223.636) [-1210.202] * (-1212.132) [-1213.908] (-1215.405) (-1215.166) -- 0:00:08 863500 -- (-1215.966) (-1211.241) (-1211.309) [-1210.687] * (-1211.617) (-1212.052) [-1215.912] (-1213.417) -- 0:00:08 864000 -- [-1211.870] (-1211.210) (-1212.159) (-1211.646) * (-1211.161) (-1211.203) (-1213.775) [-1214.993] -- 0:00:08 864500 -- [-1213.706] (-1212.310) (-1210.379) (-1213.559) * (-1213.728) (-1212.421) (-1213.638) [-1212.245] -- 0:00:08 865000 -- (-1218.469) (-1213.318) (-1214.381) [-1212.150] * [-1211.823] (-1211.279) (-1212.832) (-1212.266) -- 0:00:08 Average standard deviation of split frequencies: 0.006968 865500 -- (-1215.324) [-1212.478] (-1213.631) (-1212.159) * (-1213.390) (-1217.806) (-1212.465) [-1212.989] -- 0:00:08 866000 -- [-1211.896] (-1213.915) (-1214.109) (-1212.541) * (-1211.744) (-1216.445) (-1211.417) [-1210.489] -- 0:00:08 866500 -- [-1212.368] (-1212.622) (-1213.729) (-1217.764) * (-1210.712) [-1214.413] (-1213.888) (-1211.786) -- 0:00:08 867000 -- (-1210.769) (-1212.849) [-1212.240] (-1211.860) * [-1209.866] (-1212.324) (-1210.797) (-1220.102) -- 0:00:08 867500 -- [-1210.149] (-1213.320) (-1213.085) (-1212.128) * (-1213.369) (-1211.970) [-1210.749] (-1213.463) -- 0:00:08 868000 -- [-1212.088] (-1211.125) (-1213.202) (-1214.349) * (-1213.092) [-1211.305] (-1210.125) (-1217.536) -- 0:00:08 868500 -- (-1213.207) (-1210.352) [-1212.028] (-1212.836) * [-1213.039] (-1211.767) (-1215.055) (-1211.680) -- 0:00:08 869000 -- (-1211.035) (-1211.940) (-1212.755) [-1211.541] * [-1215.410] (-1211.433) (-1213.962) (-1210.341) -- 0:00:08 869500 -- (-1214.170) [-1211.363] (-1211.262) (-1212.359) * (-1218.882) [-1212.135] (-1212.388) (-1214.091) -- 0:00:08 870000 -- (-1214.820) (-1212.985) (-1213.824) [-1211.658] * (-1210.436) (-1212.069) (-1212.091) [-1212.096] -- 0:00:08 Average standard deviation of split frequencies: 0.006786 870500 -- (-1210.078) [-1212.094] (-1212.128) (-1212.203) * (-1213.072) (-1210.902) [-1210.894] (-1211.696) -- 0:00:08 871000 -- (-1210.049) [-1210.301] (-1210.577) (-1214.705) * (-1213.186) (-1210.382) (-1211.540) [-1216.383] -- 0:00:08 871500 -- (-1214.153) [-1212.165] (-1210.675) (-1210.809) * [-1212.311] (-1212.890) (-1211.833) (-1215.936) -- 0:00:08 872000 -- (-1213.366) (-1212.143) [-1212.970] (-1211.610) * (-1211.668) (-1211.860) (-1211.155) [-1211.622] -- 0:00:08 872500 -- [-1212.716] (-1211.124) (-1212.655) (-1210.869) * (-1221.305) (-1213.861) (-1213.423) [-1212.240] -- 0:00:08 873000 -- (-1215.188) (-1210.692) [-1212.027] (-1212.717) * (-1211.259) [-1213.947] (-1212.404) (-1210.769) -- 0:00:08 873500 -- (-1211.490) [-1210.373] (-1214.209) (-1212.717) * (-1210.354) (-1214.340) (-1218.721) [-1213.342] -- 0:00:08 874000 -- [-1215.591] (-1212.662) (-1212.123) (-1212.473) * (-1213.876) [-1212.170] (-1212.401) (-1212.903) -- 0:00:08 874500 -- [-1216.911] (-1212.743) (-1215.409) (-1212.745) * (-1215.477) [-1214.510] (-1210.831) (-1211.037) -- 0:00:08 875000 -- [-1213.319] (-1217.448) (-1213.402) (-1214.408) * (-1213.133) [-1212.051] (-1215.711) (-1213.370) -- 0:00:08 Average standard deviation of split frequencies: 0.006709 875500 -- (-1212.369) [-1212.598] (-1212.126) (-1215.712) * (-1216.056) (-1214.332) [-1213.022] (-1212.244) -- 0:00:07 876000 -- (-1211.681) (-1212.559) (-1214.442) [-1212.194] * (-1210.284) (-1214.304) (-1215.841) [-1211.811] -- 0:00:07 876500 -- (-1212.228) (-1212.795) [-1212.387] (-1214.504) * (-1215.238) (-1211.728) [-1214.279] (-1212.142) -- 0:00:07 877000 -- (-1212.920) [-1211.672] (-1211.010) (-1212.661) * (-1210.601) [-1213.537] (-1214.705) (-1214.759) -- 0:00:07 877500 -- (-1213.006) [-1211.537] (-1210.603) (-1210.431) * (-1212.815) [-1210.613] (-1212.686) (-1213.369) -- 0:00:07 878000 -- (-1212.474) [-1211.745] (-1212.016) (-1211.198) * (-1210.695) (-1212.950) [-1213.063] (-1212.159) -- 0:00:07 878500 -- (-1215.128) (-1215.932) [-1211.171] (-1212.716) * (-1212.043) (-1212.059) (-1215.023) [-1210.938] -- 0:00:07 879000 -- (-1213.160) (-1211.555) (-1211.633) [-1213.682] * (-1213.091) (-1212.437) [-1211.630] (-1210.680) -- 0:00:07 879500 -- (-1214.881) (-1211.447) [-1212.280] (-1212.050) * [-1212.565] (-1211.766) (-1211.129) (-1211.755) -- 0:00:07 880000 -- [-1214.778] (-1215.669) (-1213.336) (-1210.362) * (-1212.141) (-1210.153) (-1211.027) [-1214.047] -- 0:00:07 Average standard deviation of split frequencies: 0.006780 880500 -- [-1210.119] (-1212.720) (-1218.162) (-1212.050) * (-1212.525) (-1213.668) [-1212.498] (-1211.219) -- 0:00:07 881000 -- (-1215.009) (-1212.915) (-1212.602) [-1212.153] * [-1210.603] (-1213.198) (-1211.104) (-1210.653) -- 0:00:07 881500 -- (-1212.816) [-1213.045] (-1212.705) (-1211.185) * (-1210.917) (-1211.998) (-1218.989) [-1212.331] -- 0:00:07 882000 -- (-1212.883) (-1210.529) (-1215.501) [-1211.041] * (-1212.984) [-1210.948] (-1213.129) (-1213.586) -- 0:00:07 882500 -- (-1214.927) (-1210.938) [-1211.954] (-1210.936) * (-1211.322) [-1210.099] (-1217.708) (-1214.624) -- 0:00:07 883000 -- (-1213.593) (-1211.428) [-1212.288] (-1211.622) * [-1213.104] (-1211.163) (-1214.372) (-1211.542) -- 0:00:07 883500 -- [-1215.050] (-1210.926) (-1214.100) (-1213.628) * (-1210.702) [-1210.478] (-1212.728) (-1212.914) -- 0:00:07 884000 -- (-1211.040) [-1210.137] (-1212.004) (-1210.895) * (-1212.604) (-1213.991) (-1211.169) [-1211.056] -- 0:00:07 884500 -- (-1213.184) (-1210.137) (-1211.746) [-1211.387] * (-1213.225) (-1213.694) [-1211.120] (-1212.970) -- 0:00:07 885000 -- (-1214.216) (-1212.425) [-1211.314] (-1216.846) * (-1213.515) [-1210.439] (-1214.555) (-1212.182) -- 0:00:07 Average standard deviation of split frequencies: 0.006598 885500 -- [-1210.381] (-1213.215) (-1212.643) (-1217.315) * (-1211.019) (-1213.533) [-1212.789] (-1212.619) -- 0:00:07 886000 -- (-1209.822) [-1210.692] (-1215.983) (-1212.357) * (-1214.114) (-1213.494) (-1214.440) [-1212.178] -- 0:00:07 886500 -- (-1211.337) (-1214.705) [-1212.145] (-1212.601) * [-1217.184] (-1212.137) (-1213.027) (-1214.305) -- 0:00:07 887000 -- (-1210.642) (-1212.471) (-1211.759) [-1212.224] * [-1211.795] (-1213.157) (-1210.886) (-1211.018) -- 0:00:07 887500 -- [-1211.347] (-1214.022) (-1216.645) (-1220.149) * (-1211.346) (-1216.491) [-1212.279] (-1213.373) -- 0:00:07 888000 -- (-1213.113) [-1213.791] (-1219.870) (-1210.752) * [-1212.920] (-1211.700) (-1210.774) (-1212.324) -- 0:00:07 888500 -- [-1210.429] (-1213.492) (-1214.571) (-1211.354) * [-1211.954] (-1211.559) (-1218.728) (-1212.207) -- 0:00:07 889000 -- (-1212.106) (-1211.084) (-1212.338) [-1213.504] * (-1214.197) (-1209.920) (-1222.281) [-1212.004] -- 0:00:07 889500 -- (-1212.437) (-1212.374) (-1211.126) [-1211.072] * (-1210.784) (-1211.796) [-1211.124] (-1213.826) -- 0:00:07 890000 -- (-1211.908) (-1214.123) (-1210.932) [-1210.659] * (-1211.378) [-1210.400] (-1210.412) (-1214.289) -- 0:00:07 Average standard deviation of split frequencies: 0.006563 890500 -- (-1216.750) (-1210.638) (-1212.832) [-1211.888] * [-1211.697] (-1212.280) (-1210.719) (-1211.782) -- 0:00:07 891000 -- [-1212.993] (-1211.389) (-1211.310) (-1211.788) * [-1212.050] (-1212.352) (-1212.280) (-1212.497) -- 0:00:06 891500 -- [-1213.520] (-1213.143) (-1215.302) (-1212.798) * (-1211.957) [-1212.352] (-1214.572) (-1215.057) -- 0:00:06 892000 -- [-1213.042] (-1212.219) (-1212.738) (-1213.865) * (-1212.111) (-1210.550) (-1215.921) [-1215.730] -- 0:00:06 892500 -- (-1216.976) (-1212.638) (-1213.377) [-1214.273] * (-1212.633) [-1210.533] (-1214.746) (-1211.405) -- 0:00:06 893000 -- (-1211.349) (-1210.487) (-1217.066) [-1215.075] * [-1212.755] (-1210.106) (-1215.373) (-1211.191) -- 0:00:06 893500 -- (-1211.621) (-1210.917) [-1213.408] (-1213.201) * (-1211.134) (-1212.002) [-1210.832] (-1211.174) -- 0:00:06 894000 -- (-1213.376) [-1210.973] (-1214.774) (-1211.206) * (-1211.232) (-1212.083) [-1212.217] (-1211.099) -- 0:00:06 894500 -- [-1213.059] (-1210.258) (-1212.569) (-1210.988) * (-1213.812) (-1211.070) (-1213.836) [-1211.289] -- 0:00:06 895000 -- (-1212.924) (-1210.247) (-1211.576) [-1213.120] * [-1210.809] (-1212.514) (-1211.830) (-1210.651) -- 0:00:06 Average standard deviation of split frequencies: 0.006840 895500 -- [-1213.917] (-1217.277) (-1211.882) (-1213.051) * (-1211.489) (-1213.260) (-1211.522) [-1213.289] -- 0:00:06 896000 -- [-1212.905] (-1210.022) (-1211.992) (-1211.947) * (-1211.208) (-1212.040) (-1211.019) [-1213.190] -- 0:00:06 896500 -- (-1212.162) (-1210.582) (-1213.484) [-1212.224] * [-1211.875] (-1211.159) (-1213.456) (-1211.434) -- 0:00:06 897000 -- [-1213.951] (-1210.671) (-1211.184) (-1215.196) * [-1210.816] (-1210.757) (-1213.819) (-1213.589) -- 0:00:06 897500 -- [-1210.988] (-1215.462) (-1214.777) (-1219.474) * (-1212.936) [-1211.099] (-1211.683) (-1217.140) -- 0:00:06 898000 -- (-1211.122) [-1214.580] (-1211.065) (-1212.326) * [-1211.379] (-1215.450) (-1214.067) (-1212.587) -- 0:00:06 898500 -- [-1211.373] (-1212.587) (-1214.285) (-1215.884) * (-1210.566) (-1212.479) (-1217.262) [-1212.357] -- 0:00:06 899000 -- [-1211.784] (-1212.357) (-1212.213) (-1210.724) * [-1211.191] (-1213.301) (-1213.241) (-1214.328) -- 0:00:06 899500 -- (-1210.108) (-1210.530) [-1211.043] (-1211.156) * (-1213.719) (-1214.061) [-1213.282] (-1215.378) -- 0:00:06 900000 -- (-1210.266) [-1211.382] (-1210.899) (-1211.903) * (-1212.063) [-1212.036] (-1215.072) (-1212.771) -- 0:00:06 Average standard deviation of split frequencies: 0.007048 900500 -- (-1213.639) (-1211.505) [-1211.066] (-1213.023) * [-1211.877] (-1210.044) (-1216.041) (-1212.135) -- 0:00:06 901000 -- [-1211.905] (-1213.117) (-1213.643) (-1213.066) * (-1212.541) [-1210.405] (-1214.185) (-1216.066) -- 0:00:06 901500 -- (-1211.314) (-1211.851) [-1211.834] (-1214.750) * (-1214.342) (-1210.886) [-1210.874] (-1211.364) -- 0:00:06 902000 -- (-1212.755) [-1210.868] (-1212.406) (-1211.994) * (-1212.945) (-1210.552) [-1211.015] (-1211.273) -- 0:00:06 902500 -- (-1213.202) (-1213.042) (-1213.120) [-1214.026] * (-1212.347) (-1212.724) [-1212.949] (-1211.296) -- 0:00:06 903000 -- [-1210.255] (-1211.126) (-1215.021) (-1216.109) * (-1214.881) (-1210.673) (-1214.515) [-1211.602] -- 0:00:06 903500 -- [-1210.413] (-1217.576) (-1212.361) (-1214.000) * (-1211.835) (-1218.097) (-1214.185) [-1211.059] -- 0:00:06 904000 -- (-1211.921) [-1213.365] (-1213.896) (-1211.787) * (-1210.657) (-1214.554) [-1212.706] (-1211.792) -- 0:00:06 904500 -- (-1213.832) [-1211.705] (-1214.676) (-1210.107) * (-1214.058) (-1212.545) (-1212.515) [-1210.588] -- 0:00:06 905000 -- [-1212.136] (-1214.773) (-1212.026) (-1210.763) * (-1214.061) (-1213.779) (-1211.424) [-1211.250] -- 0:00:06 Average standard deviation of split frequencies: 0.007423 905500 -- (-1212.266) (-1213.520) [-1213.957] (-1212.277) * (-1213.755) (-1209.894) [-1212.238] (-1211.067) -- 0:00:06 906000 -- (-1220.038) (-1213.065) (-1210.566) [-1210.934] * (-1213.097) (-1212.651) (-1215.926) [-1211.748] -- 0:00:06 906500 -- (-1214.946) (-1212.141) (-1213.973) [-1211.464] * (-1216.056) (-1213.459) [-1210.851] (-1213.889) -- 0:00:05 907000 -- (-1215.570) [-1213.053] (-1216.091) (-1211.471) * (-1210.814) (-1212.989) (-1210.819) [-1213.476] -- 0:00:05 907500 -- [-1213.839] (-1212.107) (-1215.206) (-1211.251) * [-1211.959] (-1212.048) (-1213.241) (-1215.076) -- 0:00:05 908000 -- [-1212.379] (-1214.948) (-1212.607) (-1211.202) * (-1216.796) [-1211.767] (-1211.813) (-1212.269) -- 0:00:05 908500 -- (-1213.916) [-1215.865] (-1212.440) (-1211.603) * (-1211.455) [-1212.275] (-1213.409) (-1210.720) -- 0:00:05 909000 -- (-1218.493) [-1213.968] (-1217.257) (-1213.333) * (-1210.933) [-1211.735] (-1212.244) (-1213.605) -- 0:00:05 909500 -- (-1214.829) [-1213.153] (-1212.033) (-1212.141) * (-1209.978) (-1213.260) (-1210.747) [-1212.512] -- 0:00:05 910000 -- (-1211.723) (-1210.006) (-1211.008) [-1211.887] * (-1210.184) (-1212.173) [-1215.754] (-1213.312) -- 0:00:05 Average standard deviation of split frequencies: 0.007558 910500 -- (-1210.253) [-1210.861] (-1210.932) (-1211.989) * (-1210.024) [-1212.588] (-1212.667) (-1215.463) -- 0:00:05 911000 -- (-1211.540) (-1212.838) (-1210.490) [-1211.926] * (-1211.611) (-1213.220) (-1214.269) [-1215.457] -- 0:00:05 911500 -- [-1211.622] (-1212.552) (-1211.982) (-1212.321) * [-1211.399] (-1211.126) (-1213.938) (-1218.253) -- 0:00:05 912000 -- (-1211.292) (-1212.258) [-1214.120] (-1212.998) * (-1211.055) (-1213.813) [-1210.250] (-1213.351) -- 0:00:05 912500 -- [-1211.332] (-1212.508) (-1213.128) (-1212.323) * (-1211.118) (-1210.747) [-1210.242] (-1211.296) -- 0:00:05 913000 -- (-1211.945) (-1210.213) [-1211.468] (-1213.739) * (-1212.693) (-1210.146) [-1210.100] (-1214.305) -- 0:00:05 913500 -- (-1213.853) [-1211.801] (-1212.869) (-1213.573) * [-1210.886] (-1211.618) (-1211.078) (-1215.288) -- 0:00:05 914000 -- (-1213.450) (-1212.687) (-1213.227) [-1211.777] * [-1210.474] (-1210.325) (-1211.097) (-1216.222) -- 0:00:05 914500 -- (-1211.190) (-1213.237) [-1215.240] (-1210.001) * (-1211.871) (-1210.885) (-1211.818) [-1214.804] -- 0:00:05 915000 -- (-1211.807) (-1214.706) (-1211.897) [-1213.586] * [-1210.619] (-1209.986) (-1212.081) (-1215.537) -- 0:00:05 Average standard deviation of split frequencies: 0.007891 915500 -- (-1213.847) (-1215.262) (-1210.994) [-1210.064] * (-1210.581) (-1211.422) [-1211.592] (-1211.685) -- 0:00:05 916000 -- (-1211.449) (-1214.856) (-1210.780) [-1213.202] * [-1215.964] (-1210.430) (-1210.357) (-1210.829) -- 0:00:05 916500 -- [-1212.165] (-1211.467) (-1213.218) (-1212.905) * (-1211.447) (-1211.268) (-1210.893) [-1212.622] -- 0:00:05 917000 -- (-1210.244) [-1215.415] (-1212.479) (-1212.854) * (-1212.651) (-1211.777) [-1210.284] (-1211.762) -- 0:00:05 917500 -- (-1211.329) [-1212.517] (-1212.836) (-1211.322) * (-1210.090) (-1212.878) [-1211.623] (-1212.142) -- 0:00:05 918000 -- (-1214.963) [-1211.835] (-1214.410) (-1210.505) * (-1210.398) (-1211.382) [-1211.481] (-1212.859) -- 0:00:05 918500 -- (-1212.463) [-1212.322] (-1210.919) (-1210.753) * [-1212.424] (-1211.793) (-1210.078) (-1213.029) -- 0:00:05 919000 -- [-1212.817] (-1212.595) (-1213.280) (-1213.761) * (-1218.409) (-1211.001) [-1210.440] (-1212.295) -- 0:00:05 919500 -- [-1216.404] (-1219.205) (-1214.249) (-1212.480) * [-1212.967] (-1212.076) (-1211.405) (-1214.477) -- 0:00:05 920000 -- [-1211.248] (-1217.580) (-1211.821) (-1212.352) * (-1210.830) (-1213.013) [-1213.215] (-1214.399) -- 0:00:05 Average standard deviation of split frequencies: 0.007885 920500 -- (-1210.133) (-1215.461) (-1212.261) [-1211.468] * (-1210.655) (-1211.902) [-1210.425] (-1211.199) -- 0:00:05 921000 -- (-1210.642) [-1211.779] (-1214.101) (-1212.814) * (-1211.583) [-1210.389] (-1209.976) (-1210.816) -- 0:00:05 921500 -- (-1213.396) (-1211.680) (-1213.505) [-1214.204] * [-1212.938] (-1209.970) (-1213.099) (-1211.048) -- 0:00:05 922000 -- (-1213.765) [-1212.968] (-1210.776) (-1212.839) * (-1214.123) (-1211.704) (-1210.777) [-1210.953] -- 0:00:04 922500 -- [-1212.834] (-1211.784) (-1213.287) (-1213.188) * [-1215.867] (-1211.546) (-1210.716) (-1211.398) -- 0:00:04 923000 -- (-1213.769) [-1210.207] (-1216.524) (-1212.129) * (-1210.481) [-1213.108] (-1211.889) (-1213.364) -- 0:00:04 923500 -- (-1213.899) [-1212.220] (-1215.058) (-1214.181) * (-1211.912) (-1211.858) [-1212.165] (-1213.525) -- 0:00:04 924000 -- [-1210.736] (-1211.468) (-1215.267) (-1212.925) * (-1211.542) (-1212.011) [-1213.149] (-1211.665) -- 0:00:04 924500 -- (-1213.134) (-1210.925) (-1214.607) [-1210.621] * (-1215.340) [-1212.824] (-1211.329) (-1211.708) -- 0:00:04 925000 -- [-1215.571] (-1210.299) (-1211.651) (-1213.661) * (-1213.024) [-1212.790] (-1210.425) (-1210.990) -- 0:00:04 Average standard deviation of split frequencies: 0.008077 925500 -- (-1211.224) (-1210.454) (-1215.272) [-1212.341] * (-1211.848) [-1212.956] (-1211.156) (-1212.200) -- 0:00:04 926000 -- (-1212.091) (-1211.533) [-1211.851] (-1212.079) * (-1212.321) (-1212.311) [-1211.574] (-1212.589) -- 0:00:04 926500 -- [-1210.317] (-1211.168) (-1213.944) (-1212.328) * (-1213.641) [-1213.578] (-1211.322) (-1214.591) -- 0:00:04 927000 -- (-1214.877) (-1210.409) (-1213.206) [-1212.027] * (-1212.607) (-1210.601) (-1212.714) [-1212.208] -- 0:00:04 927500 -- (-1212.908) (-1210.723) [-1211.368] (-1210.973) * (-1213.152) (-1212.101) (-1213.410) [-1211.438] -- 0:00:04 928000 -- [-1215.498] (-1212.539) (-1210.075) (-1211.349) * [-1212.476] (-1217.476) (-1214.654) (-1213.137) -- 0:00:04 928500 -- (-1211.185) (-1212.344) [-1209.930] (-1212.032) * (-1219.347) [-1212.288] (-1215.385) (-1212.806) -- 0:00:04 929000 -- (-1212.046) (-1219.729) (-1209.863) [-1216.020] * [-1219.028] (-1215.822) (-1214.090) (-1212.234) -- 0:00:04 929500 -- (-1213.136) (-1216.812) [-1212.322] (-1212.957) * (-1218.966) (-1213.601) (-1210.897) [-1211.003] -- 0:00:04 930000 -- [-1212.499] (-1219.002) (-1210.080) (-1213.822) * (-1216.789) [-1211.337] (-1212.634) (-1210.991) -- 0:00:04 Average standard deviation of split frequencies: 0.008881 930500 -- (-1212.240) (-1213.497) [-1210.691] (-1212.979) * (-1211.868) [-1210.245] (-1212.617) (-1213.725) -- 0:00:04 931000 -- (-1212.581) (-1215.906) [-1210.489] (-1213.749) * [-1210.963] (-1210.133) (-1211.458) (-1213.073) -- 0:00:04 931500 -- (-1210.612) [-1212.862] (-1211.503) (-1214.663) * (-1211.913) (-1214.709) [-1210.748] (-1212.994) -- 0:00:04 932000 -- [-1216.603] (-1212.453) (-1212.339) (-1212.617) * (-1215.301) (-1212.497) (-1212.424) [-1212.844] -- 0:00:04 932500 -- (-1213.364) (-1211.729) [-1212.336] (-1212.226) * [-1210.327] (-1213.052) (-1211.812) (-1214.231) -- 0:00:04 933000 -- (-1211.245) [-1213.361] (-1212.249) (-1212.978) * (-1211.660) (-1215.540) [-1211.113] (-1214.333) -- 0:00:04 933500 -- [-1211.216] (-1212.089) (-1211.653) (-1213.461) * (-1212.113) [-1213.873] (-1211.284) (-1210.141) -- 0:00:04 934000 -- [-1210.689] (-1211.614) (-1210.523) (-1214.962) * [-1211.428] (-1211.854) (-1210.889) (-1211.689) -- 0:00:04 934500 -- (-1211.418) (-1213.952) [-1210.015] (-1213.883) * (-1211.961) [-1211.054] (-1211.118) (-1211.340) -- 0:00:04 935000 -- (-1210.389) (-1211.521) [-1210.970] (-1212.019) * [-1211.534] (-1210.763) (-1215.599) (-1214.403) -- 0:00:04 Average standard deviation of split frequencies: 0.009368 935500 -- (-1210.863) (-1212.929) [-1211.712] (-1214.829) * [-1212.662] (-1211.252) (-1213.765) (-1212.115) -- 0:00:04 936000 -- (-1211.849) (-1212.392) (-1211.120) [-1213.501] * [-1215.329] (-1211.155) (-1211.849) (-1211.722) -- 0:00:04 936500 -- (-1211.281) [-1210.428] (-1213.146) (-1210.286) * (-1212.355) (-1211.551) (-1211.182) [-1210.126] -- 0:00:04 937000 -- [-1211.619] (-1215.237) (-1210.617) (-1213.203) * (-1212.461) (-1218.498) (-1211.103) [-1210.231] -- 0:00:04 937500 -- (-1210.660) (-1213.873) [-1214.556] (-1212.630) * (-1214.643) (-1210.643) (-1212.576) [-1211.918] -- 0:00:04 938000 -- (-1213.637) (-1214.479) [-1212.176] (-1212.493) * [-1211.709] (-1215.192) (-1217.976) (-1215.286) -- 0:00:03 938500 -- (-1214.598) (-1213.535) (-1212.149) [-1211.614] * [-1211.796] (-1216.477) (-1212.110) (-1212.826) -- 0:00:03 939000 -- (-1210.337) (-1211.492) [-1212.422] (-1211.185) * (-1212.635) [-1210.280] (-1210.678) (-1211.696) -- 0:00:03 939500 -- (-1210.907) [-1210.331] (-1214.784) (-1210.245) * (-1213.419) (-1212.674) [-1212.072] (-1211.018) -- 0:00:03 940000 -- (-1211.064) (-1212.742) (-1212.627) [-1210.629] * (-1211.578) (-1212.184) (-1211.443) [-1211.018] -- 0:00:03 Average standard deviation of split frequencies: 0.009321 940500 -- [-1214.156] (-1211.377) (-1213.807) (-1213.511) * (-1210.508) [-1210.331] (-1212.800) (-1211.929) -- 0:00:03 941000 -- [-1212.808] (-1214.044) (-1212.873) (-1213.671) * (-1211.844) (-1222.976) (-1213.376) [-1214.325] -- 0:00:03 941500 -- (-1212.051) [-1214.227] (-1214.162) (-1211.130) * (-1210.008) [-1214.729] (-1215.160) (-1211.359) -- 0:00:03 942000 -- [-1210.418] (-1213.308) (-1212.507) (-1213.172) * (-1210.829) (-1210.931) (-1211.964) [-1212.935] -- 0:00:03 942500 -- [-1210.788] (-1211.252) (-1210.992) (-1210.848) * (-1210.916) [-1214.366] (-1212.381) (-1213.655) -- 0:00:03 943000 -- (-1213.847) (-1214.023) (-1211.804) [-1211.483] * (-1210.736) (-1216.160) (-1210.884) [-1214.295] -- 0:00:03 943500 -- (-1212.988) (-1213.902) [-1211.839] (-1213.523) * (-1211.501) (-1211.797) [-1212.551] (-1211.910) -- 0:00:03 944000 -- (-1213.282) (-1211.129) [-1210.273] (-1214.085) * (-1211.122) [-1214.121] (-1212.704) (-1211.943) -- 0:00:03 944500 -- (-1213.607) (-1214.380) (-1211.619) [-1212.342] * [-1213.010] (-1212.562) (-1212.774) (-1211.451) -- 0:00:03 945000 -- (-1213.641) (-1212.359) (-1212.125) [-1212.310] * (-1218.150) (-1212.981) [-1210.395] (-1213.410) -- 0:00:03 Average standard deviation of split frequencies: 0.009767 945500 -- (-1212.338) (-1212.123) (-1211.978) [-1211.958] * (-1212.385) (-1210.283) (-1211.291) [-1212.087] -- 0:00:03 946000 -- (-1211.489) (-1214.129) (-1212.064) [-1210.645] * [-1211.782] (-1210.949) (-1212.066) (-1212.861) -- 0:00:03 946500 -- [-1210.838] (-1212.397) (-1211.331) (-1211.076) * [-1213.021] (-1211.674) (-1212.486) (-1210.895) -- 0:00:03 947000 -- (-1212.805) (-1210.518) [-1214.840] (-1214.869) * (-1211.574) [-1210.561] (-1214.152) (-1211.373) -- 0:00:03 947500 -- [-1211.445] (-1210.851) (-1212.764) (-1212.465) * (-1212.358) (-1212.620) (-1213.423) [-1215.055] -- 0:00:03 948000 -- (-1213.213) (-1212.662) (-1211.478) [-1213.099] * (-1211.024) [-1213.176] (-1212.225) (-1212.836) -- 0:00:03 948500 -- (-1215.390) (-1215.080) (-1212.588) [-1211.293] * (-1211.135) [-1214.178] (-1213.105) (-1213.035) -- 0:00:03 949000 -- (-1215.374) (-1215.780) (-1210.600) [-1211.889] * (-1211.393) (-1211.633) (-1210.690) [-1215.130] -- 0:00:03 949500 -- (-1215.904) (-1218.194) [-1210.568] (-1212.755) * (-1211.018) [-1211.935] (-1210.489) (-1210.432) -- 0:00:03 950000 -- (-1213.749) (-1214.281) [-1211.205] (-1210.108) * [-1210.884] (-1211.115) (-1211.790) (-1210.924) -- 0:00:03 Average standard deviation of split frequencies: 0.010116 950500 -- (-1210.612) [-1215.948] (-1213.692) (-1210.481) * (-1211.678) (-1213.952) [-1211.576] (-1214.173) -- 0:00:03 951000 -- (-1213.871) (-1211.477) (-1218.809) [-1212.129] * (-1212.708) (-1213.613) [-1211.867] (-1212.033) -- 0:00:03 951500 -- (-1216.041) [-1210.233] (-1214.368) (-1212.379) * (-1211.320) (-1215.258) [-1210.544] (-1212.167) -- 0:00:03 952000 -- (-1212.881) [-1214.029] (-1215.097) (-1212.063) * [-1213.054] (-1214.965) (-1210.867) (-1213.480) -- 0:00:03 952500 -- (-1213.452) (-1212.791) [-1210.585] (-1213.282) * (-1215.944) [-1212.480] (-1216.167) (-1213.230) -- 0:00:02 953000 -- [-1212.047] (-1211.584) (-1211.175) (-1211.948) * (-1211.356) [-1212.002] (-1217.046) (-1211.553) -- 0:00:03 953500 -- (-1214.157) (-1211.000) (-1213.223) [-1215.506] * [-1213.214] (-1214.256) (-1212.731) (-1214.982) -- 0:00:02 954000 -- (-1212.209) (-1210.966) [-1212.843] (-1213.849) * [-1211.665] (-1211.367) (-1213.095) (-1209.986) -- 0:00:02 954500 -- (-1210.147) [-1210.876] (-1211.623) (-1212.344) * (-1210.981) [-1214.907] (-1214.692) (-1211.420) -- 0:00:02 955000 -- (-1210.145) [-1210.050] (-1212.265) (-1211.609) * (-1212.956) (-1213.423) (-1211.719) [-1211.339] -- 0:00:02 Average standard deviation of split frequencies: 0.009862 955500 -- [-1210.218] (-1211.414) (-1211.563) (-1215.034) * (-1214.285) (-1214.282) (-1210.637) [-1212.777] -- 0:00:02 956000 -- [-1211.245] (-1216.142) (-1214.532) (-1212.490) * (-1214.177) [-1214.782] (-1214.245) (-1211.522) -- 0:00:02 956500 -- (-1211.491) (-1215.189) [-1213.596] (-1214.576) * (-1220.389) (-1214.179) (-1210.844) [-1210.239] -- 0:00:02 957000 -- (-1212.716) [-1212.408] (-1211.118) (-1215.259) * (-1218.305) [-1210.924] (-1211.015) (-1211.151) -- 0:00:02 957500 -- (-1210.530) [-1214.696] (-1212.986) (-1212.495) * [-1213.164] (-1213.612) (-1213.845) (-1211.094) -- 0:00:02 958000 -- [-1210.380] (-1212.302) (-1211.098) (-1212.762) * (-1211.241) (-1211.837) [-1211.674] (-1216.303) -- 0:00:02 958500 -- (-1216.231) [-1214.090] (-1216.057) (-1212.099) * (-1210.887) [-1211.006] (-1217.319) (-1212.240) -- 0:00:02 959000 -- (-1217.981) (-1215.046) (-1210.955) [-1210.854] * (-1210.885) [-1215.478] (-1215.204) (-1211.852) -- 0:00:02 959500 -- (-1218.399) (-1215.097) [-1212.285] (-1214.893) * (-1210.209) (-1219.208) [-1211.042] (-1214.294) -- 0:00:02 960000 -- (-1214.334) (-1212.278) [-1211.324] (-1214.066) * (-1215.745) (-1211.130) (-1218.548) [-1210.967] -- 0:00:02 Average standard deviation of split frequencies: 0.009945 960500 -- (-1214.492) (-1214.209) (-1211.063) [-1212.274] * [-1210.919] (-1219.333) (-1210.969) (-1210.695) -- 0:00:02 961000 -- (-1215.441) (-1215.252) (-1212.063) [-1212.028] * (-1209.836) (-1211.567) [-1210.698] (-1214.938) -- 0:00:02 961500 -- (-1212.849) (-1212.454) [-1210.761] (-1214.816) * (-1212.934) (-1212.914) [-1212.623] (-1211.486) -- 0:00:02 962000 -- (-1217.332) (-1213.091) [-1211.599] (-1210.802) * (-1211.361) [-1212.897] (-1219.551) (-1214.076) -- 0:00:02 962500 -- (-1217.220) (-1216.301) (-1210.576) [-1210.106] * (-1213.876) (-1212.447) (-1215.167) [-1210.930] -- 0:00:02 963000 -- [-1214.413] (-1217.562) (-1213.887) (-1213.871) * (-1211.370) (-1211.208) [-1213.792] (-1210.501) -- 0:00:02 963500 -- (-1212.079) [-1211.997] (-1214.087) (-1210.947) * (-1213.802) (-1211.741) [-1210.650] (-1213.669) -- 0:00:02 964000 -- (-1215.266) (-1212.265) (-1213.352) [-1211.512] * (-1214.282) (-1212.407) [-1213.776] (-1211.864) -- 0:00:02 964500 -- [-1214.417] (-1213.080) (-1215.076) (-1211.316) * (-1211.861) [-1212.292] (-1210.976) (-1215.833) -- 0:00:02 965000 -- [-1212.637] (-1212.498) (-1213.405) (-1210.815) * (-1211.642) [-1214.645] (-1212.559) (-1211.216) -- 0:00:02 Average standard deviation of split frequencies: 0.009760 965500 -- [-1211.697] (-1212.487) (-1210.717) (-1211.601) * (-1211.574) (-1216.914) (-1212.331) [-1212.048] -- 0:00:02 966000 -- [-1211.417] (-1212.106) (-1214.714) (-1213.685) * (-1212.486) [-1214.357] (-1215.096) (-1215.724) -- 0:00:02 966500 -- (-1214.311) [-1210.632] (-1214.493) (-1211.803) * (-1211.929) [-1212.994] (-1213.202) (-1217.751) -- 0:00:02 967000 -- (-1212.915) (-1212.355) [-1212.372] (-1213.731) * (-1212.086) (-1212.900) (-1212.756) [-1213.236] -- 0:00:02 967500 -- (-1212.046) (-1212.621) [-1212.901] (-1212.593) * (-1211.231) (-1213.243) [-1212.968] (-1212.427) -- 0:00:02 968000 -- [-1211.633] (-1212.264) (-1215.445) (-1213.088) * (-1211.052) [-1211.344] (-1211.520) (-1210.952) -- 0:00:02 968500 -- (-1213.448) [-1212.920] (-1211.902) (-1211.319) * (-1211.067) [-1210.927] (-1212.262) (-1211.448) -- 0:00:01 969000 -- (-1215.666) (-1210.790) (-1211.909) [-1215.028] * (-1211.179) [-1215.578] (-1213.022) (-1212.820) -- 0:00:01 969500 -- (-1212.206) (-1210.810) (-1211.264) [-1211.968] * [-1211.365] (-1212.161) (-1212.381) (-1213.907) -- 0:00:01 970000 -- [-1210.225] (-1214.895) (-1212.064) (-1215.385) * (-1210.838) (-1212.943) [-1213.203] (-1210.959) -- 0:00:01 Average standard deviation of split frequencies: 0.009551 970500 -- (-1211.904) (-1211.193) [-1214.354] (-1212.277) * (-1211.432) (-1215.225) (-1214.190) [-1213.844] -- 0:00:01 971000 -- [-1213.934] (-1212.505) (-1213.073) (-1212.993) * [-1214.790] (-1212.263) (-1211.606) (-1213.850) -- 0:00:01 971500 -- (-1213.733) (-1211.227) (-1219.551) [-1215.165] * (-1212.424) [-1210.932] (-1212.960) (-1216.843) -- 0:00:01 972000 -- (-1215.492) (-1210.651) (-1211.813) [-1213.687] * (-1211.419) [-1214.877] (-1212.633) (-1211.855) -- 0:00:01 972500 -- (-1213.948) (-1218.612) [-1214.185] (-1214.242) * [-1211.352] (-1211.991) (-1212.643) (-1210.523) -- 0:00:01 973000 -- (-1211.614) [-1212.752] (-1211.836) (-1212.696) * (-1212.964) (-1211.740) (-1211.996) [-1210.857] -- 0:00:01 973500 -- [-1211.540] (-1212.298) (-1216.564) (-1213.959) * (-1211.421) (-1213.758) [-1212.766] (-1211.644) -- 0:00:01 974000 -- (-1210.252) (-1212.975) (-1212.915) [-1210.432] * [-1212.251] (-1212.795) (-1217.068) (-1214.081) -- 0:00:01 974500 -- (-1211.861) [-1213.656] (-1211.179) (-1210.929) * [-1214.914] (-1212.763) (-1212.420) (-1212.481) -- 0:00:01 975000 -- (-1214.995) (-1210.468) (-1211.011) [-1213.820] * (-1212.399) [-1211.123] (-1213.456) (-1213.031) -- 0:00:01 Average standard deviation of split frequencies: 0.009435 975500 -- (-1213.657) [-1210.980] (-1210.964) (-1211.477) * (-1211.567) (-1211.558) (-1210.491) [-1210.712] -- 0:00:01 976000 -- (-1212.503) [-1212.102] (-1211.421) (-1213.033) * [-1214.515] (-1213.957) (-1210.445) (-1212.719) -- 0:00:01 976500 -- [-1211.492] (-1213.003) (-1211.531) (-1211.851) * [-1212.701] (-1210.945) (-1212.781) (-1212.833) -- 0:00:01 977000 -- (-1214.808) (-1213.998) [-1210.170] (-1210.288) * (-1216.741) (-1210.564) (-1210.989) [-1211.650] -- 0:00:01 977500 -- (-1215.881) (-1213.081) [-1213.717] (-1210.709) * [-1211.260] (-1213.771) (-1210.537) (-1212.271) -- 0:00:01 978000 -- [-1213.033] (-1216.488) (-1213.278) (-1212.542) * (-1212.198) [-1210.486] (-1210.537) (-1213.519) -- 0:00:01 978500 -- [-1210.784] (-1211.709) (-1215.223) (-1211.444) * (-1213.467) [-1211.697] (-1212.749) (-1213.923) -- 0:00:01 979000 -- (-1212.520) (-1211.388) (-1213.153) [-1210.223] * (-1213.526) (-1210.460) (-1212.015) [-1211.608] -- 0:00:01 979500 -- (-1212.492) (-1213.698) [-1210.867] (-1210.490) * [-1212.467] (-1211.127) (-1212.489) (-1211.011) -- 0:00:01 980000 -- (-1213.072) (-1212.797) [-1211.218] (-1210.384) * (-1214.415) [-1211.219] (-1212.004) (-1211.068) -- 0:00:01 Average standard deviation of split frequencies: 0.009229 980500 -- [-1212.984] (-1214.453) (-1212.802) (-1210.463) * (-1215.254) (-1212.587) (-1210.374) [-1212.337] -- 0:00:01 981000 -- [-1213.615] (-1213.409) (-1215.371) (-1211.241) * (-1212.067) (-1214.036) (-1210.260) [-1211.786] -- 0:00:01 981500 -- (-1213.970) (-1212.988) [-1212.889] (-1213.054) * [-1213.715] (-1216.199) (-1214.516) (-1212.878) -- 0:00:01 982000 -- (-1215.328) (-1210.513) (-1214.137) [-1209.939] * (-1212.388) [-1213.248] (-1215.877) (-1212.634) -- 0:00:01 982500 -- [-1213.243] (-1211.913) (-1210.843) (-1210.831) * (-1210.879) (-1215.528) [-1210.602] (-1213.310) -- 0:00:01 983000 -- [-1211.880] (-1214.612) (-1210.642) (-1214.077) * [-1212.466] (-1215.275) (-1215.496) (-1214.232) -- 0:00:01 983500 -- (-1212.539) (-1213.321) [-1211.075] (-1212.170) * [-1210.567] (-1214.223) (-1213.720) (-1213.306) -- 0:00:01 984000 -- [-1215.079] (-1212.057) (-1218.108) (-1212.069) * (-1210.560) [-1212.333] (-1216.320) (-1213.057) -- 0:00:01 984500 -- (-1210.494) (-1212.008) (-1210.540) [-1213.194] * [-1210.089] (-1210.070) (-1212.932) (-1212.960) -- 0:00:00 985000 -- (-1210.986) [-1213.015] (-1210.866) (-1210.578) * [-1211.047] (-1211.476) (-1216.500) (-1211.547) -- 0:00:00 Average standard deviation of split frequencies: 0.009020 985500 -- (-1211.721) (-1214.840) (-1211.058) [-1212.650] * (-1212.944) (-1210.874) (-1211.801) [-1211.830] -- 0:00:00 986000 -- (-1210.407) (-1214.666) [-1211.574] (-1213.017) * [-1211.153] (-1210.582) (-1211.392) (-1212.106) -- 0:00:00 986500 -- (-1211.045) (-1211.409) [-1211.517] (-1210.740) * (-1215.236) [-1212.362] (-1213.763) (-1212.651) -- 0:00:00 987000 -- (-1211.900) (-1213.188) [-1212.428] (-1211.563) * (-1215.829) (-1215.432) [-1214.037] (-1211.344) -- 0:00:00 987500 -- (-1212.713) (-1217.934) [-1212.643] (-1211.350) * (-1210.926) (-1210.177) [-1211.579] (-1211.146) -- 0:00:00 988000 -- (-1211.708) (-1215.421) (-1211.226) [-1211.590] * [-1213.191] (-1212.943) (-1213.163) (-1210.319) -- 0:00:00 988500 -- (-1210.651) [-1214.534] (-1213.746) (-1211.133) * (-1210.675) (-1214.011) (-1212.709) [-1211.295] -- 0:00:00 989000 -- (-1210.322) (-1212.604) (-1214.059) [-1211.590] * (-1210.675) [-1212.455] (-1211.382) (-1212.402) -- 0:00:00 989500 -- [-1210.783] (-1210.425) (-1211.796) (-1212.701) * (-1212.100) (-1211.265) [-1212.048] (-1215.825) -- 0:00:00 990000 -- (-1213.272) (-1210.859) [-1212.588] (-1214.201) * (-1218.103) (-1210.500) (-1212.606) [-1212.614] -- 0:00:00 Average standard deviation of split frequencies: 0.008787 990500 -- [-1211.963] (-1212.284) (-1217.994) (-1211.567) * (-1216.669) (-1211.539) (-1211.940) [-1212.791] -- 0:00:00 991000 -- (-1210.562) (-1215.998) (-1213.173) [-1211.423] * (-1215.060) (-1212.398) (-1212.006) [-1218.976] -- 0:00:00 991500 -- (-1210.865) (-1211.689) (-1213.132) [-1213.222] * (-1214.482) [-1211.649] (-1211.040) (-1214.304) -- 0:00:00 992000 -- (-1210.033) [-1213.447] (-1215.337) (-1213.975) * [-1211.308] (-1213.819) (-1211.132) (-1214.163) -- 0:00:00 992500 -- (-1211.716) (-1211.726) [-1210.417] (-1211.046) * (-1211.323) (-1213.460) (-1210.924) [-1215.651] -- 0:00:00 993000 -- (-1214.414) (-1212.817) [-1210.091] (-1211.394) * (-1213.907) [-1213.545] (-1211.252) (-1212.629) -- 0:00:00 993500 -- (-1212.693) (-1211.005) [-1210.763] (-1210.585) * (-1210.423) [-1213.450] (-1211.958) (-1211.211) -- 0:00:00 994000 -- (-1210.161) (-1211.905) [-1211.484] (-1211.183) * [-1212.599] (-1209.784) (-1218.181) (-1211.608) -- 0:00:00 994500 -- (-1210.839) [-1212.810] (-1211.405) (-1210.783) * (-1213.338) (-1211.534) [-1216.236] (-1212.760) -- 0:00:00 995000 -- [-1211.529] (-1212.164) (-1210.382) (-1212.435) * (-1213.474) [-1215.181] (-1216.208) (-1213.170) -- 0:00:00 Average standard deviation of split frequencies: 0.008740 995500 -- (-1211.350) (-1211.450) (-1210.405) [-1211.531] * (-1211.785) (-1212.029) (-1210.770) [-1211.552] -- 0:00:00 996000 -- (-1212.038) (-1211.841) (-1211.236) [-1210.734] * (-1213.582) [-1212.279] (-1214.514) (-1212.801) -- 0:00:00 996500 -- [-1212.146] (-1210.966) (-1211.540) (-1213.073) * (-1214.044) [-1212.258] (-1211.025) (-1210.509) -- 0:00:00 997000 -- [-1210.552] (-1212.127) (-1214.094) (-1213.409) * (-1216.605) [-1212.816] (-1211.441) (-1210.822) -- 0:00:00 997500 -- [-1212.299] (-1211.351) (-1215.555) (-1211.278) * [-1216.420] (-1210.685) (-1213.059) (-1210.267) -- 0:00:00 998000 -- (-1217.149) (-1217.426) [-1214.298] (-1212.489) * [-1213.027] (-1211.644) (-1214.340) (-1210.141) -- 0:00:00 998500 -- (-1215.796) [-1213.521] (-1211.645) (-1213.174) * (-1211.722) [-1212.091] (-1214.506) (-1212.232) -- 0:00:00 999000 -- (-1212.577) [-1214.241] (-1212.504) (-1212.367) * [-1211.807] (-1213.310) (-1215.113) (-1210.162) -- 0:00:00 999500 -- (-1215.048) (-1221.131) (-1211.058) [-1214.600] * (-1210.824) (-1214.516) [-1212.196] (-1211.231) -- 0:00:00 1000000 -- (-1215.176) [-1212.356] (-1212.061) (-1210.288) * [-1210.543] (-1211.028) (-1212.588) (-1210.983) -- 0:00:00 Average standard deviation of split frequencies: 0.008417 Analysis completed in 1 mins 3 seconds Analysis used 62.44 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1209.73 Likelihood of best state for "cold" chain of run 2 was -1209.73 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.0 % ( 63 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.1 % ( 23 %) Dirichlet(Pi{all}) 27.5 % ( 24 %) Slider(Pi{all}) 78.9 % ( 58 %) Multiplier(Alpha{1,2}) 77.9 % ( 63 %) Multiplier(Alpha{3}) 18.7 % ( 20 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 85 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 24 %) Multiplier(V{all}) 97.4 % ( 95 %) Nodeslider(V{all}) 30.3 % ( 20 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.1 % ( 78 %) Dirichlet(Revmat{all}) 99.9 % ( 99 %) Slider(Revmat{all}) 26.6 % ( 30 %) Dirichlet(Pi{all}) 27.9 % ( 22 %) Slider(Pi{all}) 78.5 % ( 54 %) Multiplier(Alpha{1,2}) 77.5 % ( 59 %) Multiplier(Alpha{3}) 19.8 % ( 26 %) Slider(Pinvar{all}) 98.6 % ( 97 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 63 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 88 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 29 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.5 % ( 30 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166092 0.82 0.67 3 | 167212 166303 0.84 4 | 167044 167111 166238 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166463 0.83 0.67 3 | 166003 166993 0.84 4 | 166827 167182 166532 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1211.34 | 2 | | 22 | | 2 1 2 2 2 2 2 2 2 | | 1 1 2 1 11 1 1 1 12 2 | |11 1 221 * * 2 2 1 1 21 1222 1 | | 2 1 12 22 2 111 2 12 2 * 11| | 1 12221 1 1 1 11 1 2 2 1 1 1 1 | | 2 2 2 2 12 1 1 2 2 1211 2 2 1 | | 1 1 2 2 1 2 1 1 | | 1 2 1 2 | |2 2 2 1 22 2 | | 1 2| | | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1213.52 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1211.44 -1216.46 2 -1211.47 -1215.54 -------------------------------------- TOTAL -1211.45 -1216.10 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896248 0.087759 0.377946 1.459751 0.862123 1482.80 1491.90 1.000 r(A<->C){all} 0.184079 0.023028 0.000033 0.486986 0.145421 267.82 313.86 1.004 r(A<->G){all} 0.147723 0.016869 0.000092 0.404489 0.108498 189.89 241.59 1.000 r(A<->T){all} 0.174214 0.021944 0.000036 0.481803 0.135473 105.27 120.85 1.000 r(C<->G){all} 0.159780 0.018806 0.000156 0.428881 0.122095 302.76 320.30 1.000 r(C<->T){all} 0.169247 0.020732 0.000019 0.456496 0.129457 136.54 192.85 1.007 r(G<->T){all} 0.164958 0.020138 0.000041 0.454190 0.124621 156.57 218.29 1.000 pi(A){all} 0.152938 0.000142 0.129513 0.175763 0.152642 1166.68 1249.38 1.000 pi(C){all} 0.284618 0.000215 0.255893 0.313081 0.284273 1236.95 1241.51 1.000 pi(G){all} 0.352704 0.000251 0.322883 0.384579 0.353081 1149.02 1200.29 1.000 pi(T){all} 0.209739 0.000185 0.184120 0.235916 0.209487 1247.25 1276.22 1.000 alpha{1,2} 0.410179 0.221997 0.000168 1.365406 0.239238 994.32 1097.81 1.000 alpha{3} 0.473817 0.244902 0.000134 1.448924 0.324241 1447.07 1474.03 1.000 pinvar{all} 0.998334 0.000004 0.994680 0.999999 0.998977 939.44 1163.12 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*..*. 8 -- ..*.*. 9 -- ..*..* 10 -- .***.* 11 -- ..**** 12 -- ...*.* 13 -- .*.*.. 14 -- .*...* 15 -- ..**.. 16 -- .*.*** 17 -- .**... 18 -- .**.** 19 -- ....** 20 -- .****. 21 -- ...**. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 457 0.152232 0.015546 0.141239 0.163225 2 8 450 0.149900 0.015075 0.139241 0.160560 2 9 445 0.148235 0.011777 0.139907 0.156562 2 10 442 0.147235 0.006595 0.142572 0.151899 2 11 439 0.146236 0.008951 0.139907 0.152565 2 12 437 0.145570 0.003298 0.143238 0.147901 2 13 434 0.144570 0.022612 0.128581 0.160560 2 14 434 0.144570 0.005653 0.140573 0.148568 2 15 430 0.143238 0.005653 0.139241 0.147235 2 16 428 0.142572 0.009422 0.135909 0.149234 2 17 415 0.138241 0.002355 0.136576 0.139907 2 18 412 0.137242 0.002827 0.135243 0.139241 2 19 412 0.137242 0.005653 0.133245 0.141239 2 20 407 0.135576 0.008009 0.129913 0.141239 2 21 396 0.131912 0.002827 0.129913 0.133911 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.099835 0.009497 0.000003 0.303414 0.071059 1.000 2 length{all}[2] 0.097235 0.009693 0.000001 0.291718 0.068332 1.000 2 length{all}[3] 0.099929 0.009540 0.000017 0.290573 0.070966 1.000 2 length{all}[4] 0.102908 0.010322 0.000051 0.303151 0.071864 1.000 2 length{all}[5] 0.097717 0.009704 0.000015 0.284485 0.067790 1.000 2 length{all}[6] 0.100205 0.010105 0.000052 0.310275 0.068705 1.000 2 length{all}[7] 0.092552 0.007469 0.000226 0.266913 0.068733 1.003 2 length{all}[8] 0.101721 0.009349 0.000233 0.303286 0.068101 0.998 2 length{all}[9] 0.101493 0.011037 0.000061 0.305151 0.072525 0.999 2 length{all}[10] 0.095643 0.008458 0.000172 0.286612 0.069951 0.998 2 length{all}[11] 0.095304 0.009229 0.000117 0.295909 0.062658 0.998 2 length{all}[12] 0.103302 0.012616 0.000229 0.321025 0.061812 1.007 2 length{all}[13] 0.108883 0.011489 0.000225 0.288658 0.083019 0.998 2 length{all}[14] 0.103499 0.010954 0.000123 0.315278 0.073330 0.998 2 length{all}[15] 0.097674 0.009788 0.000022 0.289311 0.071241 1.005 2 length{all}[16] 0.103131 0.010875 0.000103 0.300570 0.068574 0.998 2 length{all}[17] 0.094584 0.008754 0.000178 0.270516 0.066952 0.999 2 length{all}[18] 0.099338 0.008577 0.000064 0.296565 0.067609 1.001 2 length{all}[19] 0.105807 0.010582 0.000561 0.300676 0.073775 0.999 2 length{all}[20] 0.096551 0.009453 0.000055 0.301354 0.062447 0.998 2 length{all}[21] 0.091828 0.007931 0.001068 0.263042 0.067205 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008417 Maximum standard deviation of split frequencies = 0.022612 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.007 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |-------------------------------------------------------------------- C2 (2) | |----------------------------------------------------------------------- C3 (3) + |------------------------------------------------------------------------ C4 (4) | |-------------------------------------------------------------------- C5 (5) | \--------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 903 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 53 patterns at 301 / 301 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 53 patterns at 301 / 301 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 51728 bytes for conP 4664 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.033348 0.099212 0.074412 0.095308 0.052414 0.107225 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1300.790783 Iterating by ming2 Initial: fx= 1300.790783 x= 0.03335 0.09921 0.07441 0.09531 0.05241 0.10722 0.30000 1.30000 1 h-m-p 0.0000 0.0001 717.8151 ++ 1242.462850 m 0.0001 13 | 1/8 2 h-m-p 0.0015 0.0134 47.9242 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 658.3044 ++ 1214.347362 m 0.0001 44 | 2/8 4 h-m-p 0.0011 0.0580 35.4222 -----------.. | 2/8 5 h-m-p 0.0000 0.0001 589.9914 ++ 1188.175669 m 0.0001 75 | 3/8 6 h-m-p 0.0160 8.0000 28.1670 -------------.. | 3/8 7 h-m-p 0.0000 0.0001 512.4367 ++ 1169.348244 m 0.0001 108 | 4/8 8 h-m-p 0.0160 8.0000 23.1179 -------------.. | 4/8 9 h-m-p 0.0000 0.0000 419.8476 ++ 1166.989135 m 0.0000 141 | 5/8 10 h-m-p 0.0160 8.0000 17.0174 -------------.. | 5/8 11 h-m-p 0.0000 0.0000 296.8710 ++ 1164.563255 m 0.0000 174 | 6/8 12 h-m-p 0.0923 8.0000 0.0000 ++++ 1164.563255 m 8.0000 187 | 6/8 13 h-m-p 0.5618 8.0000 0.0001 ++ 1164.563255 m 8.0000 200 | 6/8 14 h-m-p 0.0160 8.0000 0.0559 +++Y 1164.563255 0 0.7052 216 | 6/8 15 h-m-p 1.6000 8.0000 0.0001 C 1164.563255 0 0.4000 229 | 6/8 16 h-m-p 1.6000 8.0000 0.0000 Y 1164.563255 0 0.4000 242 | 6/8 17 h-m-p 0.4334 8.0000 0.0000 Y 1164.563255 0 0.4334 255 | 6/8 18 h-m-p 1.0770 8.0000 0.0000 --C 1164.563255 0 0.0168 270 | 6/8 19 h-m-p 0.5504 8.0000 0.0000 --C 1164.563255 0 0.0086 285 Out.. lnL = -1164.563255 286 lfun, 286 eigenQcodon, 1716 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.036316 0.061829 0.092600 0.093537 0.094551 0.051121 0.330926 0.524460 0.372420 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.274074 np = 9 lnL0 = -1288.804541 Iterating by ming2 Initial: fx= 1288.804541 x= 0.03632 0.06183 0.09260 0.09354 0.09455 0.05112 0.33093 0.52446 0.37242 1 h-m-p 0.0000 0.0001 686.2638 ++ 1227.254473 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0002 360.2609 ++ 1205.460937 m 0.0002 26 | 2/9 3 h-m-p 0.0000 0.0000 93595.1506 ++ 1192.656954 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 4845.6290 ++ 1165.368462 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0000 631.4635 ++ 1164.839258 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0002 422.6909 ++ 1164.563302 m 0.0002 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0018 ++ 1164.563301 m 8.0000 86 | 6/9 8 h-m-p 0.0128 0.8163 1.0940 +++ 1164.563264 m 0.8163 102 | 7/9 9 h-m-p 1.6000 8.0000 0.0106 ++ 1164.563264 m 8.0000 114 | 7/9 10 h-m-p 0.1165 0.5824 0.6136 ++ 1164.563262 m 0.5824 128 | 7/9 11 h-m-p 0.0000 0.0000 3.4035 h-m-p: 6.29544739e-19 3.14772369e-18 3.40346954e+00 1164.563262 .. | 7/9 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1164.563262 m 8.0000 154 | 7/9 13 h-m-p 0.1559 8.0000 0.0007 +++ 1164.563262 m 8.0000 169 | 7/9 14 h-m-p 0.0160 8.0000 1.0445 +++++ 1164.563239 m 8.0000 186 | 7/9 15 h-m-p 1.6000 8.0000 0.8932 ++ 1164.563236 m 8.0000 198 | 7/9 16 h-m-p 1.6000 8.0000 2.0382 ++ 1164.563234 m 8.0000 212 | 7/9 17 h-m-p 0.4959 8.0000 32.8801 +++ 1164.563232 m 8.0000 225 | 8/9 18 h-m-p 1.6000 8.0000 29.9691 ++ 1164.563232 m 8.0000 237 | 8/9 19 h-m-p 0.3130 1.5651 296.3864 ++ 1164.563231 m 1.5651 249 | 8/9 20 h-m-p 1.6000 8.0000 98.0601 ----------C 1164.563231 0 0.0000 271 | 8/9 21 h-m-p 0.1000 0.5000 0.0001 -------------Y 1164.563231 0 0.0000 296 Out.. lnL = -1164.563231 297 lfun, 891 eigenQcodon, 3564 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.062349 0.023662 0.051309 0.069925 0.086709 0.098694 998.999963 0.856858 0.150150 0.340736 1.398087 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 0.021843 np = 11 lnL0 = -1275.528217 Iterating by ming2 Initial: fx= 1275.528217 x= 0.06235 0.02366 0.05131 0.06993 0.08671 0.09869 951.42857 0.85686 0.15015 0.34074 1.39809 1 h-m-p 0.0000 0.0001 659.4541 ++ 1237.523035 m 0.0001 16 | 1/11 2 h-m-p 0.0002 0.0010 222.4571 ++ 1194.675189 m 0.0010 30 | 2/11 3 h-m-p 0.0000 0.0000 10537.1143 ++ 1181.746137 m 0.0000 44 | 3/11 4 h-m-p 0.0000 0.0001 908.3714 ++ 1178.714115 m 0.0001 58 | 4/11 5 h-m-p 0.0005 0.0024 13.3004 -----------.. | 4/11 6 h-m-p 0.0000 0.0000 501.1684 ++ 1175.342878 m 0.0000 95 | 5/11 7 h-m-p 0.0019 0.9707 9.1608 ------------.. | 5/11 8 h-m-p 0.0000 0.0000 410.9320 ++ 1167.454676 m 0.0000 133 | 6/11 9 h-m-p 0.0160 8.0000 6.2918 -------------.. | 6/11 10 h-m-p 0.0000 0.0000 296.6655 ++ 1164.563331 m 0.0000 172 | 7/11 11 h-m-p 0.0674 8.0000 0.0000 ++++ 1164.563330 m 8.0000 188 | 6/11 12 h-m-p 0.0272 8.0000 0.0075 +++++ 1164.563329 m 8.0000 209 | 6/11 13 h-m-p 0.0659 0.7762 0.9048 ++ 1164.563316 m 0.7762 228 | 6/11 14 h-m-p -0.0000 -0.0000 0.3525 h-m-p: -0.00000000e+00 -0.00000000e+00 3.52505659e-01 1164.563316 .. | 6/11 15 h-m-p 0.0160 8.0000 0.0002 +++++ 1164.563316 m 8.0000 266 | 6/11 16 h-m-p 0.0040 1.9997 0.6834 +++++ 1164.563207 m 1.9997 288 | 7/11 17 h-m-p 1.6000 8.0000 0.2109 ++ 1164.563187 m 8.0000 307 | 7/11 18 h-m-p 1.6000 8.0000 0.4345 C 1164.563186 0 1.6000 325 | 7/11 19 h-m-p 1.6000 8.0000 0.0263 C 1164.563186 0 1.6398 343 | 7/11 20 h-m-p 1.6000 8.0000 0.0004 ++ 1164.563186 m 8.0000 361 | 7/11 21 h-m-p 0.0097 4.8291 0.8287 +++Y 1164.563182 0 1.1278 382 | 7/11 22 h-m-p 1.6000 8.0000 0.2485 ++ 1164.563155 m 8.0000 400 | 7/11 23 h-m-p 0.7646 8.0000 2.5996 ++ 1164.563023 m 8.0000 418 | 7/11 24 h-m-p 1.6000 8.0000 0.3912 ++ 1164.563020 m 8.0000 432 | 7/11 25 h-m-p 0.0775 2.8730 40.4048 +++ 1164.563007 m 2.8730 451 | 7/11 26 h-m-p 1.6000 8.0000 3.2713 ----------------.. | 7/11 27 h-m-p 0.0160 8.0000 0.0000 -------N 1164.563007 0 0.0000 500 | 7/11 28 h-m-p 0.0160 8.0000 0.0000 --------N 1164.563007 0 0.0000 526 Out.. lnL = -1164.563007 527 lfun, 2108 eigenQcodon, 9486 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1164.556325 S = -1164.556151 -0.000067 Calculating f(w|X), posterior probabilities of site classes. did 10 / 53 patterns 0:04 did 20 / 53 patterns 0:04 did 30 / 53 patterns 0:04 did 40 / 53 patterns 0:04 did 50 / 53 patterns 0:04 did 53 / 53 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.012652 0.091816 0.065634 0.080888 0.069181 0.098870 951.429449 1.086013 1.056617 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 0.027893 np = 9 lnL0 = -1285.176476 Iterating by ming2 Initial: fx= 1285.176476 x= 0.01265 0.09182 0.06563 0.08089 0.06918 0.09887 951.42945 1.08601 1.05662 1 h-m-p 0.0000 0.0000 676.7388 ++ 1264.730973 m 0.0000 14 | 1/9 2 h-m-p 0.0006 0.0253 42.8288 +++ 1251.704461 m 0.0253 27 | 1/9 3 h-m-p -0.0000 -0.0000 9458.8946 h-m-p: -2.25891945e-21 -1.12945972e-20 9.45889459e+03 1251.704461 .. | 1/9 4 h-m-p 0.0000 0.0002 658.2106 +++ 1178.839442 m 0.0002 49 | 2/9 5 h-m-p 0.0136 0.0681 2.0185 -------------.. | 2/9 6 h-m-p 0.0000 0.0000 635.2412 ++ 1173.950351 m 0.0000 84 | 3/9 7 h-m-p 0.0160 8.0000 1.8935 -------------.. | 3/9 8 h-m-p 0.0000 0.0000 551.3781 ++ 1168.588750 m 0.0000 119 | 4/9 9 h-m-p 0.0160 8.0000 1.4238 -------------.. | 4/9 10 h-m-p 0.0000 0.0000 452.7710 ++ 1165.065146 m 0.0000 154 | 5/9 11 h-m-p 0.0160 8.0000 1.0379 -------------.. | 5/9 12 h-m-p 0.0000 0.0000 322.6093 ++ 1164.563881 m 0.0000 189 | 6/9 13 h-m-p 0.6527 8.0000 0.0000 +N 1164.563881 0 2.6110 202 QuantileBeta(0.15, 0.00495, 1.00974) = 8.711215e-162 2000 rounds | 6/9 14 h-m-p 0.2126 8.0000 0.0000 -C 1164.563881 0 0.0133 218 Out.. lnL = -1164.563881 219 lfun, 2409 eigenQcodon, 13140 P(t) Time used: 0:07 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.056583 0.072690 0.047021 0.082942 0.011569 0.079083 951.429454 0.900000 0.929336 1.523497 1.275001 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 0.029239 np = 11 lnL0 = -1264.553788 Iterating by ming2 Initial: fx= 1264.553788 x= 0.05658 0.07269 0.04702 0.08294 0.01157 0.07908 951.42945 0.90000 0.92934 1.52350 1.27500 1 h-m-p 0.0000 0.0000 666.8289 ++ 1246.029337 m 0.0000 16 | 1/11 2 h-m-p 0.0001 0.0012 228.8016 ++ 1192.466710 m 0.0012 30 | 2/11 3 h-m-p 0.0000 0.0000 9613.5080 ++ 1181.639164 m 0.0000 44 | 3/11 4 h-m-p 0.0005 0.0024 108.5169 ++ 1174.400514 m 0.0024 58 | 4/11 5 h-m-p 0.0000 0.0001 847.2751 ++ 1167.987493 m 0.0001 72 | 5/11 6 h-m-p 0.0000 0.0001 2570.2453 ++ 1164.563177 m 0.0001 86 | 6/11 7 h-m-p 1.6000 8.0000 0.0004 ++ 1164.563176 m 8.0000 100 | 6/11 8 h-m-p 0.0008 0.0500 4.0118 +++ 1164.563150 m 0.0500 120 | 7/11 9 h-m-p 0.1285 1.6055 0.8946 ++ 1164.563095 m 1.6055 134 | 7/11 10 h-m-p 0.0000 0.0000 0.9341 h-m-p: 2.00863860e-18 1.00431930e-17 9.34120957e-01 1164.563095 .. | 7/11 11 h-m-p 0.0160 8.0000 0.0000 +++++ 1164.563095 m 8.0000 170 | 7/11 12 h-m-p 0.0160 8.0000 0.6565 +++++ 1164.563040 m 8.0000 191 | 7/11 13 h-m-p 1.6000 8.0000 0.9447 ++ 1164.563023 m 8.0000 209 | 7/11 14 h-m-p 1.6000 8.0000 2.9934 ++ 1164.563012 m 8.0000 227 | 7/11 15 h-m-p 1.6000 8.0000 4.4996 ++ 1164.563008 m 8.0000 241 | 7/11 16 h-m-p 1.6000 8.0000 11.8611 ++ 1164.563006 m 8.0000 255 | 7/11 17 h-m-p 1.6000 8.0000 13.9006 ++ 1164.563005 m 8.0000 269 | 7/11 18 h-m-p 0.2277 1.1383 246.7261 ---------C 1164.563005 0 0.0000 292 | 7/11 19 h-m-p 1.0000 8.0000 0.0001 -C 1164.563005 0 0.0625 307 | 7/11 20 h-m-p 0.3948 8.0000 0.0000 Y 1164.563005 0 0.3948 325 Out.. lnL = -1164.563005 326 lfun, 3912 eigenQcodon, 21516 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1164.556208 S = -1164.556130 -0.000034 Calculating f(w|X), posterior probabilities of site classes. did 10 / 53 patterns 0:13 did 20 / 53 patterns 0:13 did 30 / 53 patterns 0:13 did 40 / 53 patterns 0:14 did 50 / 53 patterns 0:14 did 53 / 53 patterns 0:14 Time used: 0:14 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=301 NC_011896_1_WP_010907521_1_99_MLBR_RS00480 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG NC_002677_1_NP_301196_1_68_fbpC VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG ************************************************** NC_011896_1_WP_010907521_1_99_MLBR_RS00480 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP NC_002677_1_NP_301196_1_68_fbpC RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP ************************************************** NC_011896_1_WP_010907521_1_99_MLBR_RS00480 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG NC_002677_1_NP_301196_1_68_fbpC AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG ************************************************** NC_011896_1_WP_010907521_1_99_MLBR_RS00480 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG NC_002677_1_NP_301196_1_68_fbpC GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG ************************************************** NC_011896_1_WP_010907521_1_99_MLBR_RS00480 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA NC_002677_1_NP_301196_1_68_fbpC MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA ************************************************** NC_011896_1_WP_010907521_1_99_MLBR_RS00480 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI NC_002677_1_NP_301196_1_68_fbpC SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI ************************************************** NC_011896_1_WP_010907521_1_99_MLBR_RS00480 R NC_002677_1_NP_301196_1_68_fbpC R NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 R NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 R NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 R NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 R *
>NC_011896_1_WP_010907521_1_99_MLBR_RS00480 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >NC_002677_1_NP_301196_1_68_fbpC GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC >NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 GTGCGGGGTCTGTCAGCAGTTGTGCGGGTGCTCTGCGTCGCCGCCCTGGC AGTAGGGGTGTTCGCTGCGGCCGTACTACTGGCGGGAACCGCTGGCAACG CCAAGGCTGCGGGTTACGAATCCTTGATGGTGCCGTCGAACGCAATGGGC CGGGATATTCCGGTCGCTTTCATGGCCGGGGGGCCGCACGCGGTGTACCT GCTTGATGCCTTCAACGCCGCCTTGGATGTCAGTAACTGGGTTACTGCGG GCAATGCGATGACCACGTTGGGAGGCAGGGGTATCTCGGTGGTGGCTCCC GCCGGCGGCGCCTACAGCATGTACACAAACTGGGAGAATGACGGCAGCAA GCAGTGGGATACCTTCCTGTCCAGCGAGCTTCCCGACTGGCTGGCCACCA AACGGGGTTTGGCGCCCGACGGCCACGCGGCCGTCGGCGCCTCGCAGGGT GGGTATGCTGCGCTGGCGCTGGCGGCTTTCCACCCCGACCGTTTCGGCTT CGCTGGTTCGTTGTCCGGGTTTGTGTACCCCTCGAGCACAAACTACAATG GTGCCATTCTTGCTGGCCTGCAGCAGTTTGGCGGTATCGACGGCAACGGG ATGTGGGGCGCCCCGCAGCTGGGCCGGTGGAAGTGGCATGACCCCTACGT GCATGCTTCGCTTTTGGCGCAGAACAACACCCGCGTGTGGGTCTACAGTC CGATGACTATGGGTGGCGACATCGACGCAATGATTGGTCAGGCAGTCGCA TCGATGGGCAGCTCCCGGGAGTTTTACCAACAGTACCGCAGCGTCGGTGG GCACAACGGTCACTTTGACTTCTCGGGTGGTGGTGACAACGGCTGGGGGG CGTGGGCGCCGCAGTTGGCTGCTATGTCGGGCGATATCGTCGGCGCCATT CGC
>NC_011896_1_WP_010907521_1_99_MLBR_RS00480 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >NC_002677_1_NP_301196_1_68_fbpC VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R >NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMG RDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAP AGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQG GYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNG MWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVA SMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAI R
#NEXUS [ID: 9204764926] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907521_1_99_MLBR_RS00480 NC_002677_1_NP_301196_1_68_fbpC NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 ; end; begin trees; translate 1 NC_011896_1_WP_010907521_1_99_MLBR_RS00480, 2 NC_002677_1_NP_301196_1_68_fbpC, 3 NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915, 4 NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095, 5 NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505, 6 NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07105889,2:0.06833178,3:0.07096642,4:0.07186373,5:0.0677897,6:0.06870498); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07105889,2:0.06833178,3:0.07096642,4:0.07186373,5:0.0677897,6:0.06870498); end;
Estimated marginal likelihoods for runs sampled in files "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1211.44 -1216.46 2 -1211.47 -1215.54 -------------------------------------- TOTAL -1211.45 -1216.10 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/fbpC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896248 0.087759 0.377946 1.459751 0.862123 1482.80 1491.90 1.000 r(A<->C){all} 0.184079 0.023028 0.000033 0.486986 0.145421 267.82 313.86 1.004 r(A<->G){all} 0.147723 0.016869 0.000092 0.404489 0.108498 189.89 241.59 1.000 r(A<->T){all} 0.174214 0.021944 0.000036 0.481803 0.135473 105.27 120.85 1.000 r(C<->G){all} 0.159780 0.018806 0.000156 0.428881 0.122095 302.76 320.30 1.000 r(C<->T){all} 0.169247 0.020732 0.000019 0.456496 0.129457 136.54 192.85 1.007 r(G<->T){all} 0.164958 0.020138 0.000041 0.454190 0.124621 156.57 218.29 1.000 pi(A){all} 0.152938 0.000142 0.129513 0.175763 0.152642 1166.68 1249.38 1.000 pi(C){all} 0.284618 0.000215 0.255893 0.313081 0.284273 1236.95 1241.51 1.000 pi(G){all} 0.352704 0.000251 0.322883 0.384579 0.353081 1149.02 1200.29 1.000 pi(T){all} 0.209739 0.000185 0.184120 0.235916 0.209487 1247.25 1276.22 1.000 alpha{1,2} 0.410179 0.221997 0.000168 1.365406 0.239238 994.32 1097.81 1.000 alpha{3} 0.473817 0.244902 0.000134 1.448924 0.324241 1447.07 1474.03 1.000 pinvar{all} 0.998334 0.000004 0.994680 0.999999 0.998977 939.44 1163.12 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/fbpC/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 301 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 4 4 4 4 4 4 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0 TTC 8 8 8 8 8 8 | TCC 4 4 4 4 4 4 | TAC 10 10 10 10 10 10 | TGC 1 1 1 1 1 1 Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 7 7 7 7 7 7 | TCG 9 9 9 9 9 9 | TAG 0 0 0 0 0 0 | Trp TGG 10 10 10 10 10 10 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 4 4 4 4 4 4 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1 CTC 1 1 1 1 1 1 | CCC 6 6 6 6 6 6 | CAC 5 5 5 5 5 5 | CGC 3 3 3 3 3 3 CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0 CTG 10 10 10 10 10 10 | CCG 6 6 6 6 6 6 | CAG 9 9 9 9 9 9 | CGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 4 4 4 4 4 4 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 2 2 2 2 2 2 ATC 4 4 4 4 4 4 | ACC 5 5 5 5 5 5 | AAC 11 11 11 11 11 11 | AGC 6 6 6 6 6 6 ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0 Met ATG 11 11 11 11 11 11 | ACG 1 1 1 1 1 1 | AAG 3 3 3 3 3 3 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 2 2 | Ala GCT 12 12 12 12 12 12 | Asp GAT 5 5 5 5 5 5 | Gly GGT 15 15 15 15 15 15 GTC 8 8 8 8 8 8 | GCC 16 16 16 16 16 16 | GAC 10 10 10 10 10 10 | GGC 20 20 20 20 20 20 GTA 2 2 2 2 2 2 | GCA 6 6 6 6 6 6 | Glu GAA 1 1 1 1 1 1 | GGA 2 2 2 2 2 2 GTG 11 11 11 11 11 11 | GCG 14 14 14 14 14 14 | GAG 3 3 3 3 3 3 | GGG 8 8 8 8 8 8 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907521_1_99_MLBR_RS00480 position 1: T:0.18272 C:0.18272 A:0.18605 G:0.44850 position 2: T:0.25581 C:0.27907 A:0.21595 G:0.24917 position 3: T:0.18937 C:0.39203 A:0.05648 G:0.36213 Average T:0.20930 C:0.28461 A:0.15282 G:0.35327 #2: NC_002677_1_NP_301196_1_68_fbpC position 1: T:0.18272 C:0.18272 A:0.18605 G:0.44850 position 2: T:0.25581 C:0.27907 A:0.21595 G:0.24917 position 3: T:0.18937 C:0.39203 A:0.05648 G:0.36213 Average T:0.20930 C:0.28461 A:0.15282 G:0.35327 #3: NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915 position 1: T:0.18272 C:0.18272 A:0.18605 G:0.44850 position 2: T:0.25581 C:0.27907 A:0.21595 G:0.24917 position 3: T:0.18937 C:0.39203 A:0.05648 G:0.36213 Average T:0.20930 C:0.28461 A:0.15282 G:0.35327 #4: NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095 position 1: T:0.18272 C:0.18272 A:0.18605 G:0.44850 position 2: T:0.25581 C:0.27907 A:0.21595 G:0.24917 position 3: T:0.18937 C:0.39203 A:0.05648 G:0.36213 Average T:0.20930 C:0.28461 A:0.15282 G:0.35327 #5: NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505 position 1: T:0.18272 C:0.18272 A:0.18605 G:0.44850 position 2: T:0.25581 C:0.27907 A:0.21595 G:0.24917 position 3: T:0.18937 C:0.39203 A:0.05648 G:0.36213 Average T:0.20930 C:0.28461 A:0.15282 G:0.35327 #6: NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520 position 1: T:0.18272 C:0.18272 A:0.18605 G:0.44850 position 2: T:0.25581 C:0.27907 A:0.21595 G:0.24917 position 3: T:0.18937 C:0.39203 A:0.05648 G:0.36213 Average T:0.20930 C:0.28461 A:0.15282 G:0.35327 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 24 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0 TTC 48 | TCC 24 | TAC 60 | TGC 6 Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 42 | TCG 54 | TAG 0 | Trp W TGG 60 ------------------------------------------------------------------------------ Leu L CTT 24 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 6 CTC 6 | CCC 36 | CAC 30 | CGC 18 CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 0 CTG 60 | CCG 36 | CAG 54 | CGG 36 ------------------------------------------------------------------------------ Ile I ATT 24 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 12 ATC 24 | ACC 30 | AAC 66 | AGC 36 ATA 0 | ACA 12 | Lys K AAA 6 | Arg R AGA 0 Met M ATG 66 | ACG 6 | AAG 18 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 12 | Ala A GCT 72 | Asp D GAT 30 | Gly G GGT 90 GTC 48 | GCC 96 | GAC 60 | GGC 120 GTA 12 | GCA 36 | Glu E GAA 6 | GGA 12 GTG 66 | GCG 84 | GAG 18 | GGG 48 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.18272 C:0.18272 A:0.18605 G:0.44850 position 2: T:0.25581 C:0.27907 A:0.21595 G:0.24917 position 3: T:0.18937 C:0.39203 A:0.05648 G:0.36213 Average T:0.20930 C:0.28461 A:0.15282 G:0.35327 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1164.563255 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.330926 1.275001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907521_1_99_MLBR_RS00480: 0.000004, NC_002677_1_NP_301196_1_68_fbpC: 0.000004, NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915: 0.000004, NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095: 0.000004, NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505: 0.000004, NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.33093 omega (dN/dS) = 1.27500 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 697.7 205.3 1.2750 0.0000 0.0000 0.0 0.0 7..2 0.000 697.7 205.3 1.2750 0.0000 0.0000 0.0 0.0 7..3 0.000 697.7 205.3 1.2750 0.0000 0.0000 0.0 0.0 7..4 0.000 697.7 205.3 1.2750 0.0000 0.0000 0.0 0.0 7..5 0.000 697.7 205.3 1.2750 0.0000 0.0000 0.0 0.0 7..6 0.000 697.7 205.3 1.2750 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1164.563231 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 998.999963 0.000010 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907521_1_99_MLBR_RS00480: 0.000004, NC_002677_1_NP_301196_1_68_fbpC: 0.000004, NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915: 0.000004, NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095: 0.000004, NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505: 0.000004, NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 998.99996 MLEs of dN/dS (w) for site classes (K=2) p: 0.00001 0.99999 w: 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 668.8 234.2 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 668.8 234.2 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 668.8 234.2 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 668.8 234.2 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 668.8 234.2 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 668.8 234.2 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1164.563007 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.429449 0.000000 0.000000 1.000000 96.349092 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907521_1_99_MLBR_RS00480: 0.000004, NC_002677_1_NP_301196_1_68_fbpC: 0.000004, NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915: 0.000004, NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095: 0.000004, NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505: 0.000004, NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 951.42945 MLEs of dN/dS (w) for site classes (K=3) p: 0.00000 0.00000 1.00000 w: 1.00000 1.00000 96.34909 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 668.8 234.2 96.3491 0.0000 0.0000 0.0 0.0 7..2 0.000 668.8 234.2 96.3491 0.0000 0.0000 0.0 0.0 7..3 0.000 668.8 234.2 96.3491 0.0000 0.0000 0.0 0.0 7..4 0.000 668.8 234.2 96.3491 0.0000 0.0000 0.0 0.0 7..5 0.000 668.8 234.2 96.3491 0.0000 0.0000 0.0 0.0 7..6 0.000 668.8 234.2 96.3491 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907521_1_99_MLBR_RS00480) Pr(w>1) post mean +- SE for w 1 V 1.000** 96.349 2 R 1.000** 96.349 3 G 1.000** 96.349 4 L 1.000** 96.349 5 S 1.000** 96.349 6 A 1.000** 96.349 7 V 1.000** 96.349 8 V 1.000** 96.349 9 R 1.000** 96.349 10 V 1.000** 96.349 11 L 1.000** 96.349 12 C 1.000** 96.349 13 V 1.000** 96.349 14 A 1.000** 96.349 15 A 1.000** 96.349 16 L 1.000** 96.349 17 A 1.000** 96.349 18 V 1.000** 96.349 19 G 1.000** 96.349 20 V 1.000** 96.349 21 F 1.000** 96.349 22 A 1.000** 96.349 23 A 1.000** 96.349 24 A 1.000** 96.349 25 V 1.000** 96.349 26 L 1.000** 96.349 27 L 1.000** 96.349 28 A 1.000** 96.349 29 G 1.000** 96.349 30 T 1.000** 96.349 31 A 1.000** 96.349 32 G 1.000** 96.349 33 N 1.000** 96.349 34 A 1.000** 96.349 35 K 1.000** 96.349 36 A 1.000** 96.349 37 A 1.000** 96.349 38 G 1.000** 96.349 39 Y 1.000** 96.349 40 E 1.000** 96.349 41 S 1.000** 96.349 42 L 1.000** 96.349 43 M 1.000** 96.349 44 V 1.000** 96.349 45 P 1.000** 96.349 46 S 1.000** 96.349 47 N 1.000** 96.349 48 A 1.000** 96.349 49 M 1.000** 96.349 50 G 1.000** 96.349 51 R 1.000** 96.349 52 D 1.000** 96.349 53 I 1.000** 96.349 54 P 1.000** 96.349 55 V 1.000** 96.349 56 A 1.000** 96.349 57 F 1.000** 96.349 58 M 1.000** 96.349 59 A 1.000** 96.349 60 G 1.000** 96.349 61 G 1.000** 96.349 62 P 1.000** 96.349 63 H 1.000** 96.349 64 A 1.000** 96.349 65 V 1.000** 96.349 66 Y 1.000** 96.349 67 L 1.000** 96.349 68 L 1.000** 96.349 69 D 1.000** 96.349 70 A 1.000** 96.349 71 F 1.000** 96.349 72 N 1.000** 96.349 73 A 1.000** 96.349 74 A 1.000** 96.349 75 L 1.000** 96.349 76 D 1.000** 96.349 77 V 1.000** 96.349 78 S 1.000** 96.349 79 N 1.000** 96.349 80 W 1.000** 96.349 81 V 1.000** 96.349 82 T 1.000** 96.349 83 A 1.000** 96.349 84 G 1.000** 96.349 85 N 1.000** 96.349 86 A 1.000** 96.349 87 M 1.000** 96.349 88 T 1.000** 96.349 89 T 1.000** 96.349 90 L 1.000** 96.349 91 G 1.000** 96.349 92 G 1.000** 96.349 93 R 1.000** 96.349 94 G 1.000** 96.349 95 I 1.000** 96.349 96 S 1.000** 96.349 97 V 1.000** 96.349 98 V 1.000** 96.349 99 A 1.000** 96.349 100 P 1.000** 96.349 101 A 1.000** 96.349 102 G 1.000** 96.349 103 G 1.000** 96.349 104 A 1.000** 96.349 105 Y 1.000** 96.349 106 S 1.000** 96.349 107 M 1.000** 96.349 108 Y 1.000** 96.349 109 T 1.000** 96.349 110 N 1.000** 96.349 111 W 1.000** 96.349 112 E 1.000** 96.349 113 N 1.000** 96.349 114 D 1.000** 96.349 115 G 1.000** 96.349 116 S 1.000** 96.349 117 K 1.000** 96.349 118 Q 1.000** 96.349 119 W 1.000** 96.349 120 D 1.000** 96.349 121 T 1.000** 96.349 122 F 1.000** 96.349 123 L 1.000** 96.349 124 S 1.000** 96.349 125 S 1.000** 96.349 126 E 1.000** 96.349 127 L 1.000** 96.349 128 P 1.000** 96.349 129 D 1.000** 96.349 130 W 1.000** 96.349 131 L 1.000** 96.349 132 A 1.000** 96.349 133 T 1.000** 96.349 134 K 1.000** 96.349 135 R 1.000** 96.349 136 G 1.000** 96.349 137 L 1.000** 96.349 138 A 1.000** 96.349 139 P 1.000** 96.349 140 D 1.000** 96.349 141 G 1.000** 96.349 142 H 1.000** 96.349 143 A 1.000** 96.349 144 A 1.000** 96.349 145 V 1.000** 96.349 146 G 1.000** 96.349 147 A 1.000** 96.349 148 S 1.000** 96.349 149 Q 1.000** 96.349 150 G 1.000** 96.349 151 G 1.000** 96.349 152 Y 1.000** 96.349 153 A 1.000** 96.349 154 A 1.000** 96.349 155 L 1.000** 96.349 156 A 1.000** 96.349 157 L 1.000** 96.349 158 A 1.000** 96.349 159 A 1.000** 96.349 160 F 1.000** 96.349 161 H 1.000** 96.349 162 P 1.000** 96.349 163 D 1.000** 96.349 164 R 1.000** 96.349 165 F 1.000** 96.349 166 G 1.000** 96.349 167 F 1.000** 96.349 168 A 1.000** 96.349 169 G 1.000** 96.349 170 S 1.000** 96.349 171 L 1.000** 96.349 172 S 1.000** 96.349 173 G 1.000** 96.349 174 F 1.000** 96.349 175 V 1.000** 96.349 176 Y 1.000** 96.349 177 P 1.000** 96.349 178 S 1.000** 96.349 179 S 1.000** 96.349 180 T 1.000** 96.349 181 N 1.000** 96.349 182 Y 1.000** 96.349 183 N 1.000** 96.349 184 G 1.000** 96.349 185 A 1.000** 96.349 186 I 1.000** 96.349 187 L 1.000** 96.349 188 A 1.000** 96.349 189 G 1.000** 96.349 190 L 1.000** 96.349 191 Q 1.000** 96.349 192 Q 1.000** 96.349 193 F 1.000** 96.349 194 G 1.000** 96.349 195 G 1.000** 96.349 196 I 1.000** 96.349 197 D 1.000** 96.349 198 G 1.000** 96.349 199 N 1.000** 96.349 200 G 1.000** 96.349 201 M 1.000** 96.349 202 W 1.000** 96.349 203 G 1.000** 96.349 204 A 1.000** 96.349 205 P 1.000** 96.349 206 Q 1.000** 96.349 207 L 1.000** 96.349 208 G 1.000** 96.349 209 R 1.000** 96.349 210 W 1.000** 96.349 211 K 1.000** 96.349 212 W 1.000** 96.349 213 H 1.000** 96.349 214 D 1.000** 96.349 215 P 1.000** 96.349 216 Y 1.000** 96.349 217 V 1.000** 96.349 218 H 1.000** 96.349 219 A 1.000** 96.349 220 S 1.000** 96.349 221 L 1.000** 96.349 222 L 1.000** 96.349 223 A 1.000** 96.349 224 Q 1.000** 96.349 225 N 1.000** 96.349 226 N 1.000** 96.349 227 T 1.000** 96.349 228 R 1.000** 96.349 229 V 1.000** 96.349 230 W 1.000** 96.349 231 V 1.000** 96.349 232 Y 1.000** 96.349 233 S 1.000** 96.349 234 P 1.000** 96.349 235 M 1.000** 96.349 236 T 1.000** 96.349 237 M 1.000** 96.349 238 G 1.000** 96.349 239 G 1.000** 96.349 240 D 1.000** 96.349 241 I 1.000** 96.349 242 D 1.000** 96.349 243 A 1.000** 96.349 244 M 1.000** 96.349 245 I 1.000** 96.349 246 G 1.000** 96.349 247 Q 1.000** 96.349 248 A 1.000** 96.349 249 V 1.000** 96.349 250 A 1.000** 96.349 251 S 1.000** 96.349 252 M 1.000** 96.349 253 G 1.000** 96.349 254 S 1.000** 96.349 255 S 1.000** 96.349 256 R 1.000** 96.349 257 E 1.000** 96.349 258 F 1.000** 96.349 259 Y 1.000** 96.349 260 Q 1.000** 96.349 261 Q 1.000** 96.349 262 Y 1.000** 96.349 263 R 1.000** 96.349 264 S 1.000** 96.349 265 V 1.000** 96.349 266 G 1.000** 96.349 267 G 1.000** 96.349 268 H 1.000** 96.349 269 N 1.000** 96.349 270 G 1.000** 96.349 271 H 1.000** 96.349 272 F 1.000** 96.349 273 D 1.000** 96.349 274 F 1.000** 96.349 275 S 1.000** 96.349 276 G 1.000** 96.349 277 G 1.000** 96.349 278 G 1.000** 96.349 279 D 1.000** 96.349 280 N 1.000** 96.349 281 G 1.000** 96.349 282 W 1.000** 96.349 283 G 1.000** 96.349 284 A 1.000** 96.349 285 W 1.000** 96.349 286 A 1.000** 96.349 287 P 1.000** 96.349 288 Q 1.000** 96.349 289 L 1.000** 96.349 290 A 1.000** 96.349 291 A 1.000** 96.349 292 M 1.000** 96.349 293 S 1.000** 96.349 294 G 1.000** 96.349 295 D 1.000** 96.349 296 I 1.000** 96.349 297 V 1.000** 96.349 298 G 1.000** 96.349 299 A 1.000** 96.349 300 I 1.000** 96.349 301 R 1.000** 96.349 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907521_1_99_MLBR_RS00480) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1164.563881 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.429454 0.005007 1.009740 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907521_1_99_MLBR_RS00480: 0.000004, NC_002677_1_NP_301196_1_68_fbpC: 0.000004, NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915: 0.000004, NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095: 0.000004, NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505: 0.000004, NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 951.42945 Parameters in M7 (beta): p = 0.00501 q = 1.00974 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 668.8 234.2 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 668.8 234.2 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 668.8 234.2 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 668.8 234.2 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 668.8 234.2 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 668.8 234.2 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:07 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1164.563005 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.433397 0.000010 0.005000 1.799762 281.860225 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907521_1_99_MLBR_RS00480: 0.000004, NC_002677_1_NP_301196_1_68_fbpC: 0.000004, NZ_LVXE01000014_1_WP_010907521_1_481_A3216_RS05915: 0.000004, NZ_LYPH01000018_1_WP_010907521_1_657_A8144_RS03095: 0.000004, NZ_CP029543_1_WP_010907521_1_98_DIJ64_RS00505: 0.000004, NZ_AP014567_1_WP_010907521_1_101_JK2ML_RS00520: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 951.43340 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 0.00500 q = 1.79976 (p1 = 0.99999) w = 281.86022 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 281.86022 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 668.8 234.2 281.8574 0.0000 0.0000 0.0 0.0 7..2 0.000 668.8 234.2 281.8574 0.0000 0.0000 0.0 0.0 7..3 0.000 668.8 234.2 281.8574 0.0000 0.0000 0.0 0.0 7..4 0.000 668.8 234.2 281.8574 0.0000 0.0000 0.0 0.0 7..5 0.000 668.8 234.2 281.8574 0.0000 0.0000 0.0 0.0 7..6 0.000 668.8 234.2 281.8574 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907521_1_99_MLBR_RS00480) Pr(w>1) post mean +- SE for w 1 V 1.000** 281.857 2 R 1.000** 281.857 3 G 1.000** 281.857 4 L 1.000** 281.857 5 S 1.000** 281.857 6 A 1.000** 281.857 7 V 1.000** 281.857 8 V 1.000** 281.857 9 R 1.000** 281.857 10 V 1.000** 281.857 11 L 1.000** 281.857 12 C 1.000** 281.857 13 V 1.000** 281.857 14 A 1.000** 281.857 15 A 1.000** 281.857 16 L 1.000** 281.857 17 A 1.000** 281.857 18 V 1.000** 281.857 19 G 1.000** 281.857 20 V 1.000** 281.857 21 F 1.000** 281.857 22 A 1.000** 281.857 23 A 1.000** 281.857 24 A 1.000** 281.857 25 V 1.000** 281.857 26 L 1.000** 281.857 27 L 1.000** 281.857 28 A 1.000** 281.857 29 G 1.000** 281.857 30 T 1.000** 281.857 31 A 1.000** 281.857 32 G 1.000** 281.857 33 N 1.000** 281.857 34 A 1.000** 281.857 35 K 1.000** 281.857 36 A 1.000** 281.857 37 A 1.000** 281.857 38 G 1.000** 281.857 39 Y 1.000** 281.857 40 E 1.000** 281.857 41 S 1.000** 281.857 42 L 1.000** 281.857 43 M 1.000** 281.857 44 V 1.000** 281.857 45 P 1.000** 281.857 46 S 1.000** 281.857 47 N 1.000** 281.857 48 A 1.000** 281.857 49 M 1.000** 281.857 50 G 1.000** 281.857 51 R 1.000** 281.857 52 D 1.000** 281.857 53 I 1.000** 281.857 54 P 1.000** 281.857 55 V 1.000** 281.857 56 A 1.000** 281.857 57 F 1.000** 281.857 58 M 1.000** 281.857 59 A 1.000** 281.857 60 G 1.000** 281.857 61 G 1.000** 281.857 62 P 1.000** 281.857 63 H 1.000** 281.857 64 A 1.000** 281.857 65 V 1.000** 281.857 66 Y 1.000** 281.857 67 L 1.000** 281.857 68 L 1.000** 281.857 69 D 1.000** 281.857 70 A 1.000** 281.857 71 F 1.000** 281.857 72 N 1.000** 281.857 73 A 1.000** 281.857 74 A 1.000** 281.857 75 L 1.000** 281.857 76 D 1.000** 281.857 77 V 1.000** 281.857 78 S 1.000** 281.857 79 N 1.000** 281.857 80 W 1.000** 281.857 81 V 1.000** 281.857 82 T 1.000** 281.857 83 A 1.000** 281.857 84 G 1.000** 281.857 85 N 1.000** 281.857 86 A 1.000** 281.857 87 M 1.000** 281.857 88 T 1.000** 281.857 89 T 1.000** 281.857 90 L 1.000** 281.857 91 G 1.000** 281.857 92 G 1.000** 281.857 93 R 1.000** 281.857 94 G 1.000** 281.857 95 I 1.000** 281.857 96 S 1.000** 281.857 97 V 1.000** 281.857 98 V 1.000** 281.857 99 A 1.000** 281.857 100 P 1.000** 281.857 101 A 1.000** 281.857 102 G 1.000** 281.857 103 G 1.000** 281.857 104 A 1.000** 281.857 105 Y 1.000** 281.857 106 S 1.000** 281.857 107 M 1.000** 281.857 108 Y 1.000** 281.857 109 T 1.000** 281.857 110 N 1.000** 281.857 111 W 1.000** 281.857 112 E 1.000** 281.857 113 N 1.000** 281.857 114 D 1.000** 281.857 115 G 1.000** 281.857 116 S 1.000** 281.857 117 K 1.000** 281.857 118 Q 1.000** 281.857 119 W 1.000** 281.857 120 D 1.000** 281.857 121 T 1.000** 281.857 122 F 1.000** 281.857 123 L 1.000** 281.857 124 S 1.000** 281.857 125 S 1.000** 281.857 126 E 1.000** 281.857 127 L 1.000** 281.857 128 P 1.000** 281.857 129 D 1.000** 281.857 130 W 1.000** 281.857 131 L 1.000** 281.857 132 A 1.000** 281.857 133 T 1.000** 281.857 134 K 1.000** 281.857 135 R 1.000** 281.857 136 G 1.000** 281.857 137 L 1.000** 281.857 138 A 1.000** 281.857 139 P 1.000** 281.857 140 D 1.000** 281.857 141 G 1.000** 281.857 142 H 1.000** 281.857 143 A 1.000** 281.857 144 A 1.000** 281.857 145 V 1.000** 281.857 146 G 1.000** 281.857 147 A 1.000** 281.857 148 S 1.000** 281.857 149 Q 1.000** 281.857 150 G 1.000** 281.857 151 G 1.000** 281.857 152 Y 1.000** 281.857 153 A 1.000** 281.857 154 A 1.000** 281.857 155 L 1.000** 281.857 156 A 1.000** 281.857 157 L 1.000** 281.857 158 A 1.000** 281.857 159 A 1.000** 281.857 160 F 1.000** 281.857 161 H 1.000** 281.857 162 P 1.000** 281.857 163 D 1.000** 281.857 164 R 1.000** 281.857 165 F 1.000** 281.857 166 G 1.000** 281.857 167 F 1.000** 281.857 168 A 1.000** 281.857 169 G 1.000** 281.857 170 S 1.000** 281.857 171 L 1.000** 281.857 172 S 1.000** 281.857 173 G 1.000** 281.857 174 F 1.000** 281.857 175 V 1.000** 281.857 176 Y 1.000** 281.857 177 P 1.000** 281.857 178 S 1.000** 281.857 179 S 1.000** 281.857 180 T 1.000** 281.857 181 N 1.000** 281.857 182 Y 1.000** 281.857 183 N 1.000** 281.857 184 G 1.000** 281.857 185 A 1.000** 281.857 186 I 1.000** 281.857 187 L 1.000** 281.857 188 A 1.000** 281.857 189 G 1.000** 281.857 190 L 1.000** 281.857 191 Q 1.000** 281.857 192 Q 1.000** 281.857 193 F 1.000** 281.857 194 G 1.000** 281.857 195 G 1.000** 281.857 196 I 1.000** 281.857 197 D 1.000** 281.857 198 G 1.000** 281.857 199 N 1.000** 281.857 200 G 1.000** 281.857 201 M 1.000** 281.857 202 W 1.000** 281.857 203 G 1.000** 281.857 204 A 1.000** 281.857 205 P 1.000** 281.857 206 Q 1.000** 281.857 207 L 1.000** 281.857 208 G 1.000** 281.857 209 R 1.000** 281.857 210 W 1.000** 281.857 211 K 1.000** 281.857 212 W 1.000** 281.857 213 H 1.000** 281.857 214 D 1.000** 281.857 215 P 1.000** 281.857 216 Y 1.000** 281.857 217 V 1.000** 281.857 218 H 1.000** 281.857 219 A 1.000** 281.857 220 S 1.000** 281.857 221 L 1.000** 281.857 222 L 1.000** 281.857 223 A 1.000** 281.857 224 Q 1.000** 281.857 225 N 1.000** 281.857 226 N 1.000** 281.857 227 T 1.000** 281.857 228 R 1.000** 281.857 229 V 1.000** 281.857 230 W 1.000** 281.857 231 V 1.000** 281.857 232 Y 1.000** 281.857 233 S 1.000** 281.857 234 P 1.000** 281.857 235 M 1.000** 281.857 236 T 1.000** 281.857 237 M 1.000** 281.857 238 G 1.000** 281.857 239 G 1.000** 281.857 240 D 1.000** 281.857 241 I 1.000** 281.857 242 D 1.000** 281.857 243 A 1.000** 281.857 244 M 1.000** 281.857 245 I 1.000** 281.857 246 G 1.000** 281.857 247 Q 1.000** 281.857 248 A 1.000** 281.857 249 V 1.000** 281.857 250 A 1.000** 281.857 251 S 1.000** 281.857 252 M 1.000** 281.857 253 G 1.000** 281.857 254 S 1.000** 281.857 255 S 1.000** 281.857 256 R 1.000** 281.857 257 E 1.000** 281.857 258 F 1.000** 281.857 259 Y 1.000** 281.857 260 Q 1.000** 281.857 261 Q 1.000** 281.857 262 Y 1.000** 281.857 263 R 1.000** 281.857 264 S 1.000** 281.857 265 V 1.000** 281.857 266 G 1.000** 281.857 267 G 1.000** 281.857 268 H 1.000** 281.857 269 N 1.000** 281.857 270 G 1.000** 281.857 271 H 1.000** 281.857 272 F 1.000** 281.857 273 D 1.000** 281.857 274 F 1.000** 281.857 275 S 1.000** 281.857 276 G 1.000** 281.857 277 G 1.000** 281.857 278 G 1.000** 281.857 279 D 1.000** 281.857 280 N 1.000** 281.857 281 G 1.000** 281.857 282 W 1.000** 281.857 283 G 1.000** 281.857 284 A 1.000** 281.857 285 W 1.000** 281.857 286 A 1.000** 281.857 287 P 1.000** 281.857 288 Q 1.000** 281.857 289 L 1.000** 281.857 290 A 1.000** 281.857 291 A 1.000** 281.857 292 M 1.000** 281.857 293 S 1.000** 281.857 294 G 1.000** 281.857 295 D 1.000** 281.857 296 I 1.000** 281.857 297 V 1.000** 281.857 298 G 1.000** 281.857 299 A 1.000** 281.857 300 I 1.000** 281.857 301 R 1.000** 281.857 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907521_1_99_MLBR_RS00480) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:14
Model 1: NearlyNeutral -1164.563231 Model 2: PositiveSelection -1164.563007 Model 0: one-ratio -1164.563255 Model 7: beta -1164.563881 Model 8: beta&w>1 -1164.563005 Model 0 vs 1 4.799999987881165E-5 Model 2 vs 1 4.480000002331508E-4 Model 8 vs 7 0.0017520000001240987