--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:13:34 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/folD/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1144.01 -1146.72 2 -1143.93 -1147.03 -------------------------------------- TOTAL -1143.97 -1146.89 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899047 0.089970 0.342036 1.487773 0.862575 1148.66 1211.04 1.000 r(A<->C){all} 0.169640 0.020983 0.000014 0.459405 0.130400 214.95 247.93 1.000 r(A<->G){all} 0.156218 0.018326 0.000016 0.430837 0.119282 160.32 181.81 1.003 r(A<->T){all} 0.174947 0.022846 0.000115 0.496691 0.131980 208.15 223.75 1.000 r(C<->G){all} 0.163106 0.020089 0.000043 0.456254 0.121585 273.14 334.84 1.003 r(C<->T){all} 0.168777 0.020902 0.000188 0.463971 0.130177 192.49 200.85 1.001 r(G<->T){all} 0.167312 0.021542 0.000022 0.467902 0.125369 227.26 259.21 1.005 pi(A){all} 0.180566 0.000175 0.155033 0.206581 0.180140 1208.54 1246.34 1.000 pi(C){all} 0.316993 0.000276 0.285401 0.348775 0.316892 997.52 1202.43 1.002 pi(G){all} 0.315091 0.000248 0.286222 0.346614 0.315002 1188.27 1210.29 1.005 pi(T){all} 0.187351 0.000182 0.160792 0.213141 0.187520 1188.27 1244.70 1.000 alpha{1,2} 0.438962 0.240900 0.000151 1.461049 0.264462 1056.98 1121.78 1.000 alpha{3} 0.452460 0.217270 0.000145 1.386458 0.303426 1004.93 1148.21 1.000 pinvar{all} 0.998146 0.000005 0.994159 1.000000 0.998866 1189.84 1345.42 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1095.006981 Model 2: PositiveSelection -1095.006978 Model 0: one-ratio -1095.006959 Model 7: beta -1095.007008 Model 8: beta&w>1 -1095.006965 Model 0 vs 1 4.399999988891068E-5 Model 2 vs 1 6.000000212225132E-6 Model 8 vs 7 8.600000001024455E-5
>C1 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C2 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C3 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C4 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C5 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C6 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=282 C1 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C2 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C3 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C4 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C5 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C6 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV ************************************************** C1 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C2 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C3 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C4 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C5 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C6 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL ************************************************** C1 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C2 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C3 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C4 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C5 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C6 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR ************************************************** C1 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C2 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C3 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C4 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C5 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C6 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL ************************************************** C1 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C2 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C3 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C4 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C5 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C6 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE ************************************************** C1 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C2 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C3 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C4 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C5 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C6 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ ******************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 282 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 282 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8460] Library Relaxation: Multi_proc [96] Relaxation Summary: [8460]--->[8460] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.487 Mb, Max= 30.825 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C2 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C3 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C4 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C5 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV C6 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV ************************************************** C1 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C2 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C3 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C4 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C5 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL C6 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL ************************************************** C1 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C2 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C3 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C4 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C5 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR C6 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR ************************************************** C1 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C2 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C3 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C4 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C5 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL C6 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL ************************************************** C1 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C2 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C3 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C4 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C5 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE C6 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE ************************************************** C1 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C2 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C3 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C4 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C5 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ C6 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ ******************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT C2 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT C3 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT C4 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT C5 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT C6 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT ************************************************** C1 CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG C2 CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG C3 CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG C4 CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG C5 CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG C6 CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG ************************************************** C1 GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT C2 GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT C3 GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT C4 GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT C5 GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT C6 GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT ************************************************** C1 CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG C2 CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG C3 CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG C4 CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG C5 CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG C6 CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG ************************************************** C1 CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG C2 CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG C3 CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG C4 CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG C5 CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG C6 CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG ************************************************** C1 AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA C2 AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA C3 AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA C4 AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA C5 AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA C6 AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA ************************************************** C1 CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA C2 CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA C3 CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA C4 CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA C5 CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA C6 CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA ************************************************** C1 GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA C2 GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA C3 GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA C4 GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA C5 GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA C6 GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA ************************************************** C1 CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG C2 CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG C3 CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG C4 CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG C5 CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG C6 CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG ************************************************** C1 CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG C2 CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG C3 CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG C4 CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG C5 CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG C6 CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG ************************************************** C1 TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA C2 TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA C3 TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA C4 TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA C5 TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA C6 TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ************************************************** C1 ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA C2 ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA C3 ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA C4 ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA C5 ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA C6 ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ************************************************** C1 ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT C2 ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT C3 ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT C4 ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT C5 ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT C6 ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT ************************************************** C1 GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA C2 GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA C3 GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA C4 GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA C5 GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA C6 GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA ************************************************** C1 GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA C2 GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA C3 GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA C4 GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA C5 GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA C6 GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA ************************************************** C1 GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG C2 GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG C3 GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG C4 GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG C5 GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG C6 GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG ************************************************** C1 GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG C2 GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG C3 GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG C4 GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG C5 GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG C6 GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG ********************************************** >C1 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >C2 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >C3 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >C4 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >C5 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >C6 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >C1 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C2 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C3 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C4 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C5 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >C6 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 846 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579788739 Setting output file names to "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1558313911 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0415189034 Seed = 136573400 Swapseed = 1579788739 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1893.388270 -- -24.965149 Chain 2 -- -1893.388450 -- -24.965149 Chain 3 -- -1893.388559 -- -24.965149 Chain 4 -- -1893.388270 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1893.388450 -- -24.965149 Chain 2 -- -1893.388450 -- -24.965149 Chain 3 -- -1893.388270 -- -24.965149 Chain 4 -- -1893.388559 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1893.388] (-1893.388) (-1893.389) (-1893.388) * [-1893.388] (-1893.388) (-1893.388) (-1893.389) 500 -- (-1161.681) [-1158.657] (-1157.339) (-1173.803) * [-1153.624] (-1162.976) (-1168.415) (-1164.375) -- 0:00:00 1000 -- (-1153.212) (-1154.793) (-1150.599) [-1154.669] * (-1153.914) (-1160.284) (-1164.085) [-1152.554] -- 0:00:00 1500 -- (-1150.434) (-1162.331) [-1154.019] (-1149.276) * (-1151.091) [-1150.227] (-1154.970) (-1164.409) -- 0:00:00 2000 -- (-1153.980) (-1148.186) (-1157.078) [-1151.883] * (-1148.121) [-1151.250] (-1160.384) (-1159.795) -- 0:00:00 2500 -- [-1150.044] (-1150.329) (-1153.538) (-1155.707) * (-1158.911) (-1152.207) [-1151.461] (-1157.035) -- 0:00:00 3000 -- (-1155.158) [-1149.838] (-1150.487) (-1157.473) * (-1150.904) [-1151.747] (-1153.270) (-1157.570) -- 0:00:00 3500 -- (-1156.813) [-1158.249] (-1155.971) (-1159.169) * (-1154.118) (-1155.107) [-1151.691] (-1149.436) -- 0:00:00 4000 -- (-1150.966) [-1154.172] (-1156.666) (-1152.439) * (-1150.771) [-1151.409] (-1159.219) (-1158.384) -- 0:00:00 4500 -- [-1148.401] (-1155.522) (-1158.446) (-1156.887) * (-1155.426) [-1152.839] (-1154.536) (-1152.826) -- 0:00:00 5000 -- (-1156.347) [-1148.321] (-1149.954) (-1150.873) * (-1164.446) (-1154.549) (-1151.317) [-1155.587] -- 0:00:00 Average standard deviation of split frequencies: 0.113486 5500 -- [-1158.133] (-1156.506) (-1169.267) (-1155.072) * (-1156.098) (-1153.496) [-1157.510] (-1152.555) -- 0:00:00 6000 -- (-1149.880) (-1161.909) (-1151.741) [-1154.454] * (-1151.349) [-1152.263] (-1167.018) (-1157.216) -- 0:00:00 6500 -- (-1155.009) (-1151.929) (-1150.143) [-1152.210] * (-1149.923) (-1159.811) [-1154.918] (-1149.479) -- 0:00:00 7000 -- (-1152.399) [-1146.798] (-1157.594) (-1157.431) * [-1152.741] (-1155.855) (-1155.439) (-1162.227) -- 0:00:00 7500 -- (-1154.573) [-1151.930] (-1154.845) (-1161.386) * (-1150.851) (-1154.286) [-1149.403] (-1163.957) -- 0:00:00 8000 -- (-1161.828) (-1153.781) (-1157.296) [-1152.662] * (-1163.365) (-1158.370) (-1149.953) [-1155.866] -- 0:00:00 8500 -- (-1153.941) [-1147.071] (-1157.558) (-1152.830) * [-1154.500] (-1154.202) (-1149.661) (-1154.092) -- 0:00:00 9000 -- (-1158.377) (-1160.285) (-1159.155) [-1154.470] * (-1154.035) (-1155.362) [-1146.723] (-1153.805) -- 0:00:00 9500 -- (-1154.103) (-1151.382) [-1160.242] (-1152.828) * [-1148.265] (-1156.176) (-1159.457) (-1157.381) -- 0:00:00 10000 -- (-1152.660) (-1155.231) (-1152.156) [-1153.811] * [-1152.017] (-1148.391) (-1146.867) (-1157.169) -- 0:00:00 Average standard deviation of split frequencies: 0.044194 10500 -- (-1156.494) [-1154.873] (-1156.470) (-1151.563) * (-1157.349) (-1153.689) [-1150.451] (-1149.836) -- 0:00:00 11000 -- (-1154.811) (-1151.376) [-1149.055] (-1154.245) * [-1150.760] (-1150.625) (-1152.744) (-1155.976) -- 0:01:29 11500 -- (-1153.755) (-1161.774) (-1165.440) [-1153.809] * (-1151.313) (-1148.936) [-1150.698] (-1155.167) -- 0:01:25 12000 -- (-1154.156) [-1150.994] (-1152.992) (-1159.861) * (-1151.677) (-1156.413) [-1157.571] (-1157.586) -- 0:01:22 12500 -- (-1150.393) (-1155.146) [-1152.489] (-1153.017) * (-1164.308) (-1149.873) (-1151.093) [-1152.554] -- 0:01:19 13000 -- (-1152.237) (-1151.040) [-1152.930] (-1150.703) * [-1148.299] (-1153.614) (-1148.418) (-1155.961) -- 0:01:15 13500 -- (-1151.499) [-1151.107] (-1152.709) (-1152.925) * (-1153.171) [-1152.758] (-1159.385) (-1158.931) -- 0:01:13 14000 -- (-1152.280) [-1153.664] (-1152.785) (-1156.447) * (-1156.004) (-1156.154) (-1153.638) [-1150.245] -- 0:01:10 14500 -- (-1156.987) (-1162.683) (-1151.428) [-1150.684] * (-1152.465) (-1155.799) (-1154.015) [-1152.777] -- 0:01:07 15000 -- [-1154.557] (-1149.674) (-1158.855) (-1148.877) * (-1160.596) [-1155.163] (-1161.580) (-1146.272) -- 0:01:05 Average standard deviation of split frequencies: 0.045831 15500 -- (-1158.524) (-1152.884) (-1160.106) [-1154.831] * (-1151.227) (-1154.703) (-1169.456) [-1156.282] -- 0:01:03 16000 -- (-1151.590) [-1159.175] (-1150.541) (-1151.639) * (-1155.650) (-1153.208) [-1146.619] (-1158.984) -- 0:01:01 16500 -- (-1154.180) [-1149.553] (-1155.793) (-1147.576) * [-1148.416] (-1162.429) (-1143.954) (-1155.992) -- 0:00:59 17000 -- (-1152.222) [-1153.544] (-1155.050) (-1163.420) * (-1156.930) (-1152.713) [-1142.818] (-1152.109) -- 0:00:57 17500 -- [-1148.101] (-1149.600) (-1152.830) (-1150.478) * [-1152.756] (-1152.561) (-1143.823) (-1157.272) -- 0:00:56 18000 -- (-1152.466) (-1151.275) (-1167.489) [-1150.832] * (-1166.540) (-1149.704) [-1143.926] (-1160.332) -- 0:00:54 18500 -- (-1154.161) (-1150.771) (-1146.001) [-1148.136] * (-1165.699) (-1156.240) (-1144.616) [-1155.310] -- 0:00:53 19000 -- (-1159.694) (-1150.285) [-1148.414] (-1155.943) * (-1161.750) (-1154.597) (-1144.693) [-1159.885] -- 0:00:51 19500 -- (-1148.449) (-1153.523) [-1145.610] (-1170.054) * (-1160.237) (-1157.808) [-1145.334] (-1151.857) -- 0:00:50 20000 -- (-1142.885) (-1153.297) (-1148.238) [-1159.479] * (-1156.686) (-1157.672) (-1145.547) [-1153.607] -- 0:00:49 Average standard deviation of split frequencies: 0.049041 20500 -- [-1144.329] (-1160.526) (-1144.742) (-1161.013) * (-1151.079) (-1150.193) [-1144.515] (-1155.286) -- 0:00:47 21000 -- (-1145.817) [-1153.305] (-1148.246) (-1157.325) * (-1149.684) (-1153.352) [-1144.151] (-1159.737) -- 0:00:46 21500 -- (-1149.074) (-1155.521) (-1145.686) [-1152.423] * [-1153.220] (-1158.431) (-1146.649) (-1161.779) -- 0:00:45 22000 -- (-1144.476) (-1146.291) [-1144.827] (-1150.979) * (-1150.985) [-1150.091] (-1145.332) (-1155.638) -- 0:00:44 22500 -- (-1144.698) (-1160.306) [-1147.292] (-1157.561) * [-1148.761] (-1149.145) (-1147.468) (-1145.708) -- 0:00:43 23000 -- (-1145.895) [-1152.691] (-1146.419) (-1153.975) * (-1148.708) (-1148.493) (-1148.911) [-1143.218] -- 0:00:42 23500 -- (-1146.411) (-1162.471) [-1144.278] (-1155.426) * [-1154.193] (-1153.272) (-1145.958) (-1143.326) -- 0:00:41 24000 -- (-1143.830) [-1151.539] (-1142.496) (-1152.625) * (-1157.051) (-1151.511) (-1144.839) [-1146.703] -- 0:00:40 24500 -- [-1144.167] (-1153.835) (-1142.486) (-1156.838) * (-1154.441) [-1153.782] (-1148.419) (-1149.820) -- 0:00:39 25000 -- (-1144.546) (-1153.407) [-1142.474] (-1153.742) * (-1158.526) (-1155.605) (-1145.370) [-1143.909] -- 0:01:18 Average standard deviation of split frequencies: 0.039715 25500 -- (-1145.046) [-1151.797] (-1145.729) (-1158.703) * [-1152.304] (-1156.977) (-1143.855) (-1142.878) -- 0:01:16 26000 -- (-1143.229) (-1155.069) (-1146.289) [-1153.551] * (-1152.615) [-1149.246] (-1143.188) (-1143.427) -- 0:01:14 26500 -- [-1144.107] (-1154.054) (-1142.725) (-1153.549) * (-1151.386) (-1154.274) (-1143.475) [-1145.144] -- 0:01:13 27000 -- (-1147.110) (-1149.688) [-1143.707] (-1152.750) * (-1159.317) (-1153.850) (-1144.255) [-1145.635] -- 0:01:12 27500 -- [-1144.858] (-1157.455) (-1144.726) (-1161.070) * (-1160.644) [-1152.193] (-1145.165) (-1147.837) -- 0:01:10 28000 -- (-1143.925) [-1149.541] (-1144.176) (-1152.552) * [-1156.382] (-1155.545) (-1143.858) (-1144.190) -- 0:01:09 28500 -- (-1144.989) (-1149.072) (-1145.919) [-1148.408] * (-1150.971) [-1163.617] (-1143.697) (-1143.599) -- 0:01:08 29000 -- (-1143.049) [-1159.038] (-1148.298) (-1154.838) * (-1160.050) (-1151.075) [-1143.193] (-1144.790) -- 0:01:06 29500 -- (-1146.233) (-1154.864) [-1145.828] (-1152.958) * (-1153.504) [-1156.832] (-1143.335) (-1145.098) -- 0:01:05 30000 -- (-1146.824) (-1163.441) [-1149.108] (-1148.797) * (-1153.079) (-1160.474) (-1146.065) [-1146.013] -- 0:01:04 Average standard deviation of split frequencies: 0.040992 30500 -- (-1145.440) (-1144.097) (-1146.725) [-1156.824] * [-1150.622] (-1162.922) (-1145.084) (-1142.830) -- 0:01:03 31000 -- (-1145.056) [-1144.453] (-1147.121) (-1151.656) * [-1152.517] (-1158.491) (-1146.331) (-1147.731) -- 0:01:02 31500 -- (-1145.156) [-1144.746] (-1146.372) (-1157.939) * (-1156.623) (-1160.164) (-1142.810) [-1144.180] -- 0:01:01 32000 -- (-1142.792) [-1145.834] (-1143.444) (-1149.493) * (-1155.701) [-1144.188] (-1147.930) (-1146.818) -- 0:01:00 32500 -- (-1142.601) (-1150.874) (-1143.435) [-1151.814] * [-1149.205] (-1145.928) (-1150.094) (-1146.595) -- 0:00:59 33000 -- [-1143.882] (-1146.633) (-1151.874) (-1158.683) * [-1149.706] (-1142.751) (-1148.684) (-1144.481) -- 0:00:58 33500 -- (-1143.729) (-1143.629) (-1147.214) [-1152.252] * (-1153.508) (-1143.811) [-1150.726] (-1147.140) -- 0:00:57 34000 -- (-1143.222) [-1147.182] (-1145.838) (-1155.452) * (-1153.273) (-1145.303) (-1147.897) [-1147.038] -- 0:00:56 34500 -- (-1143.126) (-1145.757) (-1147.463) [-1151.389] * [-1155.012] (-1144.275) (-1145.089) (-1144.443) -- 0:00:55 35000 -- (-1144.419) [-1143.926] (-1144.848) (-1146.862) * (-1157.928) (-1145.822) [-1145.160] (-1145.512) -- 0:00:55 Average standard deviation of split frequencies: 0.051131 35500 -- (-1145.337) (-1145.201) [-1144.613] (-1156.909) * [-1154.215] (-1143.572) (-1148.364) (-1147.919) -- 0:00:54 36000 -- [-1147.118] (-1146.371) (-1145.570) (-1151.102) * [-1152.837] (-1143.155) (-1145.623) (-1144.945) -- 0:00:53 36500 -- (-1143.104) [-1143.362] (-1143.858) (-1150.101) * (-1154.311) [-1143.326] (-1144.910) (-1142.948) -- 0:00:52 37000 -- [-1145.497] (-1145.828) (-1144.963) (-1154.498) * [-1152.834] (-1143.763) (-1144.306) (-1143.273) -- 0:00:52 37500 -- [-1145.911] (-1145.347) (-1143.969) (-1155.351) * (-1155.963) (-1144.546) (-1145.572) [-1144.286] -- 0:00:51 38000 -- (-1145.978) [-1142.940] (-1145.907) (-1161.169) * [-1154.917] (-1144.196) (-1144.836) (-1143.176) -- 0:00:50 38500 -- [-1144.698] (-1143.886) (-1143.045) (-1153.488) * (-1152.193) [-1142.676] (-1144.368) (-1143.998) -- 0:00:49 39000 -- (-1146.587) (-1148.441) [-1143.336] (-1152.504) * (-1155.919) [-1144.568] (-1143.293) (-1145.799) -- 0:01:13 39500 -- [-1144.953] (-1143.213) (-1143.699) (-1153.518) * [-1153.353] (-1143.528) (-1143.696) (-1146.713) -- 0:01:12 40000 -- [-1143.518] (-1142.969) (-1145.269) (-1152.332) * [-1151.207] (-1143.534) (-1144.736) (-1144.278) -- 0:01:12 Average standard deviation of split frequencies: 0.049680 40500 -- (-1143.080) (-1146.191) (-1142.684) [-1149.155] * (-1155.136) (-1143.754) (-1144.216) [-1145.885] -- 0:01:11 41000 -- (-1145.236) [-1143.153] (-1143.363) (-1152.643) * [-1153.141] (-1143.662) (-1146.663) (-1145.011) -- 0:01:10 41500 -- (-1144.119) (-1145.472) (-1143.068) [-1150.737] * (-1160.646) (-1143.550) [-1146.580] (-1144.262) -- 0:01:09 42000 -- (-1148.960) (-1145.278) [-1143.770] (-1153.796) * [-1152.724] (-1145.238) (-1148.953) (-1145.847) -- 0:01:08 42500 -- (-1144.366) (-1143.413) [-1143.510] (-1159.509) * (-1154.531) (-1147.943) (-1143.084) [-1144.375] -- 0:01:07 43000 -- [-1143.878] (-1144.186) (-1149.045) (-1158.270) * (-1151.620) (-1143.991) [-1145.443] (-1150.053) -- 0:01:06 43500 -- (-1143.851) [-1143.236] (-1143.323) (-1155.612) * [-1152.317] (-1144.046) (-1145.922) (-1150.901) -- 0:01:05 44000 -- (-1145.352) (-1144.468) (-1143.685) [-1153.633] * (-1156.364) [-1145.172] (-1146.437) (-1147.992) -- 0:01:05 44500 -- [-1145.172] (-1142.809) (-1144.372) (-1155.665) * [-1151.177] (-1142.400) (-1147.702) (-1146.170) -- 0:01:04 45000 -- (-1148.755) [-1146.352] (-1145.929) (-1153.046) * (-1154.327) (-1142.861) (-1150.739) [-1144.350] -- 0:01:03 Average standard deviation of split frequencies: 0.042328 45500 -- (-1143.891) [-1146.870] (-1148.170) (-1161.050) * (-1149.664) [-1145.363] (-1147.477) (-1144.592) -- 0:01:02 46000 -- (-1144.874) (-1145.333) [-1148.802] (-1156.686) * (-1150.491) (-1143.481) (-1151.029) [-1144.330] -- 0:01:02 46500 -- (-1142.508) (-1144.769) (-1145.296) [-1154.285] * (-1151.489) [-1144.142] (-1146.806) (-1143.751) -- 0:01:01 47000 -- (-1145.500) (-1145.385) [-1144.887] (-1161.734) * [-1158.863] (-1143.354) (-1147.304) (-1144.183) -- 0:01:00 47500 -- (-1143.759) (-1144.717) (-1147.241) [-1154.739] * (-1159.364) (-1143.435) [-1146.293] (-1146.572) -- 0:01:00 48000 -- [-1142.947] (-1145.380) (-1144.530) (-1155.300) * [-1154.323] (-1153.585) (-1146.798) (-1151.115) -- 0:00:59 48500 -- (-1146.159) [-1145.665] (-1145.764) (-1161.629) * [-1152.782] (-1148.741) (-1146.039) (-1147.225) -- 0:00:58 49000 -- (-1149.737) [-1146.074] (-1145.784) (-1152.873) * (-1159.857) [-1143.151] (-1144.163) (-1145.979) -- 0:00:58 49500 -- (-1142.800) (-1143.825) (-1143.432) [-1152.989] * [-1156.269] (-1148.142) (-1143.822) (-1145.755) -- 0:00:57 50000 -- [-1142.805] (-1143.991) (-1147.552) (-1151.514) * (-1151.871) (-1143.876) (-1144.323) [-1146.743] -- 0:00:57 Average standard deviation of split frequencies: 0.046077 50500 -- (-1144.320) (-1144.870) (-1145.072) [-1153.608] * (-1160.544) [-1143.906] (-1144.076) (-1143.157) -- 0:00:56 51000 -- (-1144.095) (-1143.476) [-1147.582] (-1154.836) * (-1150.930) (-1144.998) [-1145.080] (-1145.924) -- 0:00:55 51500 -- (-1145.945) [-1143.974] (-1147.688) (-1159.344) * (-1150.241) [-1144.091] (-1144.364) (-1144.481) -- 0:00:55 52000 -- (-1152.783) (-1145.018) [-1143.827] (-1157.750) * (-1152.651) [-1147.871] (-1145.981) (-1146.912) -- 0:00:54 52500 -- (-1145.964) [-1143.987] (-1147.919) (-1158.255) * [-1157.378] (-1144.109) (-1143.526) (-1144.820) -- 0:00:54 53000 -- (-1143.612) [-1144.081] (-1144.269) (-1151.654) * [-1147.402] (-1142.779) (-1144.462) (-1146.516) -- 0:00:53 53500 -- (-1144.617) [-1147.001] (-1147.866) (-1150.797) * (-1150.687) (-1142.685) [-1143.462] (-1145.991) -- 0:00:53 54000 -- (-1143.434) [-1150.723] (-1146.440) (-1156.177) * (-1152.255) (-1142.777) (-1146.699) [-1143.027] -- 0:00:52 54500 -- (-1144.299) (-1148.546) [-1143.902] (-1153.235) * [-1152.045] (-1144.484) (-1144.848) (-1144.049) -- 0:01:09 55000 -- (-1145.677) (-1143.971) [-1144.421] (-1161.330) * [-1157.200] (-1145.836) (-1144.220) (-1145.695) -- 0:01:08 Average standard deviation of split frequencies: 0.050508 55500 -- [-1143.205] (-1143.427) (-1143.487) (-1156.211) * [-1152.725] (-1144.088) (-1143.053) (-1145.732) -- 0:01:08 56000 -- (-1143.197) [-1147.999] (-1143.661) (-1157.513) * (-1154.780) (-1144.674) [-1143.657] (-1144.591) -- 0:01:07 56500 -- (-1142.867) [-1144.469] (-1145.982) (-1154.013) * (-1152.798) [-1144.308] (-1142.871) (-1145.375) -- 0:01:06 57000 -- [-1144.441] (-1146.800) (-1146.236) (-1154.873) * (-1152.549) [-1145.421] (-1145.691) (-1145.967) -- 0:01:06 57500 -- (-1145.217) [-1146.103] (-1143.497) (-1150.760) * [-1152.182] (-1147.124) (-1145.673) (-1144.479) -- 0:01:05 58000 -- [-1144.278] (-1146.073) (-1148.716) (-1152.868) * (-1148.735) [-1144.383] (-1146.978) (-1142.510) -- 0:01:04 58500 -- (-1145.785) (-1146.382) [-1143.909] (-1153.913) * [-1150.210] (-1150.378) (-1144.789) (-1143.103) -- 0:01:04 59000 -- [-1143.979] (-1146.732) (-1143.738) (-1156.475) * (-1158.838) [-1148.663] (-1144.690) (-1143.022) -- 0:01:03 59500 -- (-1145.227) (-1144.907) (-1143.451) [-1151.727] * (-1150.055) [-1145.486] (-1145.281) (-1143.038) -- 0:01:03 60000 -- (-1147.910) (-1151.350) [-1144.144] (-1157.703) * (-1168.525) (-1145.581) (-1143.492) [-1143.997] -- 0:01:02 Average standard deviation of split frequencies: 0.052348 60500 -- (-1147.657) [-1144.054] (-1148.654) (-1160.510) * (-1145.468) [-1147.264] (-1152.952) (-1145.940) -- 0:01:02 61000 -- (-1148.206) (-1143.925) (-1149.443) [-1147.569] * (-1144.549) (-1147.232) [-1146.812] (-1143.737) -- 0:01:01 61500 -- (-1150.569) [-1143.047] (-1147.820) (-1151.020) * [-1143.735] (-1153.498) (-1144.155) (-1150.026) -- 0:01:01 62000 -- (-1144.399) (-1146.034) (-1149.080) [-1147.892] * [-1147.673] (-1147.365) (-1143.238) (-1145.920) -- 0:01:00 62500 -- (-1146.607) (-1144.678) (-1145.889) [-1154.114] * (-1145.235) (-1143.657) (-1149.590) [-1143.254] -- 0:01:00 63000 -- (-1144.300) (-1145.127) [-1145.861] (-1152.754) * (-1143.381) (-1146.053) [-1146.276] (-1150.380) -- 0:00:59 63500 -- (-1143.652) (-1144.442) [-1145.493] (-1153.744) * (-1145.516) [-1146.070] (-1147.105) (-1145.103) -- 0:00:58 64000 -- (-1143.047) [-1147.161] (-1145.930) (-1156.700) * (-1145.196) [-1145.184] (-1149.140) (-1144.584) -- 0:00:58 64500 -- (-1144.742) [-1151.223] (-1145.214) (-1159.159) * (-1143.356) [-1144.528] (-1145.698) (-1145.076) -- 0:00:58 65000 -- (-1142.548) [-1144.379] (-1146.366) (-1153.051) * [-1144.193] (-1147.626) (-1144.944) (-1143.845) -- 0:00:57 Average standard deviation of split frequencies: 0.042855 65500 -- [-1146.834] (-1144.133) (-1142.835) (-1156.581) * (-1144.014) (-1145.218) [-1147.559] (-1143.821) -- 0:00:57 66000 -- (-1142.782) (-1143.054) [-1142.830] (-1153.210) * (-1143.744) [-1144.364] (-1145.181) (-1144.931) -- 0:00:56 66500 -- (-1142.499) (-1143.363) [-1148.001] (-1151.805) * (-1143.995) (-1143.934) (-1145.093) [-1145.688] -- 0:00:56 67000 -- [-1144.452] (-1143.283) (-1151.291) (-1152.474) * (-1144.319) (-1143.395) (-1145.520) [-1143.097] -- 0:00:55 67500 -- (-1144.350) (-1143.481) [-1147.152] (-1161.778) * (-1146.942) (-1142.395) [-1146.229] (-1145.969) -- 0:00:55 68000 -- (-1144.311) (-1142.687) [-1145.888] (-1151.471) * (-1145.482) (-1144.034) [-1145.329] (-1149.307) -- 0:00:54 68500 -- [-1146.031] (-1145.978) (-1144.322) (-1157.728) * [-1143.412] (-1143.386) (-1144.426) (-1143.588) -- 0:00:54 69000 -- (-1146.026) (-1145.932) [-1143.372] (-1152.265) * [-1142.452] (-1143.978) (-1152.924) (-1145.114) -- 0:00:53 69500 -- (-1144.851) (-1146.873) [-1145.211] (-1158.888) * (-1143.414) [-1144.520] (-1151.886) (-1144.054) -- 0:00:53 70000 -- (-1143.314) (-1144.214) (-1146.817) [-1151.893] * (-1146.209) [-1143.675] (-1148.924) (-1145.137) -- 0:01:06 Average standard deviation of split frequencies: 0.042834 70500 -- (-1145.628) (-1143.710) [-1145.440] (-1156.680) * (-1148.199) [-1144.051] (-1146.320) (-1144.817) -- 0:01:05 71000 -- (-1145.927) [-1145.737] (-1148.667) (-1152.379) * (-1147.125) (-1143.751) [-1145.456] (-1148.467) -- 0:01:05 71500 -- (-1143.885) (-1152.178) (-1147.596) [-1150.780] * [-1145.929] (-1143.635) (-1144.185) (-1144.930) -- 0:01:04 72000 -- (-1144.006) (-1146.323) [-1146.562] (-1159.819) * [-1145.287] (-1145.545) (-1145.337) (-1143.691) -- 0:01:04 72500 -- (-1143.439) [-1143.570] (-1147.385) (-1150.695) * (-1143.258) (-1147.133) (-1147.054) [-1143.693] -- 0:01:03 73000 -- (-1143.445) [-1142.921] (-1145.789) (-1153.304) * (-1143.739) [-1144.897] (-1142.681) (-1145.716) -- 0:01:03 73500 -- (-1144.522) [-1145.082] (-1144.284) (-1154.317) * [-1143.981] (-1144.308) (-1142.517) (-1147.223) -- 0:01:03 74000 -- [-1144.883] (-1146.484) (-1146.998) (-1157.092) * (-1143.579) [-1145.692] (-1145.214) (-1144.603) -- 0:01:02 74500 -- (-1145.657) [-1144.158] (-1145.468) (-1150.015) * (-1143.304) [-1142.767] (-1144.917) (-1144.296) -- 0:01:02 75000 -- (-1146.459) (-1144.344) [-1146.163] (-1155.887) * (-1148.918) [-1143.206] (-1144.386) (-1144.831) -- 0:01:01 Average standard deviation of split frequencies: 0.040154 75500 -- (-1143.328) (-1146.153) [-1144.905] (-1152.798) * (-1150.065) (-1145.462) [-1146.476] (-1144.423) -- 0:01:01 76000 -- [-1145.474] (-1146.690) (-1144.188) (-1154.469) * (-1143.617) (-1146.525) (-1147.125) [-1144.444] -- 0:01:00 76500 -- (-1144.580) (-1144.316) [-1143.558] (-1152.958) * (-1144.255) (-1149.419) [-1144.436] (-1142.971) -- 0:01:00 77000 -- [-1143.684] (-1144.515) (-1144.432) (-1157.228) * (-1148.681) (-1150.103) (-1144.015) [-1145.815] -- 0:00:59 77500 -- (-1146.281) (-1144.531) [-1143.923] (-1154.526) * (-1146.402) (-1147.071) (-1149.705) [-1145.796] -- 0:00:59 78000 -- (-1145.171) [-1144.615] (-1143.131) (-1154.830) * (-1149.148) (-1146.604) (-1145.130) [-1144.640] -- 0:00:59 78500 -- (-1147.455) [-1144.752] (-1144.218) (-1151.398) * (-1144.382) (-1144.060) (-1148.926) [-1143.992] -- 0:00:58 79000 -- (-1146.056) (-1146.638) (-1149.262) [-1157.996] * (-1146.063) (-1144.805) (-1151.881) [-1143.801] -- 0:00:58 79500 -- [-1144.234] (-1144.520) (-1145.577) (-1149.167) * (-1146.076) (-1144.690) [-1148.474] (-1143.843) -- 0:00:57 80000 -- (-1145.626) [-1146.674] (-1143.226) (-1151.879) * (-1145.509) (-1145.221) (-1144.231) [-1146.186] -- 0:00:57 Average standard deviation of split frequencies: 0.036293 80500 -- (-1149.860) (-1145.515) (-1143.832) [-1150.989] * [-1148.461] (-1145.603) (-1146.214) (-1148.242) -- 0:00:57 81000 -- (-1146.582) (-1150.387) (-1142.850) [-1155.458] * [-1145.071] (-1144.331) (-1147.707) (-1143.766) -- 0:00:56 81500 -- (-1144.530) (-1149.774) (-1147.461) [-1155.363] * (-1144.929) (-1146.040) [-1146.713] (-1149.277) -- 0:00:56 82000 -- [-1145.315] (-1146.787) (-1146.481) (-1157.021) * (-1143.426) (-1143.595) [-1148.356] (-1146.223) -- 0:00:55 82500 -- (-1146.881) (-1146.078) (-1148.274) [-1142.745] * (-1143.026) (-1143.413) (-1145.461) [-1146.270] -- 0:00:55 83000 -- (-1146.972) (-1145.093) [-1144.564] (-1142.445) * (-1145.575) (-1143.894) (-1144.240) [-1143.967] -- 0:00:55 83500 -- (-1144.817) (-1145.299) (-1143.839) [-1143.885] * (-1146.607) (-1147.950) (-1144.463) [-1144.914] -- 0:00:54 84000 -- (-1150.744) [-1144.853] (-1145.965) (-1142.653) * (-1146.607) [-1143.680] (-1151.405) (-1145.600) -- 0:00:54 84500 -- (-1146.003) (-1144.968) [-1144.346] (-1149.446) * (-1143.798) (-1146.117) (-1149.941) [-1142.696] -- 0:00:54 85000 -- (-1144.745) (-1145.619) (-1143.347) [-1145.284] * (-1146.454) [-1144.099] (-1150.627) (-1142.474) -- 0:00:53 Average standard deviation of split frequencies: 0.033802 85500 -- (-1144.707) (-1148.570) (-1142.986) [-1142.918] * (-1147.509) (-1143.673) (-1150.498) [-1143.131] -- 0:00:53 86000 -- (-1143.329) (-1144.953) [-1143.897] (-1144.789) * [-1144.474] (-1148.086) (-1146.489) (-1144.900) -- 0:00:53 86500 -- (-1143.053) (-1144.009) (-1143.979) [-1144.215] * (-1147.144) (-1147.554) (-1145.840) [-1142.563] -- 0:01:03 87000 -- (-1143.581) [-1144.740] (-1146.502) (-1145.948) * (-1147.505) (-1147.970) [-1146.037] (-1147.334) -- 0:01:02 87500 -- (-1144.941) (-1144.147) [-1143.346] (-1144.538) * [-1144.056] (-1147.623) (-1143.865) (-1146.517) -- 0:01:02 88000 -- (-1144.227) (-1145.933) [-1144.924] (-1144.520) * (-1144.122) [-1148.161] (-1146.227) (-1144.069) -- 0:01:02 88500 -- (-1145.746) (-1145.125) [-1145.404] (-1142.665) * [-1145.272] (-1146.424) (-1145.574) (-1145.100) -- 0:01:01 89000 -- [-1143.001] (-1143.639) (-1147.530) (-1143.381) * (-1144.040) [-1146.099] (-1145.810) (-1142.880) -- 0:01:01 89500 -- (-1142.882) [-1143.871] (-1143.623) (-1146.072) * [-1143.824] (-1146.404) (-1144.103) (-1143.695) -- 0:01:01 90000 -- (-1145.274) (-1144.496) (-1144.790) [-1144.724] * (-1144.113) (-1147.217) [-1145.202] (-1143.294) -- 0:01:00 Average standard deviation of split frequencies: 0.030701 90500 -- (-1147.050) (-1146.671) (-1146.855) [-1147.567] * [-1144.492] (-1146.498) (-1144.439) (-1145.790) -- 0:01:00 91000 -- [-1144.717] (-1145.105) (-1145.484) (-1147.273) * (-1146.634) (-1144.388) (-1146.863) [-1144.151] -- 0:00:59 91500 -- [-1144.088] (-1143.415) (-1142.289) (-1144.494) * (-1146.336) (-1145.442) [-1145.263] (-1151.240) -- 0:00:59 92000 -- (-1146.094) (-1143.393) [-1143.136] (-1144.211) * (-1143.550) (-1150.407) [-1143.345] (-1149.552) -- 0:00:59 92500 -- (-1144.949) (-1144.039) [-1145.865] (-1144.184) * [-1145.416] (-1145.238) (-1145.456) (-1153.179) -- 0:00:58 93000 -- (-1146.353) (-1147.368) [-1148.720] (-1143.437) * (-1143.623) [-1144.196] (-1147.419) (-1149.167) -- 0:00:58 93500 -- (-1145.239) (-1145.474) (-1143.661) [-1144.692] * [-1143.623] (-1144.580) (-1146.879) (-1144.547) -- 0:00:58 94000 -- (-1143.521) (-1143.083) (-1144.002) [-1143.809] * (-1144.246) (-1144.744) (-1144.271) [-1144.316] -- 0:00:57 94500 -- (-1144.191) (-1143.275) [-1147.568] (-1143.724) * (-1144.123) (-1145.127) (-1144.185) [-1146.228] -- 0:00:57 95000 -- (-1144.590) [-1148.905] (-1149.690) (-1144.285) * (-1144.259) (-1143.816) (-1143.289) [-1148.337] -- 0:00:57 Average standard deviation of split frequencies: 0.032564 95500 -- [-1144.937] (-1149.505) (-1142.635) (-1143.482) * (-1144.491) (-1144.705) [-1144.771] (-1147.251) -- 0:00:56 96000 -- (-1146.091) (-1148.060) (-1143.279) [-1143.068] * (-1144.600) (-1145.989) (-1143.467) [-1144.184] -- 0:00:56 96500 -- (-1146.635) (-1145.809) [-1143.984] (-1144.523) * (-1144.492) (-1145.175) [-1146.585] (-1144.036) -- 0:00:56 97000 -- (-1152.574) (-1143.807) (-1143.891) [-1144.073] * [-1144.923] (-1144.015) (-1143.631) (-1144.732) -- 0:00:55 97500 -- (-1154.054) (-1143.988) (-1144.935) [-1143.778] * (-1143.965) [-1143.855] (-1144.495) (-1143.129) -- 0:00:55 98000 -- (-1146.948) (-1144.432) (-1150.563) [-1142.867] * (-1142.627) (-1146.002) (-1147.950) [-1144.213] -- 0:00:55 98500 -- (-1144.022) (-1144.170) [-1145.507] (-1144.004) * (-1144.328) (-1143.961) [-1143.511] (-1145.920) -- 0:00:54 99000 -- (-1145.207) (-1145.269) [-1144.451] (-1144.645) * (-1143.376) [-1145.244] (-1142.854) (-1144.845) -- 0:00:54 99500 -- (-1144.124) (-1143.940) [-1143.494] (-1148.379) * (-1143.376) (-1144.818) (-1143.534) [-1143.970] -- 0:00:54 100000 -- (-1143.767) (-1143.585) [-1145.034] (-1148.547) * [-1144.255] (-1145.072) (-1144.064) (-1145.592) -- 0:00:54 Average standard deviation of split frequencies: 0.029918 100500 -- (-1147.435) [-1143.745] (-1145.936) (-1146.519) * (-1147.236) (-1143.686) (-1143.023) [-1145.847] -- 0:00:53 101000 -- [-1145.521] (-1145.410) (-1144.500) (-1145.298) * [-1145.512] (-1145.933) (-1147.348) (-1146.190) -- 0:00:53 101500 -- (-1145.466) (-1144.256) (-1144.704) [-1145.431] * (-1146.266) [-1144.987] (-1143.214) (-1146.428) -- 0:00:53 102000 -- (-1146.440) (-1144.693) (-1148.119) [-1146.240] * (-1146.004) (-1149.808) [-1142.936] (-1145.342) -- 0:00:52 102500 -- (-1144.628) (-1146.019) (-1146.084) [-1145.014] * (-1144.009) (-1144.904) (-1144.297) [-1144.434] -- 0:01:01 103000 -- (-1144.444) (-1145.776) [-1143.428] (-1145.740) * (-1143.589) [-1147.410] (-1150.635) (-1146.273) -- 0:01:00 103500 -- (-1143.960) (-1145.248) [-1144.630] (-1144.659) * (-1143.583) (-1143.211) [-1146.488] (-1150.854) -- 0:01:00 104000 -- (-1145.066) (-1144.048) [-1144.926] (-1149.335) * (-1145.860) (-1150.049) [-1144.239] (-1145.729) -- 0:01:00 104500 -- (-1147.805) [-1142.614] (-1143.328) (-1143.134) * (-1146.854) (-1145.434) (-1144.542) [-1145.623] -- 0:00:59 105000 -- [-1148.697] (-1145.666) (-1144.114) (-1144.047) * (-1144.658) (-1145.752) [-1145.077] (-1145.915) -- 0:00:59 Average standard deviation of split frequencies: 0.027128 105500 -- (-1148.529) (-1146.307) [-1144.229] (-1148.522) * (-1142.521) (-1149.775) [-1144.523] (-1144.621) -- 0:00:59 106000 -- (-1144.221) (-1148.572) [-1144.057] (-1144.262) * (-1145.587) (-1146.424) (-1144.916) [-1143.819] -- 0:00:59 106500 -- (-1148.801) (-1146.177) (-1147.430) [-1146.154] * (-1145.044) (-1143.949) (-1143.489) [-1143.412] -- 0:00:58 107000 -- (-1147.692) (-1143.613) [-1145.847] (-1144.962) * (-1151.058) (-1146.131) (-1144.050) [-1146.280] -- 0:00:58 107500 -- [-1145.219] (-1143.854) (-1150.276) (-1146.062) * (-1149.348) (-1147.724) [-1142.791] (-1143.607) -- 0:00:58 108000 -- (-1148.518) [-1143.854] (-1147.895) (-1143.108) * (-1145.951) [-1146.846] (-1143.413) (-1144.053) -- 0:00:57 108500 -- [-1148.226] (-1143.743) (-1149.279) (-1143.071) * (-1144.814) (-1146.032) [-1143.957] (-1145.079) -- 0:00:57 109000 -- (-1145.915) (-1149.683) (-1146.348) [-1142.970] * (-1146.229) [-1148.417] (-1146.901) (-1143.249) -- 0:00:57 109500 -- (-1149.603) [-1147.597] (-1143.982) (-1142.892) * [-1143.945] (-1145.575) (-1145.011) (-1144.151) -- 0:00:56 110000 -- (-1145.207) (-1150.326) [-1143.276] (-1142.844) * (-1143.940) (-1147.205) (-1145.028) [-1147.090] -- 0:00:56 Average standard deviation of split frequencies: 0.027262 110500 -- (-1143.846) (-1145.940) [-1143.899] (-1143.551) * (-1143.824) [-1143.830] (-1143.262) (-1142.470) -- 0:00:56 111000 -- [-1144.664] (-1148.391) (-1143.012) (-1146.258) * (-1142.906) (-1145.476) (-1144.195) [-1142.470] -- 0:00:56 111500 -- [-1144.724] (-1147.339) (-1144.381) (-1142.624) * (-1145.028) (-1144.994) [-1143.581] (-1143.726) -- 0:00:55 112000 -- (-1145.212) (-1144.651) [-1143.549] (-1144.999) * (-1145.215) (-1144.693) [-1144.288] (-1144.231) -- 0:00:55 112500 -- (-1144.249) [-1144.082] (-1149.042) (-1143.255) * (-1143.080) (-1145.106) (-1144.224) [-1143.134] -- 0:00:55 113000 -- (-1144.303) (-1146.369) (-1146.529) [-1143.901] * (-1144.540) (-1148.004) [-1145.439] (-1142.965) -- 0:00:54 113500 -- (-1144.488) (-1153.536) (-1147.463) [-1143.930] * (-1146.490) (-1144.225) [-1144.951] (-1143.917) -- 0:00:54 114000 -- (-1146.327) [-1145.150] (-1144.399) (-1143.847) * [-1146.195] (-1143.863) (-1144.139) (-1144.774) -- 0:00:54 114500 -- (-1145.514) (-1144.876) (-1146.289) [-1145.719] * (-1149.629) (-1145.003) (-1144.221) [-1143.371] -- 0:00:54 115000 -- [-1143.361] (-1145.359) (-1146.106) (-1144.249) * (-1144.929) (-1147.804) (-1142.880) [-1143.373] -- 0:00:53 Average standard deviation of split frequencies: 0.023977 115500 -- (-1144.276) (-1144.030) [-1144.600] (-1147.567) * [-1143.991] (-1147.315) (-1144.702) (-1142.458) -- 0:00:53 116000 -- [-1145.013] (-1146.151) (-1143.469) (-1143.961) * (-1144.607) [-1148.118] (-1144.176) (-1144.107) -- 0:00:53 116500 -- (-1143.101) (-1145.326) (-1142.789) [-1143.986] * (-1149.230) (-1145.419) (-1144.947) [-1145.665] -- 0:00:53 117000 -- (-1144.160) (-1147.235) [-1142.788] (-1147.254) * [-1146.191] (-1145.116) (-1144.075) (-1146.133) -- 0:00:52 117500 -- (-1142.915) [-1144.833] (-1145.894) (-1144.661) * (-1144.917) (-1149.196) (-1144.262) [-1142.810] -- 0:00:52 118000 -- (-1145.100) (-1146.742) (-1146.483) [-1142.733] * [-1143.996] (-1145.822) (-1144.375) (-1144.289) -- 0:00:52 118500 -- (-1146.002) (-1144.460) (-1144.291) [-1144.538] * (-1144.209) [-1143.595] (-1145.256) (-1144.451) -- 0:00:52 119000 -- [-1143.959] (-1142.342) (-1145.279) (-1144.561) * (-1147.710) (-1144.624) (-1146.051) [-1145.061] -- 0:00:59 119500 -- (-1144.448) [-1142.804] (-1149.793) (-1145.545) * [-1142.836] (-1144.268) (-1147.847) (-1145.912) -- 0:00:58 120000 -- (-1144.599) (-1142.807) (-1147.586) [-1143.615] * (-1144.200) (-1143.859) [-1145.265] (-1143.106) -- 0:00:58 Average standard deviation of split frequencies: 0.021795 120500 -- (-1144.277) (-1142.689) [-1146.983] (-1145.444) * (-1145.187) [-1143.044] (-1143.844) (-1146.893) -- 0:00:58 121000 -- (-1143.810) (-1144.684) [-1147.321] (-1146.344) * (-1146.622) [-1144.483] (-1146.056) (-1147.879) -- 0:00:58 121500 -- (-1148.953) (-1143.133) (-1144.734) [-1144.662] * (-1147.227) (-1143.620) [-1146.489] (-1149.274) -- 0:00:57 122000 -- (-1146.292) (-1143.725) [-1143.840] (-1145.576) * (-1146.186) (-1143.620) (-1145.049) [-1144.068] -- 0:00:57 122500 -- (-1146.597) [-1143.828] (-1146.175) (-1145.574) * [-1143.794] (-1143.416) (-1145.571) (-1143.736) -- 0:00:57 123000 -- (-1143.300) [-1142.974] (-1148.640) (-1147.665) * (-1144.038) (-1143.774) [-1146.852] (-1143.132) -- 0:00:57 123500 -- (-1143.587) (-1142.748) [-1145.850] (-1152.514) * (-1144.485) (-1145.800) (-1144.772) [-1144.897] -- 0:00:56 124000 -- (-1144.191) [-1145.585] (-1148.719) (-1144.956) * (-1144.892) (-1145.160) (-1145.598) [-1146.327] -- 0:00:56 124500 -- (-1144.226) [-1142.681] (-1146.740) (-1146.054) * (-1144.233) [-1145.014] (-1143.538) (-1143.921) -- 0:00:56 125000 -- (-1144.855) (-1143.764) [-1145.692] (-1144.142) * (-1146.805) [-1142.962] (-1144.183) (-1144.950) -- 0:00:56 Average standard deviation of split frequencies: 0.020310 125500 -- (-1145.470) (-1144.070) [-1144.976] (-1143.422) * (-1146.070) (-1143.336) [-1143.056] (-1143.018) -- 0:00:55 126000 -- [-1143.732] (-1144.630) (-1144.388) (-1143.003) * (-1146.949) (-1145.129) [-1144.105] (-1144.273) -- 0:00:55 126500 -- (-1143.770) (-1142.413) [-1144.289] (-1143.690) * [-1144.328] (-1146.168) (-1145.301) (-1145.068) -- 0:00:55 127000 -- (-1144.218) (-1143.800) (-1145.094) [-1144.076] * (-1143.385) (-1145.439) (-1143.335) [-1145.146] -- 0:00:54 127500 -- (-1145.482) (-1147.216) [-1143.949] (-1143.519) * (-1143.308) [-1148.743] (-1143.582) (-1144.112) -- 0:00:54 128000 -- [-1144.564] (-1145.744) (-1145.147) (-1144.685) * (-1146.551) (-1147.108) (-1145.058) [-1144.214] -- 0:00:54 128500 -- (-1144.988) (-1142.693) (-1147.740) [-1146.072] * (-1144.407) [-1145.403] (-1145.179) (-1143.648) -- 0:00:54 129000 -- (-1144.223) [-1143.305] (-1144.774) (-1146.960) * [-1144.869] (-1143.548) (-1146.167) (-1144.211) -- 0:00:54 129500 -- [-1143.422] (-1144.186) (-1145.670) (-1143.828) * (-1145.065) (-1143.640) (-1144.950) [-1144.160] -- 0:00:53 130000 -- [-1143.184] (-1145.113) (-1148.300) (-1143.810) * (-1144.957) (-1143.739) [-1145.637] (-1144.234) -- 0:00:53 Average standard deviation of split frequencies: 0.022026 130500 -- [-1142.760] (-1144.317) (-1147.181) (-1147.965) * (-1145.218) [-1143.177] (-1142.738) (-1145.812) -- 0:00:53 131000 -- (-1144.274) (-1145.307) (-1144.175) [-1145.728] * (-1143.116) (-1143.980) (-1145.601) [-1145.150] -- 0:00:53 131500 -- (-1145.267) (-1144.048) (-1143.681) [-1143.846] * [-1144.675] (-1146.035) (-1144.430) (-1144.826) -- 0:00:52 132000 -- (-1143.791) (-1143.863) (-1143.563) [-1144.255] * (-1144.501) (-1145.569) (-1149.838) [-1142.789] -- 0:00:52 132500 -- [-1145.067] (-1144.059) (-1146.648) (-1146.840) * [-1143.487] (-1143.700) (-1147.658) (-1142.787) -- 0:00:52 133000 -- [-1146.021] (-1145.414) (-1146.634) (-1144.552) * (-1145.490) (-1143.222) (-1145.826) [-1144.486] -- 0:00:52 133500 -- (-1143.846) (-1148.178) [-1145.921] (-1143.279) * [-1143.047] (-1145.635) (-1147.563) (-1143.415) -- 0:00:51 134000 -- [-1143.901] (-1146.658) (-1145.835) (-1144.891) * (-1148.436) [-1143.344] (-1143.882) (-1146.051) -- 0:00:51 134500 -- [-1146.359] (-1145.924) (-1147.344) (-1144.019) * (-1147.842) (-1145.440) [-1144.689] (-1144.171) -- 0:00:51 135000 -- [-1142.906] (-1143.907) (-1145.710) (-1143.895) * (-1145.716) (-1143.300) [-1143.616] (-1147.481) -- 0:00:51 Average standard deviation of split frequencies: 0.019982 135500 -- (-1143.415) [-1143.920] (-1144.032) (-1144.462) * [-1145.338] (-1142.979) (-1143.722) (-1149.887) -- 0:00:57 136000 -- [-1145.001] (-1146.206) (-1143.787) (-1143.353) * [-1143.814] (-1144.044) (-1143.714) (-1150.903) -- 0:00:57 136500 -- [-1148.882] (-1144.857) (-1146.266) (-1143.257) * (-1143.092) (-1147.897) [-1144.904] (-1149.104) -- 0:00:56 137000 -- [-1149.043] (-1144.348) (-1149.066) (-1143.006) * (-1148.257) [-1142.332] (-1150.759) (-1145.527) -- 0:00:56 137500 -- [-1145.061] (-1144.965) (-1152.065) (-1145.527) * (-1148.637) (-1143.243) [-1146.909] (-1143.809) -- 0:00:56 138000 -- (-1144.415) (-1144.234) [-1144.288] (-1144.111) * (-1143.360) [-1142.862] (-1144.442) (-1145.148) -- 0:00:56 138500 -- (-1146.599) (-1147.228) [-1145.499] (-1142.800) * [-1145.744] (-1145.353) (-1145.902) (-1144.693) -- 0:00:55 139000 -- (-1143.285) (-1146.959) [-1142.628] (-1146.489) * [-1145.923] (-1145.782) (-1151.562) (-1146.006) -- 0:00:55 139500 -- [-1143.812] (-1143.491) (-1143.272) (-1149.615) * [-1144.471] (-1144.617) (-1145.412) (-1146.181) -- 0:00:55 140000 -- (-1147.139) [-1145.690] (-1143.707) (-1145.593) * [-1144.171] (-1146.864) (-1143.672) (-1148.384) -- 0:00:55 Average standard deviation of split frequencies: 0.017545 140500 -- [-1146.031] (-1145.891) (-1146.027) (-1146.490) * [-1144.358] (-1147.997) (-1145.519) (-1145.358) -- 0:00:55 141000 -- [-1146.717] (-1145.853) (-1150.098) (-1146.843) * (-1144.758) [-1149.690] (-1143.473) (-1142.978) -- 0:00:54 141500 -- (-1143.610) [-1143.416] (-1144.379) (-1144.962) * [-1142.728] (-1145.021) (-1142.793) (-1144.141) -- 0:00:54 142000 -- (-1143.183) (-1143.587) (-1144.538) [-1144.273] * (-1145.267) (-1143.758) [-1143.695] (-1146.282) -- 0:00:54 142500 -- (-1144.292) (-1146.435) [-1143.140] (-1144.702) * (-1146.934) (-1143.231) (-1147.251) [-1143.586] -- 0:00:54 143000 -- (-1146.540) (-1143.994) (-1145.844) [-1143.287] * (-1146.253) (-1144.073) [-1148.136] (-1144.288) -- 0:00:53 143500 -- (-1146.888) (-1143.673) [-1147.169] (-1145.842) * (-1145.429) (-1144.416) (-1145.709) [-1146.055] -- 0:00:53 144000 -- [-1144.160] (-1143.368) (-1148.599) (-1145.794) * (-1146.287) [-1143.940] (-1144.992) (-1146.116) -- 0:00:53 144500 -- (-1145.928) (-1145.209) [-1148.063] (-1143.767) * (-1144.644) (-1144.184) [-1145.171] (-1147.542) -- 0:00:53 145000 -- (-1145.100) [-1145.489] (-1150.459) (-1144.749) * [-1144.755] (-1144.667) (-1147.559) (-1144.477) -- 0:00:53 Average standard deviation of split frequencies: 0.017758 145500 -- [-1146.781] (-1143.212) (-1145.563) (-1149.718) * (-1143.117) [-1143.972] (-1147.899) (-1143.023) -- 0:00:52 146000 -- (-1146.823) (-1145.905) [-1145.090] (-1145.087) * (-1143.173) [-1144.800] (-1144.901) (-1143.362) -- 0:00:52 146500 -- (-1145.609) (-1146.044) (-1143.821) [-1145.875] * (-1143.200) (-1145.225) (-1146.097) [-1143.646] -- 0:00:52 147000 -- (-1146.074) [-1144.227] (-1143.916) (-1145.837) * (-1149.085) [-1143.334] (-1144.772) (-1144.848) -- 0:00:52 147500 -- (-1144.471) (-1144.478) [-1143.547] (-1147.096) * [-1143.962] (-1144.611) (-1145.618) (-1142.659) -- 0:00:52 148000 -- [-1145.035] (-1144.001) (-1144.316) (-1145.283) * (-1146.015) (-1144.655) (-1145.058) [-1142.791] -- 0:00:51 148500 -- (-1143.898) (-1146.314) (-1144.471) [-1144.239] * (-1145.523) [-1144.652] (-1144.143) (-1146.764) -- 0:00:51 149000 -- (-1147.145) (-1151.633) (-1151.468) [-1144.457] * [-1143.020] (-1144.718) (-1145.568) (-1145.265) -- 0:00:51 149500 -- (-1147.982) (-1148.266) [-1149.885] (-1143.664) * (-1143.395) (-1145.547) (-1148.431) [-1143.350] -- 0:00:51 150000 -- (-1147.545) (-1144.945) (-1143.387) [-1143.343] * (-1147.026) (-1145.276) (-1148.434) [-1146.023] -- 0:00:51 Average standard deviation of split frequencies: 0.016513 150500 -- (-1150.946) [-1144.951] (-1143.889) (-1144.271) * (-1144.265) (-1144.395) (-1146.948) [-1146.673] -- 0:00:50 151000 -- (-1146.435) [-1142.829] (-1144.044) (-1146.172) * (-1145.980) [-1147.402] (-1148.793) (-1147.127) -- 0:00:50 151500 -- (-1144.890) (-1143.028) [-1144.948] (-1144.743) * (-1143.648) (-1144.553) (-1148.408) [-1146.692] -- 0:00:56 152000 -- (-1144.242) [-1144.454] (-1144.261) (-1143.016) * (-1145.472) (-1144.633) [-1144.112] (-1147.672) -- 0:00:55 152500 -- (-1142.996) (-1145.530) (-1143.836) [-1143.469] * (-1145.157) (-1146.876) (-1145.340) [-1143.723] -- 0:00:55 153000 -- (-1143.013) [-1143.872] (-1145.087) (-1146.533) * (-1150.339) [-1143.908] (-1147.907) (-1144.161) -- 0:00:55 153500 -- (-1145.761) [-1143.179] (-1146.561) (-1142.818) * (-1153.177) (-1143.904) (-1146.758) [-1144.521] -- 0:00:55 154000 -- [-1145.749] (-1146.992) (-1150.498) (-1143.779) * [-1144.503] (-1143.869) (-1146.758) (-1143.133) -- 0:00:54 154500 -- (-1148.109) (-1144.636) (-1148.263) [-1143.680] * (-1144.972) (-1143.342) (-1147.978) [-1144.576] -- 0:00:54 155000 -- [-1142.521] (-1144.628) (-1148.777) (-1144.827) * (-1146.622) (-1144.650) [-1147.527] (-1148.320) -- 0:00:54 Average standard deviation of split frequencies: 0.016531 155500 -- (-1143.225) [-1143.532] (-1146.881) (-1144.023) * (-1143.805) (-1146.744) (-1145.922) [-1143.090] -- 0:00:54 156000 -- (-1145.381) (-1146.519) (-1146.340) [-1146.691] * [-1142.960] (-1144.758) (-1143.136) (-1143.195) -- 0:00:54 156500 -- (-1143.644) (-1143.898) [-1145.410] (-1146.390) * (-1147.479) (-1145.930) [-1143.070] (-1145.366) -- 0:00:53 157000 -- (-1147.128) (-1143.524) (-1145.616) [-1142.894] * (-1148.181) (-1147.671) (-1146.124) [-1144.349] -- 0:00:53 157500 -- (-1149.446) [-1145.437] (-1145.703) (-1143.104) * [-1142.679] (-1145.526) (-1146.850) (-1147.646) -- 0:00:53 158000 -- [-1145.065] (-1144.837) (-1145.412) (-1143.132) * (-1144.154) (-1150.247) (-1148.597) [-1144.303] -- 0:00:53 158500 -- (-1146.367) (-1146.660) (-1146.509) [-1144.161] * (-1145.294) (-1147.839) (-1149.134) [-1145.333] -- 0:00:53 159000 -- (-1142.710) (-1147.246) [-1145.299] (-1143.813) * (-1145.402) (-1143.203) [-1149.666] (-1150.822) -- 0:00:52 159500 -- (-1144.308) [-1147.292] (-1142.827) (-1145.370) * (-1144.573) (-1148.538) [-1146.022] (-1149.604) -- 0:00:52 160000 -- [-1144.202] (-1143.340) (-1143.144) (-1145.279) * (-1143.023) (-1146.124) [-1145.019] (-1147.638) -- 0:00:52 Average standard deviation of split frequencies: 0.016504 160500 -- (-1142.463) (-1142.631) [-1145.574] (-1146.269) * [-1143.781] (-1144.659) (-1145.443) (-1146.869) -- 0:00:52 161000 -- (-1143.523) (-1146.865) [-1145.096] (-1145.254) * [-1143.935] (-1144.390) (-1143.067) (-1144.305) -- 0:00:52 161500 -- [-1147.018] (-1143.561) (-1143.055) (-1144.079) * (-1143.242) (-1144.019) [-1142.971] (-1143.585) -- 0:00:51 162000 -- (-1145.287) [-1143.838] (-1142.770) (-1144.680) * (-1143.002) (-1146.035) (-1143.681) [-1142.970] -- 0:00:51 162500 -- (-1143.586) [-1144.941] (-1142.833) (-1147.408) * [-1145.185] (-1148.481) (-1142.802) (-1143.580) -- 0:00:51 163000 -- (-1143.460) (-1143.177) [-1143.063] (-1144.352) * (-1143.705) (-1145.709) [-1142.733] (-1145.000) -- 0:00:51 163500 -- (-1145.657) (-1143.187) [-1144.190] (-1145.082) * [-1143.443] (-1149.286) (-1144.115) (-1146.001) -- 0:00:51 164000 -- (-1146.944) (-1143.525) (-1143.940) [-1143.031] * [-1143.933] (-1145.639) (-1145.204) (-1147.804) -- 0:00:50 164500 -- (-1146.274) (-1144.332) (-1147.997) [-1143.013] * (-1144.208) (-1145.986) (-1142.599) [-1144.088] -- 0:00:50 165000 -- (-1145.298) (-1143.719) [-1146.130] (-1144.086) * (-1145.985) (-1144.680) (-1143.856) [-1145.064] -- 0:00:50 Average standard deviation of split frequencies: 0.017373 165500 -- (-1143.632) (-1143.685) [-1143.845] (-1143.192) * [-1145.930] (-1144.443) (-1143.584) (-1145.159) -- 0:00:50 166000 -- (-1144.288) [-1143.328] (-1144.262) (-1144.080) * [-1147.501] (-1144.662) (-1145.242) (-1143.509) -- 0:00:50 166500 -- [-1143.176] (-1144.499) (-1144.627) (-1143.912) * (-1145.821) (-1143.158) (-1146.971) [-1144.320] -- 0:00:50 167000 -- (-1143.005) [-1143.243] (-1142.743) (-1144.155) * (-1145.259) [-1146.203] (-1144.801) (-1144.356) -- 0:00:49 167500 -- (-1142.853) [-1142.839] (-1143.842) (-1143.901) * (-1145.845) [-1146.702] (-1146.201) (-1144.821) -- 0:00:49 168000 -- (-1143.941) (-1142.659) [-1143.104] (-1142.921) * (-1147.341) (-1146.752) [-1149.784] (-1144.423) -- 0:00:54 168500 -- (-1144.535) (-1142.658) (-1144.689) [-1143.254] * [-1145.489] (-1145.133) (-1144.507) (-1144.947) -- 0:00:54 169000 -- (-1145.028) (-1144.013) [-1142.577] (-1147.513) * (-1144.721) [-1143.708] (-1145.887) (-1144.617) -- 0:00:54 169500 -- (-1142.550) (-1144.013) [-1142.935] (-1145.899) * (-1144.853) (-1143.845) [-1146.809] (-1144.193) -- 0:00:53 170000 -- (-1143.224) (-1151.339) [-1142.679] (-1147.584) * (-1143.412) (-1144.753) [-1143.790] (-1144.472) -- 0:00:53 Average standard deviation of split frequencies: 0.019162 170500 -- (-1145.007) (-1150.675) [-1142.899] (-1148.733) * (-1144.190) (-1146.878) [-1143.914] (-1144.965) -- 0:00:53 171000 -- (-1143.899) [-1147.635] (-1144.010) (-1147.862) * (-1144.538) (-1143.687) (-1145.415) [-1145.313] -- 0:00:53 171500 -- (-1144.755) (-1147.058) [-1144.312] (-1145.756) * [-1143.538] (-1144.118) (-1145.503) (-1142.917) -- 0:00:53 172000 -- (-1148.727) (-1145.359) [-1144.624] (-1148.382) * (-1144.280) (-1145.374) [-1142.972] (-1144.536) -- 0:00:52 172500 -- (-1146.326) (-1145.265) [-1144.795] (-1147.143) * (-1143.204) (-1143.301) [-1143.099] (-1145.740) -- 0:00:52 173000 -- [-1143.946] (-1145.163) (-1142.586) (-1147.229) * (-1143.901) (-1145.138) (-1143.062) [-1145.511] -- 0:00:52 173500 -- (-1143.388) (-1144.486) (-1142.732) [-1143.653] * (-1143.896) (-1145.955) [-1144.776] (-1144.144) -- 0:00:52 174000 -- (-1144.076) [-1143.758] (-1144.585) (-1145.396) * [-1144.041] (-1146.961) (-1143.809) (-1146.131) -- 0:00:52 174500 -- (-1144.899) [-1144.323] (-1145.677) (-1143.522) * (-1144.081) [-1146.831] (-1143.745) (-1145.045) -- 0:00:52 175000 -- (-1147.883) (-1143.739) [-1143.028] (-1146.171) * (-1144.268) [-1144.163] (-1145.374) (-1142.323) -- 0:00:51 Average standard deviation of split frequencies: 0.019537 175500 -- (-1146.358) [-1144.226] (-1145.781) (-1148.102) * [-1145.009] (-1143.402) (-1145.496) (-1146.240) -- 0:00:51 176000 -- (-1147.947) (-1143.509) (-1148.450) [-1149.245] * (-1147.202) [-1145.761] (-1144.080) (-1144.875) -- 0:00:51 176500 -- [-1145.416] (-1144.969) (-1151.365) (-1143.054) * (-1148.663) (-1144.948) (-1144.292) [-1144.744] -- 0:00:51 177000 -- (-1144.366) (-1144.434) (-1143.326) [-1142.674] * (-1150.107) (-1145.599) (-1145.535) [-1145.737] -- 0:00:51 177500 -- (-1146.241) (-1145.420) (-1148.414) [-1144.050] * (-1146.437) [-1144.606] (-1146.368) (-1144.244) -- 0:00:50 178000 -- [-1145.404] (-1147.765) (-1146.863) (-1144.189) * (-1144.083) (-1145.875) [-1144.431] (-1151.376) -- 0:00:50 178500 -- (-1143.915) (-1145.515) [-1143.466] (-1145.194) * (-1143.978) (-1147.812) [-1144.280] (-1150.703) -- 0:00:50 179000 -- (-1143.123) (-1142.768) (-1143.323) [-1142.916] * (-1143.777) (-1152.798) (-1144.074) [-1146.377] -- 0:00:50 179500 -- [-1145.302] (-1142.754) (-1144.076) (-1142.997) * (-1146.640) [-1145.953] (-1143.052) (-1149.703) -- 0:00:50 180000 -- [-1146.679] (-1144.195) (-1145.637) (-1143.244) * (-1144.214) (-1147.415) [-1143.396] (-1145.655) -- 0:00:50 Average standard deviation of split frequencies: 0.022562 180500 -- (-1145.081) (-1147.052) (-1144.440) [-1143.278] * (-1146.005) [-1144.970] (-1144.112) (-1145.119) -- 0:00:49 181000 -- [-1144.304] (-1148.642) (-1145.702) (-1149.435) * (-1145.073) (-1145.330) (-1144.023) [-1144.663] -- 0:00:49 181500 -- (-1142.844) [-1143.243] (-1144.117) (-1145.625) * (-1146.970) [-1143.260] (-1143.146) (-1143.817) -- 0:00:49 182000 -- (-1142.844) [-1142.704] (-1145.232) (-1143.289) * (-1144.233) (-1148.775) (-1145.221) [-1144.732] -- 0:00:49 182500 -- (-1142.969) [-1145.550] (-1146.474) (-1142.892) * (-1144.942) [-1142.773] (-1146.740) (-1146.086) -- 0:00:49 183000 -- (-1142.985) (-1146.162) [-1147.037] (-1143.025) * (-1144.683) [-1144.529] (-1145.186) (-1144.316) -- 0:00:49 183500 -- [-1143.996] (-1144.990) (-1147.930) (-1147.696) * [-1145.894] (-1144.529) (-1147.333) (-1145.370) -- 0:00:48 184000 -- [-1144.728] (-1143.394) (-1143.811) (-1143.951) * [-1146.224] (-1148.457) (-1145.984) (-1143.542) -- 0:00:53 184500 -- (-1148.491) (-1144.130) (-1143.819) [-1144.323] * (-1146.541) [-1146.336] (-1149.120) (-1144.725) -- 0:00:53 185000 -- (-1147.321) [-1143.072] (-1143.285) (-1145.785) * [-1143.488] (-1143.610) (-1145.807) (-1143.278) -- 0:00:52 Average standard deviation of split frequencies: 0.022064 185500 -- (-1146.450) (-1143.967) [-1145.103] (-1148.121) * (-1143.254) (-1143.285) (-1143.926) [-1143.768] -- 0:00:52 186000 -- [-1146.272] (-1143.913) (-1148.785) (-1145.467) * (-1147.278) [-1145.766] (-1142.799) (-1144.033) -- 0:00:52 186500 -- (-1144.024) [-1144.987] (-1149.296) (-1146.561) * (-1145.699) [-1146.373] (-1149.579) (-1146.366) -- 0:00:52 187000 -- (-1146.482) [-1143.147] (-1147.125) (-1145.076) * (-1144.495) [-1150.536] (-1145.365) (-1143.949) -- 0:00:52 187500 -- [-1142.998] (-1150.023) (-1146.368) (-1146.646) * (-1146.897) [-1147.379] (-1147.177) (-1146.807) -- 0:00:52 188000 -- (-1145.920) [-1148.022] (-1143.373) (-1145.725) * (-1144.535) [-1145.881] (-1145.512) (-1144.941) -- 0:00:51 188500 -- [-1145.794] (-1145.175) (-1143.258) (-1144.802) * (-1144.774) [-1144.890] (-1146.484) (-1148.383) -- 0:00:51 189000 -- (-1145.713) (-1143.922) [-1148.366] (-1144.731) * (-1144.860) [-1143.556] (-1148.739) (-1144.003) -- 0:00:51 189500 -- (-1145.119) (-1144.564) (-1145.200) [-1144.416] * [-1144.690] (-1143.370) (-1144.651) (-1149.478) -- 0:00:51 190000 -- (-1143.907) (-1143.177) (-1143.146) [-1143.987] * (-1149.783) [-1143.525] (-1145.453) (-1146.006) -- 0:00:51 Average standard deviation of split frequencies: 0.019343 190500 -- (-1143.400) (-1144.137) (-1143.317) [-1143.590] * (-1146.044) [-1143.814] (-1143.702) (-1145.355) -- 0:00:50 191000 -- [-1145.969] (-1144.811) (-1145.181) (-1146.603) * (-1145.051) (-1143.807) (-1145.686) [-1144.819] -- 0:00:50 191500 -- [-1147.419] (-1145.467) (-1142.781) (-1143.343) * (-1144.339) (-1146.989) [-1143.038] (-1144.514) -- 0:00:50 192000 -- (-1144.778) (-1144.615) [-1142.625] (-1144.042) * (-1143.113) [-1143.772] (-1143.621) (-1147.108) -- 0:00:50 192500 -- (-1146.435) (-1145.330) [-1144.034] (-1146.314) * (-1143.488) (-1145.076) (-1142.985) [-1143.151] -- 0:00:50 193000 -- [-1144.900] (-1145.737) (-1143.294) (-1145.595) * (-1145.542) (-1143.765) [-1145.610] (-1143.764) -- 0:00:50 193500 -- (-1145.805) [-1145.539] (-1143.015) (-1142.425) * (-1146.911) (-1145.386) (-1147.372) [-1149.111] -- 0:00:50 194000 -- (-1145.137) [-1147.621] (-1147.790) (-1149.000) * [-1149.878] (-1154.186) (-1143.997) (-1143.478) -- 0:00:49 194500 -- [-1144.220] (-1146.483) (-1144.672) (-1146.561) * (-1142.814) (-1144.718) [-1146.552] (-1145.267) -- 0:00:49 195000 -- (-1143.628) (-1145.094) [-1143.933] (-1149.196) * (-1144.843) (-1143.597) (-1143.898) [-1142.328] -- 0:00:49 Average standard deviation of split frequencies: 0.017826 195500 -- (-1143.848) (-1144.976) [-1144.291] (-1145.829) * (-1145.046) [-1145.464] (-1144.641) (-1142.418) -- 0:00:49 196000 -- (-1142.776) (-1145.659) [-1148.063] (-1145.920) * (-1142.947) (-1144.377) [-1143.312] (-1142.420) -- 0:00:49 196500 -- (-1142.492) [-1145.304] (-1143.417) (-1143.958) * (-1145.274) (-1142.765) (-1145.747) [-1143.324] -- 0:00:49 197000 -- (-1143.874) (-1145.094) (-1143.201) [-1147.645] * [-1144.565] (-1143.227) (-1143.788) (-1143.683) -- 0:00:48 197500 -- (-1144.370) (-1143.124) [-1143.000] (-1147.620) * (-1147.916) (-1145.690) [-1142.915] (-1143.157) -- 0:00:48 198000 -- [-1145.129] (-1146.305) (-1144.873) (-1146.042) * (-1143.754) (-1144.977) (-1143.823) [-1143.577] -- 0:00:48 198500 -- (-1143.578) (-1143.946) [-1144.868] (-1145.221) * (-1144.894) (-1145.426) [-1143.297] (-1144.397) -- 0:00:48 199000 -- (-1143.026) [-1144.430] (-1145.465) (-1144.716) * (-1145.316) [-1143.464] (-1143.893) (-1144.092) -- 0:00:48 199500 -- (-1145.082) [-1147.986] (-1144.530) (-1146.714) * (-1148.661) (-1143.978) (-1145.265) [-1145.154] -- 0:00:48 200000 -- [-1146.269] (-1144.061) (-1147.701) (-1147.934) * (-1147.613) (-1143.538) (-1146.294) [-1146.745] -- 0:00:48 Average standard deviation of split frequencies: 0.018647 200500 -- [-1146.544] (-1143.567) (-1147.047) (-1148.215) * (-1145.645) [-1143.559] (-1146.279) (-1146.622) -- 0:00:51 201000 -- (-1146.278) (-1145.476) (-1149.572) [-1144.579] * (-1146.127) (-1143.263) (-1146.143) [-1142.584] -- 0:00:51 201500 -- (-1146.539) [-1144.369] (-1142.710) (-1144.764) * (-1144.111) (-1145.323) (-1146.711) [-1145.597] -- 0:00:51 202000 -- (-1146.573) [-1144.199] (-1145.216) (-1144.598) * (-1144.860) (-1144.422) (-1143.185) [-1148.928] -- 0:00:51 202500 -- (-1143.204) [-1143.241] (-1146.234) (-1145.684) * (-1145.087) (-1144.125) (-1143.186) [-1145.328] -- 0:00:51 203000 -- (-1143.129) (-1144.754) (-1146.190) [-1144.489] * (-1144.158) [-1143.537] (-1143.523) (-1144.018) -- 0:00:51 203500 -- [-1143.948] (-1144.738) (-1143.568) (-1145.448) * [-1144.875] (-1144.964) (-1143.588) (-1143.330) -- 0:00:50 204000 -- (-1145.633) [-1145.270] (-1145.531) (-1145.448) * (-1144.515) [-1142.767] (-1145.605) (-1142.779) -- 0:00:50 204500 -- (-1143.109) [-1142.683] (-1146.111) (-1144.999) * (-1145.999) (-1142.390) [-1144.502] (-1146.013) -- 0:00:50 205000 -- (-1144.620) (-1146.635) [-1143.364] (-1145.218) * (-1147.600) [-1142.845] (-1147.260) (-1149.184) -- 0:00:50 Average standard deviation of split frequencies: 0.015637 205500 -- (-1142.734) [-1145.344] (-1143.753) (-1147.246) * (-1149.557) [-1143.613] (-1145.683) (-1145.619) -- 0:00:50 206000 -- (-1142.551) (-1150.762) (-1144.114) [-1147.950] * (-1143.396) [-1145.502] (-1146.113) (-1145.829) -- 0:00:50 206500 -- [-1142.933] (-1146.260) (-1144.934) (-1145.838) * (-1143.633) (-1145.247) (-1143.589) [-1147.013] -- 0:00:49 207000 -- (-1144.877) [-1143.479] (-1146.419) (-1143.019) * [-1142.836] (-1146.210) (-1143.349) (-1143.533) -- 0:00:49 207500 -- (-1145.737) [-1142.630] (-1147.761) (-1142.966) * (-1144.054) [-1147.525] (-1146.743) (-1148.612) -- 0:00:49 208000 -- (-1143.533) [-1144.157] (-1145.997) (-1143.116) * (-1145.587) [-1144.976] (-1154.198) (-1145.813) -- 0:00:49 208500 -- (-1146.552) (-1145.235) [-1143.741] (-1146.873) * [-1142.426] (-1150.139) (-1147.826) (-1144.793) -- 0:00:49 209000 -- (-1146.760) (-1146.157) (-1145.268) [-1148.267] * (-1143.387) [-1144.567] (-1147.601) (-1148.117) -- 0:00:49 209500 -- (-1143.259) [-1147.318] (-1143.965) (-1145.634) * (-1144.748) (-1144.225) [-1145.219] (-1147.949) -- 0:00:49 210000 -- (-1142.800) (-1145.605) [-1145.645] (-1146.946) * (-1143.412) (-1143.948) (-1146.475) [-1142.843] -- 0:00:48 Average standard deviation of split frequencies: 0.015943 210500 -- (-1147.071) [-1142.883] (-1145.169) (-1143.786) * (-1144.157) [-1147.683] (-1143.085) (-1142.665) -- 0:00:48 211000 -- (-1147.199) [-1142.926] (-1145.833) (-1145.273) * (-1146.227) (-1146.392) (-1143.661) [-1145.388] -- 0:00:48 211500 -- (-1145.986) [-1145.986] (-1146.348) (-1145.447) * (-1144.321) (-1147.303) (-1144.151) [-1142.674] -- 0:00:48 212000 -- (-1145.589) (-1146.631) (-1149.757) [-1147.254] * [-1151.815] (-1146.830) (-1146.363) (-1144.444) -- 0:00:48 212500 -- (-1143.779) [-1143.777] (-1142.908) (-1146.624) * [-1144.632] (-1145.271) (-1148.548) (-1145.896) -- 0:00:48 213000 -- (-1144.460) (-1143.743) [-1142.983] (-1146.032) * (-1146.542) (-1144.228) (-1147.250) [-1144.540] -- 0:00:48 213500 -- (-1145.989) [-1144.747] (-1143.444) (-1148.387) * [-1146.290] (-1144.217) (-1147.083) (-1146.167) -- 0:00:47 214000 -- (-1145.210) [-1146.823] (-1145.350) (-1148.096) * [-1144.614] (-1144.209) (-1146.165) (-1145.973) -- 0:00:47 214500 -- (-1146.466) (-1150.744) (-1146.410) [-1147.846] * (-1142.984) (-1145.956) (-1147.102) [-1143.537] -- 0:00:47 215000 -- (-1145.810) [-1147.806] (-1146.690) (-1143.509) * (-1143.930) [-1142.692] (-1147.978) (-1143.845) -- 0:00:47 Average standard deviation of split frequencies: 0.016304 215500 -- (-1146.003) [-1143.960] (-1146.257) (-1144.219) * (-1148.365) [-1142.759] (-1144.838) (-1144.456) -- 0:00:47 216000 -- (-1147.135) (-1148.077) [-1146.932] (-1143.908) * (-1145.965) (-1148.323) (-1144.794) [-1146.138] -- 0:00:47 216500 -- (-1147.097) (-1144.189) [-1146.477] (-1146.942) * (-1143.594) [-1148.516] (-1144.656) (-1144.504) -- 0:00:50 217000 -- (-1145.830) [-1146.551] (-1143.919) (-1146.839) * (-1143.438) (-1144.769) [-1145.558] (-1144.454) -- 0:00:50 217500 -- (-1145.913) (-1144.392) [-1143.461] (-1146.452) * (-1143.272) (-1146.263) (-1144.727) [-1146.903] -- 0:00:50 218000 -- [-1146.540] (-1143.915) (-1144.940) (-1143.968) * (-1143.120) [-1146.416] (-1144.587) (-1142.627) -- 0:00:50 218500 -- (-1143.659) [-1145.015] (-1145.393) (-1148.378) * [-1143.463] (-1145.495) (-1144.241) (-1142.721) -- 0:00:50 219000 -- [-1145.482] (-1151.117) (-1148.686) (-1145.961) * (-1143.129) (-1143.382) [-1143.906] (-1142.721) -- 0:00:49 219500 -- (-1144.432) (-1150.671) [-1142.516] (-1143.739) * (-1145.103) [-1144.619] (-1144.023) (-1142.809) -- 0:00:49 220000 -- (-1146.203) (-1143.271) (-1145.531) [-1144.381] * [-1144.214] (-1143.386) (-1145.365) (-1146.882) -- 0:00:49 Average standard deviation of split frequencies: 0.016022 220500 -- (-1147.422) [-1143.386] (-1143.007) (-1144.397) * (-1143.087) [-1143.598] (-1145.966) (-1144.541) -- 0:00:49 221000 -- [-1150.854] (-1143.798) (-1144.764) (-1145.081) * [-1143.164] (-1145.459) (-1147.254) (-1145.062) -- 0:00:49 221500 -- (-1144.946) (-1142.925) [-1145.121] (-1143.509) * (-1143.257) (-1144.751) (-1144.938) [-1144.638] -- 0:00:49 222000 -- [-1144.154] (-1143.938) (-1143.556) (-1144.175) * (-1143.375) [-1144.199] (-1147.449) (-1144.034) -- 0:00:49 222500 -- [-1144.736] (-1147.535) (-1147.126) (-1144.246) * [-1142.997] (-1150.468) (-1146.051) (-1143.288) -- 0:00:48 223000 -- (-1145.136) [-1145.062] (-1143.235) (-1143.955) * (-1142.641) [-1145.403] (-1143.872) (-1144.692) -- 0:00:48 223500 -- (-1145.190) (-1144.759) [-1144.389] (-1143.337) * [-1142.968] (-1147.001) (-1147.896) (-1145.292) -- 0:00:48 224000 -- [-1145.519] (-1142.613) (-1145.346) (-1143.960) * [-1147.918] (-1145.543) (-1143.950) (-1145.589) -- 0:00:48 224500 -- [-1148.130] (-1144.227) (-1148.464) (-1144.365) * (-1145.271) (-1146.535) (-1145.419) [-1148.391] -- 0:00:48 225000 -- (-1148.765) (-1146.107) (-1145.048) [-1143.845] * (-1147.121) [-1145.183] (-1145.868) (-1144.249) -- 0:00:48 Average standard deviation of split frequencies: 0.016441 225500 -- (-1144.315) [-1143.427] (-1148.200) (-1144.372) * (-1146.100) (-1142.992) [-1145.561] (-1145.007) -- 0:00:48 226000 -- (-1143.354) (-1144.861) [-1145.576] (-1144.740) * (-1147.380) [-1142.470] (-1146.704) (-1143.704) -- 0:00:47 226500 -- [-1144.503] (-1144.996) (-1145.353) (-1146.547) * [-1146.423] (-1144.220) (-1145.605) (-1142.584) -- 0:00:47 227000 -- (-1144.417) (-1143.180) [-1143.302] (-1145.350) * (-1143.903) (-1143.186) [-1144.748] (-1142.723) -- 0:00:47 227500 -- [-1144.563] (-1145.097) (-1144.124) (-1146.461) * (-1143.534) [-1145.133] (-1143.393) (-1142.720) -- 0:00:47 228000 -- [-1143.370] (-1144.509) (-1145.632) (-1143.830) * (-1143.003) [-1144.724] (-1148.142) (-1142.669) -- 0:00:47 228500 -- (-1143.771) [-1144.874] (-1146.257) (-1146.334) * (-1144.591) (-1142.374) (-1146.550) [-1142.674] -- 0:00:47 229000 -- [-1143.700] (-1144.956) (-1147.698) (-1147.897) * (-1145.999) [-1142.953] (-1143.818) (-1144.300) -- 0:00:47 229500 -- (-1143.743) (-1144.798) [-1144.138] (-1147.486) * (-1142.752) (-1143.084) [-1145.858] (-1144.422) -- 0:00:47 230000 -- (-1143.441) [-1144.100] (-1145.704) (-1149.385) * (-1143.380) (-1142.449) (-1145.050) [-1144.607] -- 0:00:46 Average standard deviation of split frequencies: 0.015596 230500 -- (-1142.417) (-1145.056) [-1148.202] (-1144.910) * (-1142.804) (-1144.220) [-1148.346] (-1143.463) -- 0:00:46 231000 -- (-1143.551) (-1145.600) [-1143.516] (-1147.285) * [-1143.532] (-1143.488) (-1146.608) (-1143.420) -- 0:00:46 231500 -- (-1143.787) (-1147.313) (-1143.504) [-1146.210] * [-1144.186] (-1142.856) (-1145.312) (-1143.386) -- 0:00:46 232000 -- (-1143.439) [-1143.023] (-1144.627) (-1144.569) * (-1144.962) (-1147.554) (-1144.499) [-1147.418] -- 0:00:46 232500 -- [-1145.149] (-1142.942) (-1144.981) (-1145.288) * (-1145.356) (-1144.617) [-1145.454] (-1146.205) -- 0:00:46 233000 -- (-1144.389) (-1144.200) (-1145.804) [-1146.076] * (-1144.299) [-1145.318] (-1146.629) (-1144.137) -- 0:00:49 233500 -- [-1144.673] (-1150.569) (-1148.377) (-1146.937) * (-1144.903) (-1145.401) [-1147.875] (-1144.281) -- 0:00:49 234000 -- (-1146.956) [-1146.307] (-1147.043) (-1144.295) * [-1145.813] (-1146.100) (-1147.151) (-1143.325) -- 0:00:49 234500 -- (-1144.152) (-1148.396) (-1151.104) [-1144.045] * (-1143.953) (-1144.885) [-1145.397] (-1143.123) -- 0:00:48 235000 -- (-1144.049) (-1146.237) [-1145.147] (-1148.967) * (-1144.621) (-1143.520) (-1146.690) [-1142.252] -- 0:00:48 Average standard deviation of split frequencies: 0.016085 235500 -- (-1143.384) [-1145.428] (-1143.759) (-1147.076) * [-1144.023] (-1146.595) (-1147.285) (-1142.743) -- 0:00:48 236000 -- (-1145.089) (-1146.269) (-1142.822) [-1145.181] * (-1144.118) (-1146.060) (-1143.630) [-1144.024] -- 0:00:48 236500 -- (-1144.445) (-1143.979) [-1142.964] (-1144.017) * [-1145.836] (-1143.554) (-1143.867) (-1143.020) -- 0:00:48 237000 -- (-1150.299) [-1145.776] (-1142.955) (-1144.545) * (-1148.721) (-1148.070) (-1143.875) [-1146.871] -- 0:00:48 237500 -- (-1144.549) [-1143.945] (-1143.096) (-1145.075) * [-1143.184] (-1143.712) (-1143.776) (-1144.694) -- 0:00:48 238000 -- (-1146.854) [-1144.412] (-1144.755) (-1146.356) * (-1143.677) [-1144.219] (-1143.780) (-1144.552) -- 0:00:48 238500 -- [-1147.041] (-1144.756) (-1150.797) (-1149.084) * (-1142.957) (-1143.845) [-1142.948] (-1148.356) -- 0:00:47 239000 -- [-1144.986] (-1143.620) (-1149.800) (-1145.440) * (-1144.151) [-1143.960] (-1142.974) (-1150.111) -- 0:00:47 239500 -- (-1144.605) [-1143.045] (-1146.066) (-1146.215) * [-1144.517] (-1145.945) (-1144.115) (-1149.110) -- 0:00:47 240000 -- [-1144.229] (-1143.451) (-1146.808) (-1146.211) * (-1143.407) (-1145.723) [-1144.114] (-1147.837) -- 0:00:47 Average standard deviation of split frequencies: 0.016867 240500 -- (-1150.069) [-1143.369] (-1145.868) (-1146.900) * (-1143.513) (-1147.186) [-1142.895] (-1145.937) -- 0:00:47 241000 -- (-1143.945) [-1143.591] (-1144.973) (-1148.157) * (-1147.301) [-1146.328] (-1144.417) (-1149.187) -- 0:00:47 241500 -- [-1144.332] (-1142.957) (-1144.494) (-1149.802) * [-1143.076] (-1143.459) (-1144.702) (-1148.171) -- 0:00:47 242000 -- (-1144.678) (-1143.687) (-1143.433) [-1142.479] * [-1143.724] (-1144.455) (-1146.030) (-1147.906) -- 0:00:46 242500 -- (-1147.801) (-1143.025) [-1143.905] (-1144.451) * (-1144.429) (-1142.831) [-1148.369] (-1147.590) -- 0:00:46 243000 -- (-1148.242) [-1146.476] (-1147.638) (-1143.417) * (-1145.296) (-1143.115) (-1145.206) [-1146.697] -- 0:00:46 243500 -- (-1146.101) (-1146.574) [-1145.632] (-1145.824) * (-1143.562) (-1143.601) [-1144.371] (-1149.488) -- 0:00:46 244000 -- (-1147.924) [-1143.817] (-1143.158) (-1146.220) * (-1144.401) [-1145.268] (-1145.197) (-1146.648) -- 0:00:46 244500 -- (-1143.372) (-1146.609) [-1143.314] (-1144.232) * [-1143.262] (-1145.291) (-1145.449) (-1143.110) -- 0:00:46 245000 -- (-1143.856) (-1145.198) [-1146.202] (-1143.113) * [-1146.145] (-1147.216) (-1142.899) (-1145.177) -- 0:00:46 Average standard deviation of split frequencies: 0.015935 245500 -- (-1146.784) (-1146.293) (-1145.604) [-1145.503] * (-1145.100) [-1145.098] (-1144.037) (-1143.116) -- 0:00:46 246000 -- [-1143.636] (-1146.570) (-1144.502) (-1143.734) * [-1145.022] (-1146.238) (-1147.724) (-1144.464) -- 0:00:45 246500 -- (-1143.720) (-1148.624) (-1147.740) [-1143.855] * [-1143.242] (-1147.830) (-1145.567) (-1148.838) -- 0:00:45 247000 -- (-1142.808) (-1142.403) (-1145.404) [-1142.915] * (-1143.504) (-1142.631) (-1146.461) [-1145.014] -- 0:00:45 247500 -- (-1142.387) [-1144.001] (-1145.554) (-1144.664) * (-1145.378) (-1143.498) (-1147.692) [-1143.413] -- 0:00:45 248000 -- (-1150.388) [-1143.948] (-1145.739) (-1143.317) * [-1143.616] (-1143.221) (-1146.956) (-1145.376) -- 0:00:45 248500 -- (-1149.424) [-1146.094] (-1143.380) (-1143.330) * [-1146.174] (-1144.435) (-1142.864) (-1143.238) -- 0:00:45 249000 -- (-1149.333) (-1148.184) [-1144.025] (-1143.434) * (-1144.025) [-1146.621] (-1142.862) (-1150.135) -- 0:00:45 249500 -- (-1148.263) (-1149.162) (-1143.788) [-1145.505] * (-1143.054) (-1148.235) [-1145.978] (-1147.785) -- 0:00:48 250000 -- (-1145.936) (-1145.264) [-1142.952] (-1145.118) * (-1143.360) [-1145.825] (-1145.927) (-1144.255) -- 0:00:48 Average standard deviation of split frequencies: 0.014669 250500 -- (-1146.504) (-1144.842) [-1143.037] (-1146.383) * (-1143.543) (-1145.026) [-1142.673] (-1144.684) -- 0:00:47 251000 -- (-1146.438) (-1144.955) [-1143.158] (-1146.107) * (-1145.401) (-1145.577) [-1146.172] (-1146.034) -- 0:00:47 251500 -- [-1143.500] (-1146.379) (-1148.176) (-1150.657) * (-1143.248) [-1143.145] (-1144.849) (-1145.069) -- 0:00:47 252000 -- (-1143.829) (-1147.909) [-1146.728] (-1144.424) * (-1144.370) [-1146.416] (-1144.162) (-1143.395) -- 0:00:47 252500 -- (-1144.452) (-1144.418) (-1150.257) [-1144.237] * (-1143.483) (-1144.214) (-1143.368) [-1143.882] -- 0:00:47 253000 -- (-1142.789) (-1145.535) [-1144.140] (-1143.526) * [-1143.030] (-1143.328) (-1144.636) (-1148.090) -- 0:00:47 253500 -- [-1144.338] (-1147.549) (-1143.268) (-1142.390) * (-1142.974) (-1144.387) (-1144.907) [-1143.001] -- 0:00:47 254000 -- (-1149.396) (-1144.393) [-1146.088] (-1143.532) * [-1145.395] (-1143.205) (-1143.926) (-1148.160) -- 0:00:46 254500 -- [-1144.865] (-1144.823) (-1145.190) (-1146.787) * (-1146.682) (-1143.300) (-1144.998) [-1147.141] -- 0:00:46 255000 -- [-1145.788] (-1144.851) (-1145.248) (-1144.385) * (-1151.871) (-1147.642) (-1143.888) [-1145.127] -- 0:00:46 Average standard deviation of split frequencies: 0.014441 255500 -- (-1144.483) (-1146.222) (-1143.210) [-1145.362] * [-1143.788] (-1144.087) (-1144.915) (-1144.118) -- 0:00:46 256000 -- (-1146.899) [-1143.156] (-1143.210) (-1145.085) * [-1146.917] (-1145.608) (-1147.614) (-1145.022) -- 0:00:46 256500 -- [-1149.182] (-1143.937) (-1143.459) (-1143.262) * [-1146.304] (-1143.703) (-1148.674) (-1146.907) -- 0:00:46 257000 -- (-1144.389) [-1144.155] (-1143.458) (-1144.252) * (-1143.400) (-1145.144) (-1144.041) [-1149.636] -- 0:00:46 257500 -- [-1148.181] (-1143.479) (-1144.313) (-1143.619) * (-1142.772) (-1145.252) [-1143.109] (-1145.464) -- 0:00:46 258000 -- [-1146.393] (-1145.289) (-1146.415) (-1143.433) * (-1145.567) (-1143.635) (-1143.924) [-1144.036] -- 0:00:46 258500 -- [-1145.538] (-1146.989) (-1143.823) (-1146.424) * [-1144.757] (-1145.242) (-1144.562) (-1142.931) -- 0:00:45 259000 -- [-1148.850] (-1145.117) (-1143.142) (-1144.426) * (-1150.469) [-1145.846] (-1144.781) (-1145.691) -- 0:00:45 259500 -- [-1144.522] (-1146.112) (-1143.434) (-1144.768) * [-1144.925] (-1145.110) (-1150.817) (-1146.618) -- 0:00:45 260000 -- (-1143.935) (-1144.590) [-1144.497] (-1144.855) * (-1145.301) (-1143.432) [-1146.540] (-1148.943) -- 0:00:45 Average standard deviation of split frequencies: 0.015419 260500 -- (-1144.766) [-1143.417] (-1143.610) (-1143.741) * (-1146.167) (-1146.631) [-1146.433] (-1147.630) -- 0:00:45 261000 -- (-1142.985) (-1146.939) (-1143.091) [-1143.754] * (-1145.375) (-1142.539) (-1144.610) [-1145.961] -- 0:00:45 261500 -- [-1143.022] (-1143.718) (-1144.015) (-1143.595) * (-1144.720) (-1142.982) (-1145.436) [-1144.011] -- 0:00:45 262000 -- [-1145.743] (-1143.228) (-1143.904) (-1143.233) * [-1145.027] (-1146.709) (-1144.508) (-1144.496) -- 0:00:45 262500 -- [-1146.216] (-1146.301) (-1144.173) (-1143.478) * (-1143.868) (-1144.820) (-1143.199) [-1144.532] -- 0:00:44 263000 -- [-1145.825] (-1143.477) (-1144.674) (-1142.967) * (-1144.087) (-1143.056) [-1144.713] (-1143.971) -- 0:00:44 263500 -- [-1143.442] (-1146.366) (-1143.088) (-1143.166) * (-1143.802) [-1143.055] (-1144.238) (-1143.382) -- 0:00:44 264000 -- [-1144.680] (-1145.141) (-1143.531) (-1143.660) * (-1143.464) (-1143.796) [-1145.863] (-1143.960) -- 0:00:44 264500 -- [-1143.897] (-1144.209) (-1149.657) (-1145.917) * [-1145.844] (-1144.986) (-1146.999) (-1143.155) -- 0:00:44 265000 -- (-1143.351) (-1144.635) [-1145.416] (-1146.044) * [-1144.223] (-1144.984) (-1145.379) (-1142.927) -- 0:00:44 Average standard deviation of split frequencies: 0.014355 265500 -- (-1145.469) (-1144.419) [-1142.522] (-1144.416) * (-1146.191) (-1144.465) (-1144.343) [-1143.050] -- 0:00:47 266000 -- (-1144.517) (-1143.111) (-1145.990) [-1143.804] * [-1144.698] (-1146.937) (-1149.757) (-1143.912) -- 0:00:46 266500 -- (-1146.047) (-1143.735) (-1144.008) [-1143.212] * [-1146.090] (-1144.137) (-1147.252) (-1143.502) -- 0:00:46 267000 -- (-1145.592) (-1143.700) (-1143.962) [-1144.139] * [-1144.113] (-1146.623) (-1147.133) (-1143.236) -- 0:00:46 267500 -- (-1143.000) (-1143.984) [-1145.278] (-1147.760) * (-1143.711) (-1147.994) [-1143.544] (-1143.915) -- 0:00:46 268000 -- (-1142.513) [-1143.980] (-1144.134) (-1143.687) * (-1142.896) (-1144.943) (-1143.135) [-1143.208] -- 0:00:46 268500 -- [-1142.981] (-1146.106) (-1144.372) (-1143.687) * [-1142.830] (-1144.839) (-1144.250) (-1143.158) -- 0:00:46 269000 -- [-1145.506] (-1144.952) (-1144.080) (-1145.997) * [-1144.835] (-1145.845) (-1146.689) (-1145.692) -- 0:00:46 269500 -- (-1146.036) [-1142.945] (-1143.982) (-1144.409) * (-1143.670) (-1143.928) (-1146.332) [-1146.098] -- 0:00:46 270000 -- (-1147.196) (-1143.854) [-1145.218] (-1142.789) * [-1145.211] (-1146.863) (-1144.212) (-1148.665) -- 0:00:45 Average standard deviation of split frequencies: 0.013411 270500 -- [-1145.318] (-1142.863) (-1145.218) (-1143.255) * [-1144.054] (-1146.865) (-1147.370) (-1145.262) -- 0:00:45 271000 -- (-1143.827) (-1144.377) [-1145.443] (-1146.028) * (-1143.625) (-1144.963) [-1146.258] (-1146.352) -- 0:00:45 271500 -- (-1144.198) (-1143.348) (-1145.443) [-1143.263] * (-1151.080) (-1147.635) [-1145.820] (-1154.384) -- 0:00:45 272000 -- (-1144.689) [-1142.862] (-1145.211) (-1145.204) * (-1147.638) (-1150.116) [-1143.095] (-1149.080) -- 0:00:45 272500 -- [-1147.812] (-1145.304) (-1143.879) (-1148.348) * [-1145.197] (-1145.197) (-1143.947) (-1144.916) -- 0:00:45 273000 -- [-1144.987] (-1143.797) (-1143.904) (-1146.952) * (-1146.836) (-1145.965) (-1143.953) [-1144.315] -- 0:00:45 273500 -- (-1146.846) (-1145.303) (-1142.448) [-1144.114] * (-1145.626) (-1147.947) [-1143.469] (-1144.314) -- 0:00:45 274000 -- (-1143.557) [-1145.270] (-1142.451) (-1143.461) * (-1146.478) [-1146.221] (-1143.258) (-1146.611) -- 0:00:45 274500 -- (-1143.307) (-1144.799) (-1146.285) [-1145.044] * (-1148.955) (-1147.302) [-1146.469] (-1148.491) -- 0:00:44 275000 -- (-1144.620) (-1144.679) (-1145.880) [-1143.793] * (-1145.441) [-1146.174] (-1147.393) (-1146.782) -- 0:00:44 Average standard deviation of split frequencies: 0.013189 275500 -- (-1144.246) (-1143.037) (-1147.541) [-1143.751] * (-1144.699) (-1145.406) (-1151.749) [-1143.931] -- 0:00:44 276000 -- (-1147.008) (-1142.857) (-1148.755) [-1143.978] * (-1144.420) (-1144.449) [-1145.549] (-1143.498) -- 0:00:44 276500 -- (-1144.267) (-1143.385) (-1148.444) [-1143.309] * (-1142.820) [-1145.179] (-1146.422) (-1144.598) -- 0:00:44 277000 -- (-1144.187) (-1143.578) [-1144.021] (-1143.204) * (-1143.167) (-1146.354) [-1143.906] (-1146.486) -- 0:00:44 277500 -- (-1152.171) (-1146.313) (-1144.511) [-1144.367] * (-1145.458) [-1146.506] (-1143.070) (-1148.056) -- 0:00:44 278000 -- (-1143.005) (-1145.994) (-1144.068) [-1142.323] * (-1144.456) (-1143.735) [-1145.383] (-1147.490) -- 0:00:44 278500 -- (-1143.381) [-1142.591] (-1144.076) (-1147.090) * (-1143.870) (-1144.229) (-1145.218) [-1145.159] -- 0:00:44 279000 -- (-1147.774) [-1143.054] (-1144.553) (-1147.913) * (-1144.975) (-1143.738) (-1147.276) [-1147.274] -- 0:00:43 279500 -- (-1145.065) [-1142.869] (-1144.226) (-1146.139) * (-1145.693) [-1143.495] (-1145.010) (-1144.924) -- 0:00:43 280000 -- (-1145.873) (-1144.627) (-1145.697) [-1144.067] * (-1143.226) (-1143.687) [-1145.077] (-1146.678) -- 0:00:43 Average standard deviation of split frequencies: 0.013260 280500 -- (-1142.967) [-1142.746] (-1144.080) (-1143.411) * [-1142.974] (-1145.745) (-1146.936) (-1145.885) -- 0:00:43 281000 -- [-1145.000] (-1145.427) (-1147.424) (-1145.127) * (-1142.871) [-1144.288] (-1143.741) (-1144.354) -- 0:00:43 281500 -- (-1148.258) [-1143.034] (-1146.298) (-1147.681) * (-1142.547) [-1148.712] (-1147.482) (-1145.327) -- 0:00:43 282000 -- (-1142.577) (-1146.246) (-1144.940) [-1143.907] * (-1145.820) (-1145.761) [-1145.219] (-1143.664) -- 0:00:45 282500 -- (-1142.623) (-1149.951) [-1143.813] (-1143.841) * (-1142.942) (-1145.405) [-1143.276] (-1145.943) -- 0:00:45 283000 -- (-1143.822) [-1146.369] (-1143.876) (-1144.151) * (-1143.702) [-1146.728] (-1143.185) (-1146.429) -- 0:00:45 283500 -- [-1149.032] (-1143.017) (-1146.419) (-1144.018) * (-1147.507) (-1145.159) (-1143.258) [-1146.576] -- 0:00:45 284000 -- [-1143.734] (-1146.861) (-1143.713) (-1143.453) * (-1150.197) (-1145.443) (-1147.740) [-1143.141] -- 0:00:45 284500 -- (-1144.856) [-1144.405] (-1151.428) (-1143.163) * (-1147.308) (-1144.526) (-1147.668) [-1147.870] -- 0:00:45 285000 -- (-1145.590) (-1142.991) (-1146.812) [-1143.958] * (-1143.370) [-1145.122] (-1145.407) (-1144.631) -- 0:00:45 Average standard deviation of split frequencies: 0.013273 285500 -- (-1144.762) (-1142.495) [-1145.186] (-1143.122) * (-1143.631) (-1144.830) [-1147.836] (-1150.129) -- 0:00:45 286000 -- (-1144.571) [-1142.517] (-1147.720) (-1144.500) * [-1143.104] (-1143.017) (-1146.117) (-1146.612) -- 0:00:44 286500 -- (-1145.939) (-1143.359) [-1143.676] (-1143.523) * (-1143.487) (-1144.802) (-1145.782) [-1143.473] -- 0:00:44 287000 -- (-1142.906) [-1143.879] (-1143.147) (-1142.904) * (-1144.829) (-1146.142) (-1143.325) [-1144.298] -- 0:00:44 287500 -- [-1143.648] (-1143.938) (-1144.308) (-1143.240) * (-1143.412) (-1144.767) (-1143.383) [-1143.302] -- 0:00:44 288000 -- (-1143.791) [-1145.031] (-1146.360) (-1143.424) * (-1143.756) (-1145.045) [-1144.468] (-1146.664) -- 0:00:44 288500 -- (-1143.592) [-1145.344] (-1146.830) (-1143.743) * [-1143.119] (-1149.775) (-1145.122) (-1145.578) -- 0:00:44 289000 -- (-1145.565) (-1145.873) [-1145.314] (-1145.101) * (-1143.633) (-1147.562) (-1145.331) [-1142.818] -- 0:00:44 289500 -- (-1145.697) (-1145.441) (-1144.694) [-1143.844] * (-1146.665) (-1144.765) (-1144.469) [-1143.875] -- 0:00:44 290000 -- [-1145.919] (-1146.185) (-1145.020) (-1143.531) * (-1144.753) (-1144.082) (-1145.241) [-1143.175] -- 0:00:44 Average standard deviation of split frequencies: 0.013316 290500 -- (-1149.123) (-1143.930) [-1143.948] (-1142.922) * (-1149.007) [-1143.726] (-1144.067) (-1142.400) -- 0:00:43 291000 -- (-1146.604) [-1143.654] (-1145.097) (-1145.807) * (-1143.752) (-1145.228) (-1143.893) [-1143.488] -- 0:00:43 291500 -- [-1144.739] (-1143.410) (-1144.264) (-1146.231) * (-1143.875) (-1147.080) (-1145.338) [-1143.308] -- 0:00:43 292000 -- (-1145.063) [-1142.928] (-1143.973) (-1145.283) * (-1144.475) (-1148.298) (-1143.640) [-1143.041] -- 0:00:43 292500 -- (-1144.388) (-1142.991) (-1143.885) [-1142.682] * (-1144.930) (-1146.161) [-1144.160] (-1143.584) -- 0:00:43 293000 -- (-1144.593) (-1143.070) (-1146.724) [-1142.633] * [-1142.999] (-1143.618) (-1146.516) (-1144.564) -- 0:00:43 293500 -- (-1144.624) [-1142.813] (-1144.445) (-1142.633) * [-1143.148] (-1143.545) (-1149.608) (-1145.258) -- 0:00:43 294000 -- (-1144.577) (-1143.580) [-1147.713] (-1143.407) * [-1142.753] (-1143.580) (-1144.705) (-1146.375) -- 0:00:43 294500 -- [-1143.388] (-1143.753) (-1147.984) (-1142.570) * (-1144.352) (-1143.458) (-1143.979) [-1147.530] -- 0:00:43 295000 -- (-1144.322) [-1143.852] (-1145.642) (-1143.390) * [-1143.844] (-1145.752) (-1143.370) (-1148.816) -- 0:00:43 Average standard deviation of split frequencies: 0.014501 295500 -- (-1146.649) [-1143.290] (-1145.912) (-1143.157) * (-1145.003) (-1152.053) [-1144.579] (-1148.304) -- 0:00:42 296000 -- (-1149.295) (-1144.935) [-1142.890] (-1145.222) * [-1148.002] (-1147.509) (-1145.428) (-1145.195) -- 0:00:42 296500 -- (-1145.747) (-1146.076) [-1142.985] (-1145.257) * (-1149.589) (-1145.597) [-1146.053] (-1146.737) -- 0:00:42 297000 -- (-1144.494) (-1143.429) (-1146.970) [-1144.517] * (-1143.803) [-1144.073] (-1145.792) (-1144.066) -- 0:00:42 297500 -- (-1145.532) (-1144.683) [-1142.767] (-1143.448) * (-1145.330) (-1145.008) [-1146.464] (-1144.072) -- 0:00:42 298000 -- (-1144.126) (-1145.619) (-1146.571) [-1143.626] * [-1145.591] (-1144.803) (-1145.940) (-1146.986) -- 0:00:44 298500 -- (-1144.984) (-1144.372) (-1145.252) [-1143.672] * [-1145.657] (-1148.081) (-1144.431) (-1144.591) -- 0:00:44 299000 -- (-1147.507) (-1145.220) (-1144.070) [-1145.397] * (-1145.904) [-1144.846] (-1148.190) (-1143.456) -- 0:00:44 299500 -- (-1145.989) (-1147.043) [-1143.194] (-1144.926) * [-1143.099] (-1143.554) (-1148.845) (-1143.543) -- 0:00:44 300000 -- (-1149.071) (-1146.980) [-1146.201] (-1144.534) * [-1143.734] (-1146.247) (-1147.410) (-1144.321) -- 0:00:44 Average standard deviation of split frequencies: 0.014523 300500 -- (-1144.855) (-1146.602) [-1143.429] (-1143.227) * (-1143.707) (-1145.369) (-1147.243) [-1144.834] -- 0:00:44 301000 -- (-1143.712) [-1143.661] (-1145.485) (-1144.432) * (-1144.962) [-1146.558] (-1149.978) (-1143.884) -- 0:00:44 301500 -- (-1145.010) (-1142.603) [-1144.116] (-1145.152) * (-1145.355) (-1146.272) (-1147.183) [-1143.418] -- 0:00:44 302000 -- (-1146.446) (-1149.050) (-1147.665) [-1143.698] * [-1144.670] (-1145.521) (-1146.664) (-1143.279) -- 0:00:43 302500 -- (-1143.576) (-1145.427) [-1147.510] (-1144.566) * (-1147.616) (-1147.622) (-1146.336) [-1145.200] -- 0:00:43 303000 -- (-1144.157) (-1144.493) [-1145.777] (-1145.129) * (-1145.131) (-1146.168) (-1146.473) [-1144.355] -- 0:00:43 303500 -- [-1146.146] (-1145.182) (-1153.024) (-1144.181) * (-1146.418) [-1144.334] (-1144.023) (-1143.627) -- 0:00:43 304000 -- (-1143.832) (-1144.042) [-1146.290] (-1148.417) * (-1144.258) (-1145.501) [-1143.672] (-1143.166) -- 0:00:43 304500 -- [-1143.658] (-1143.617) (-1144.486) (-1150.185) * (-1143.613) (-1145.887) (-1144.800) [-1148.566] -- 0:00:43 305000 -- [-1142.976] (-1144.482) (-1150.868) (-1145.408) * (-1142.901) [-1142.623] (-1144.414) (-1147.886) -- 0:00:43 Average standard deviation of split frequencies: 0.015320 305500 -- (-1143.593) (-1147.462) (-1147.020) [-1143.212] * [-1142.820] (-1142.945) (-1145.525) (-1145.633) -- 0:00:43 306000 -- (-1143.297) (-1145.673) (-1144.778) [-1146.087] * (-1147.400) [-1142.555] (-1143.398) (-1143.136) -- 0:00:43 306500 -- (-1145.063) [-1144.623] (-1145.341) (-1143.418) * (-1143.901) (-1143.419) (-1142.865) [-1143.778] -- 0:00:42 307000 -- (-1143.414) [-1144.899] (-1145.699) (-1143.481) * [-1142.741] (-1142.312) (-1143.615) (-1143.523) -- 0:00:42 307500 -- (-1145.876) (-1145.447) [-1145.930] (-1148.454) * (-1142.714) [-1142.954] (-1145.119) (-1144.362) -- 0:00:42 308000 -- (-1145.070) (-1153.289) [-1144.374] (-1146.999) * (-1144.923) (-1143.106) (-1146.032) [-1144.587] -- 0:00:42 308500 -- (-1144.372) (-1144.134) [-1143.164] (-1144.538) * (-1144.118) (-1142.603) [-1145.357] (-1143.315) -- 0:00:42 309000 -- (-1145.634) [-1147.656] (-1143.287) (-1143.398) * (-1145.166) [-1143.452] (-1142.866) (-1142.482) -- 0:00:42 309500 -- (-1151.247) [-1148.083] (-1144.961) (-1148.052) * (-1145.948) (-1143.697) (-1143.056) [-1144.696] -- 0:00:42 310000 -- (-1148.457) (-1144.086) (-1144.291) [-1147.144] * (-1153.233) [-1145.826] (-1143.114) (-1142.414) -- 0:00:42 Average standard deviation of split frequencies: 0.015090 310500 -- (-1145.914) (-1143.521) [-1144.721] (-1146.662) * (-1146.957) (-1142.748) (-1144.702) [-1145.992] -- 0:00:42 311000 -- (-1142.359) (-1143.890) [-1144.034] (-1142.897) * (-1144.846) (-1144.614) (-1143.368) [-1145.053] -- 0:00:42 311500 -- [-1142.987] (-1144.122) (-1143.909) (-1144.343) * (-1146.343) (-1142.649) [-1144.542] (-1145.102) -- 0:00:41 312000 -- [-1144.402] (-1144.562) (-1143.743) (-1143.221) * (-1150.266) [-1142.830] (-1146.551) (-1146.217) -- 0:00:41 312500 -- [-1143.582] (-1151.887) (-1142.935) (-1146.112) * [-1149.960] (-1144.196) (-1147.330) (-1143.964) -- 0:00:41 313000 -- [-1144.005] (-1145.669) (-1148.584) (-1150.873) * (-1146.120) (-1143.317) [-1144.956] (-1145.808) -- 0:00:41 313500 -- [-1143.536] (-1149.520) (-1144.446) (-1149.354) * [-1145.513] (-1143.803) (-1143.996) (-1145.706) -- 0:00:41 314000 -- (-1142.968) (-1148.178) [-1144.330] (-1147.065) * (-1142.601) [-1144.431] (-1145.175) (-1142.395) -- 0:00:41 314500 -- (-1145.609) (-1144.476) [-1144.066] (-1145.031) * [-1146.105] (-1144.187) (-1144.624) (-1149.026) -- 0:00:43 315000 -- (-1146.792) (-1146.246) (-1142.931) [-1144.789] * [-1146.054] (-1145.327) (-1149.222) (-1143.950) -- 0:00:43 Average standard deviation of split frequencies: 0.014669 315500 -- (-1146.534) (-1142.818) (-1144.115) [-1144.789] * [-1146.695] (-1145.346) (-1145.037) (-1143.493) -- 0:00:43 316000 -- [-1144.707] (-1146.271) (-1146.075) (-1144.024) * (-1143.756) (-1143.687) [-1145.256] (-1144.723) -- 0:00:43 316500 -- [-1147.242] (-1144.110) (-1148.918) (-1145.688) * (-1143.614) (-1143.549) [-1143.135] (-1144.729) -- 0:00:43 317000 -- (-1146.028) (-1145.400) (-1148.758) [-1145.560] * (-1149.164) (-1143.375) [-1145.490] (-1144.224) -- 0:00:43 317500 -- [-1144.639] (-1143.778) (-1143.124) (-1147.289) * (-1142.799) [-1144.244] (-1144.734) (-1142.698) -- 0:00:42 318000 -- (-1145.274) (-1144.277) [-1143.257] (-1146.086) * (-1143.342) [-1143.388] (-1145.763) (-1143.024) -- 0:00:42 318500 -- [-1144.713] (-1143.678) (-1145.922) (-1144.636) * (-1145.039) [-1143.295] (-1143.444) (-1145.073) -- 0:00:42 319000 -- (-1143.178) (-1145.376) (-1143.752) [-1145.816] * (-1143.320) [-1146.410] (-1144.312) (-1143.599) -- 0:00:42 319500 -- [-1143.005] (-1146.477) (-1144.051) (-1144.249) * (-1147.107) (-1144.718) [-1145.165] (-1146.122) -- 0:00:42 320000 -- [-1142.831] (-1147.327) (-1143.729) (-1144.811) * (-1143.062) (-1143.582) [-1145.405] (-1144.443) -- 0:00:42 Average standard deviation of split frequencies: 0.014782 320500 -- (-1143.406) [-1145.023] (-1145.317) (-1145.519) * (-1144.674) (-1144.238) [-1145.200] (-1144.699) -- 0:00:42 321000 -- (-1147.424) [-1146.155] (-1143.525) (-1144.818) * (-1146.087) [-1145.193] (-1145.200) (-1148.142) -- 0:00:42 321500 -- (-1145.412) (-1146.879) (-1142.992) [-1144.448] * [-1144.262] (-1146.208) (-1146.128) (-1143.011) -- 0:00:42 322000 -- (-1143.940) [-1148.317] (-1144.350) (-1145.804) * (-1143.897) [-1147.168] (-1144.950) (-1147.180) -- 0:00:42 322500 -- (-1147.416) (-1150.794) (-1146.474) [-1145.544] * (-1143.326) (-1145.993) [-1142.652] (-1145.585) -- 0:00:42 323000 -- (-1144.894) (-1146.626) [-1145.104] (-1148.334) * (-1145.337) (-1148.124) [-1145.960] (-1145.707) -- 0:00:41 323500 -- (-1144.920) (-1144.518) (-1145.116) [-1144.140] * (-1146.181) [-1144.059] (-1145.964) (-1146.868) -- 0:00:41 324000 -- (-1145.855) (-1143.586) [-1144.496] (-1142.846) * (-1143.256) [-1143.111] (-1144.070) (-1144.027) -- 0:00:41 324500 -- (-1146.024) (-1143.321) (-1143.551) [-1144.289] * [-1144.856] (-1144.654) (-1143.060) (-1143.389) -- 0:00:41 325000 -- [-1145.228] (-1144.767) (-1143.800) (-1147.335) * (-1147.148) (-1143.673) [-1144.059] (-1143.930) -- 0:00:41 Average standard deviation of split frequencies: 0.014862 325500 -- (-1146.572) [-1145.596] (-1144.836) (-1149.018) * [-1144.748] (-1144.816) (-1145.995) (-1144.045) -- 0:00:41 326000 -- (-1148.581) (-1145.426) [-1144.784] (-1143.264) * (-1143.946) (-1143.325) [-1145.935] (-1143.199) -- 0:00:41 326500 -- (-1146.803) (-1146.745) (-1146.549) [-1144.624] * (-1150.797) (-1147.059) [-1151.411] (-1143.939) -- 0:00:41 327000 -- (-1145.633) (-1143.559) [-1144.438] (-1148.404) * (-1145.689) [-1144.666] (-1145.572) (-1143.750) -- 0:00:41 327500 -- (-1144.473) (-1143.700) [-1146.952] (-1145.317) * (-1145.177) [-1146.346] (-1145.546) (-1146.365) -- 0:00:41 328000 -- (-1144.432) [-1144.312] (-1147.193) (-1144.499) * (-1145.438) (-1143.683) (-1144.173) [-1143.593] -- 0:00:40 328500 -- (-1144.104) [-1143.263] (-1143.515) (-1143.731) * (-1147.387) [-1142.310] (-1143.358) (-1146.213) -- 0:00:40 329000 -- (-1144.385) (-1143.530) [-1142.959] (-1144.783) * (-1147.475) (-1142.660) (-1143.775) [-1144.955] -- 0:00:40 329500 -- (-1144.637) (-1143.935) (-1143.336) [-1144.615] * (-1146.304) (-1144.146) (-1143.263) [-1145.734] -- 0:00:40 330000 -- (-1145.521) (-1143.774) (-1144.148) [-1143.343] * [-1150.092] (-1144.752) (-1143.572) (-1145.240) -- 0:00:40 Average standard deviation of split frequencies: 0.015207 330500 -- (-1143.061) (-1146.819) [-1150.064] (-1144.220) * [-1144.847] (-1143.899) (-1146.227) (-1143.080) -- 0:00:42 331000 -- (-1147.318) [-1143.983] (-1148.802) (-1143.303) * [-1145.850] (-1149.365) (-1147.014) (-1143.221) -- 0:00:42 331500 -- [-1147.547] (-1144.718) (-1147.503) (-1145.112) * (-1145.714) (-1143.545) (-1146.008) [-1144.519] -- 0:00:42 332000 -- (-1144.551) (-1144.702) [-1146.675] (-1144.851) * (-1145.152) (-1147.456) [-1143.188] (-1144.431) -- 0:00:42 332500 -- (-1149.430) [-1143.426] (-1146.669) (-1147.577) * [-1149.013] (-1148.296) (-1146.096) (-1145.991) -- 0:00:42 333000 -- (-1148.582) [-1149.331] (-1146.475) (-1146.075) * [-1142.868] (-1143.190) (-1144.590) (-1145.965) -- 0:00:42 333500 -- (-1145.949) [-1145.882] (-1146.457) (-1146.828) * (-1142.934) [-1143.793] (-1143.385) (-1145.403) -- 0:00:41 334000 -- (-1143.409) (-1143.875) [-1143.839] (-1147.997) * (-1142.793) (-1144.497) [-1146.261] (-1143.837) -- 0:00:41 334500 -- (-1146.177) (-1145.704) [-1144.729] (-1150.263) * (-1143.484) (-1145.883) (-1144.036) [-1145.310] -- 0:00:41 335000 -- (-1149.485) (-1144.577) [-1143.746] (-1143.914) * [-1143.038] (-1144.555) (-1143.201) (-1144.929) -- 0:00:41 Average standard deviation of split frequencies: 0.014887 335500 -- (-1144.854) (-1146.060) [-1145.113] (-1143.638) * (-1143.021) (-1148.349) [-1143.314] (-1145.133) -- 0:00:41 336000 -- (-1142.588) (-1145.615) [-1143.754] (-1143.648) * (-1145.852) (-1145.717) [-1144.104] (-1145.445) -- 0:00:41 336500 -- (-1142.841) [-1143.312] (-1143.742) (-1144.374) * (-1144.575) [-1144.690] (-1142.813) (-1146.087) -- 0:00:41 337000 -- (-1143.138) [-1146.040] (-1144.295) (-1144.187) * [-1145.435] (-1145.114) (-1144.669) (-1143.444) -- 0:00:41 337500 -- (-1144.875) [-1142.760] (-1146.411) (-1144.117) * (-1145.505) (-1145.108) (-1145.834) [-1145.950] -- 0:00:41 338000 -- (-1146.346) (-1147.208) [-1144.421] (-1142.721) * (-1145.710) (-1143.969) (-1145.436) [-1144.335] -- 0:00:41 338500 -- (-1143.452) (-1148.783) [-1144.116] (-1144.030) * (-1145.201) [-1143.030] (-1146.107) (-1145.121) -- 0:00:41 339000 -- (-1143.311) [-1145.110] (-1144.606) (-1143.890) * [-1143.453] (-1142.942) (-1146.166) (-1144.794) -- 0:00:40 339500 -- (-1142.297) [-1145.965] (-1144.316) (-1143.747) * (-1145.219) [-1144.578] (-1147.116) (-1144.932) -- 0:00:40 340000 -- [-1146.833] (-1143.179) (-1143.688) (-1145.998) * (-1144.143) [-1145.172] (-1144.453) (-1143.004) -- 0:00:40 Average standard deviation of split frequencies: 0.014530 340500 -- [-1144.691] (-1145.040) (-1144.317) (-1146.788) * (-1144.527) [-1145.292] (-1145.842) (-1146.020) -- 0:00:40 341000 -- (-1144.894) [-1144.687] (-1145.887) (-1145.186) * [-1144.772] (-1144.161) (-1144.288) (-1145.165) -- 0:00:40 341500 -- (-1145.919) (-1145.921) [-1147.306] (-1142.973) * (-1144.735) (-1142.778) (-1145.759) [-1144.930] -- 0:00:40 342000 -- [-1144.539] (-1148.934) (-1144.817) (-1144.511) * [-1144.327] (-1142.978) (-1144.452) (-1145.508) -- 0:00:40 342500 -- (-1144.540) [-1142.370] (-1149.243) (-1143.464) * (-1142.387) (-1145.173) [-1145.575] (-1144.345) -- 0:00:40 343000 -- (-1144.422) (-1143.594) (-1148.896) [-1143.641] * [-1142.388] (-1144.355) (-1146.716) (-1145.657) -- 0:00:40 343500 -- (-1145.270) (-1142.424) (-1143.178) [-1143.089] * (-1143.497) (-1142.830) [-1145.647] (-1148.621) -- 0:00:40 344000 -- (-1147.451) [-1147.616] (-1142.539) (-1143.908) * (-1143.613) [-1143.599] (-1145.906) (-1150.390) -- 0:00:40 344500 -- (-1146.457) [-1144.443] (-1144.973) (-1143.281) * (-1144.480) (-1144.656) (-1144.784) [-1144.814] -- 0:00:39 345000 -- (-1145.456) (-1144.683) [-1147.882] (-1145.332) * (-1145.797) [-1144.615] (-1144.705) (-1143.801) -- 0:00:39 Average standard deviation of split frequencies: 0.013624 345500 -- [-1142.927] (-1145.216) (-1143.799) (-1143.644) * (-1142.804) (-1143.508) [-1146.344] (-1144.708) -- 0:00:39 346000 -- (-1143.782) (-1144.133) [-1145.363] (-1148.322) * (-1146.364) [-1143.806] (-1145.274) (-1147.325) -- 0:00:39 346500 -- (-1148.667) (-1143.501) (-1148.263) [-1146.694] * (-1150.756) (-1143.272) (-1142.885) [-1143.106] -- 0:00:41 347000 -- (-1150.633) (-1145.360) (-1147.909) [-1146.823] * (-1155.143) (-1147.221) (-1142.984) [-1145.139] -- 0:00:41 347500 -- (-1144.858) [-1146.738] (-1145.145) (-1146.317) * (-1154.706) (-1146.244) (-1145.906) [-1144.645] -- 0:00:41 348000 -- (-1145.088) (-1146.250) (-1148.486) [-1147.601] * [-1147.963] (-1144.487) (-1145.018) (-1143.972) -- 0:00:41 348500 -- [-1143.758] (-1144.390) (-1146.881) (-1142.948) * [-1146.122] (-1147.477) (-1144.449) (-1146.709) -- 0:00:41 349000 -- (-1143.652) (-1144.774) [-1147.313] (-1143.104) * (-1149.114) [-1146.285] (-1144.909) (-1149.488) -- 0:00:41 349500 -- (-1146.112) (-1151.896) [-1145.163] (-1143.104) * (-1143.720) (-1143.564) (-1143.990) [-1144.527] -- 0:00:40 350000 -- (-1145.965) (-1150.883) (-1143.767) [-1142.833] * [-1144.977] (-1143.478) (-1144.202) (-1143.916) -- 0:00:40 Average standard deviation of split frequencies: 0.012736 350500 -- (-1147.356) (-1145.842) [-1147.924] (-1145.177) * (-1146.365) (-1143.932) [-1143.317] (-1145.013) -- 0:00:40 351000 -- [-1146.901] (-1144.577) (-1143.313) (-1147.005) * (-1143.414) [-1143.728] (-1143.075) (-1145.308) -- 0:00:40 351500 -- (-1143.634) (-1143.752) (-1147.864) [-1144.568] * [-1143.767] (-1144.929) (-1142.992) (-1146.076) -- 0:00:40 352000 -- (-1145.844) [-1146.349] (-1146.692) (-1144.512) * (-1144.215) (-1143.432) (-1143.618) [-1148.076] -- 0:00:40 352500 -- (-1147.073) (-1147.605) [-1144.370] (-1144.737) * [-1146.541] (-1144.308) (-1144.557) (-1148.684) -- 0:00:40 353000 -- (-1144.034) (-1146.737) [-1143.506] (-1144.862) * (-1146.217) [-1144.448] (-1146.484) (-1143.950) -- 0:00:40 353500 -- (-1143.433) (-1144.742) (-1143.575) [-1146.123] * (-1147.027) (-1142.905) [-1145.683] (-1145.756) -- 0:00:40 354000 -- (-1143.317) [-1144.501] (-1143.989) (-1146.049) * [-1145.377] (-1144.741) (-1143.760) (-1147.230) -- 0:00:40 354500 -- (-1145.550) [-1146.244] (-1144.100) (-1143.967) * (-1145.044) [-1145.273] (-1143.629) (-1147.619) -- 0:00:40 355000 -- (-1145.727) (-1146.415) (-1145.180) [-1143.418] * (-1146.989) (-1146.641) (-1145.414) [-1143.055] -- 0:00:39 Average standard deviation of split frequencies: 0.011918 355500 -- (-1144.622) [-1146.164] (-1149.555) (-1145.428) * [-1145.292] (-1145.445) (-1145.452) (-1145.155) -- 0:00:39 356000 -- (-1147.948) (-1144.603) (-1148.586) [-1143.987] * (-1143.786) [-1146.067] (-1145.122) (-1143.240) -- 0:00:39 356500 -- (-1145.415) (-1143.418) (-1150.670) [-1145.433] * (-1143.849) (-1145.112) (-1143.333) [-1144.429] -- 0:00:39 357000 -- [-1144.607] (-1143.367) (-1146.931) (-1144.673) * (-1144.626) (-1144.823) [-1145.277] (-1145.566) -- 0:00:39 357500 -- (-1144.753) (-1147.030) (-1147.493) [-1142.697] * (-1145.824) (-1145.393) [-1143.254] (-1144.072) -- 0:00:39 358000 -- (-1142.493) (-1144.499) [-1143.287] (-1146.084) * (-1148.290) (-1144.614) (-1144.326) [-1143.986] -- 0:00:39 358500 -- [-1145.403] (-1144.620) (-1145.048) (-1147.906) * (-1146.152) (-1144.826) [-1144.089] (-1145.532) -- 0:00:39 359000 -- (-1145.219) (-1147.083) (-1143.003) [-1147.632] * (-1143.283) [-1143.765] (-1144.971) (-1143.896) -- 0:00:39 359500 -- [-1147.348] (-1146.515) (-1143.699) (-1146.147) * (-1143.429) [-1143.465] (-1144.360) (-1148.453) -- 0:00:39 360000 -- (-1144.958) [-1146.733] (-1142.747) (-1143.457) * (-1143.959) (-1151.940) [-1143.569] (-1145.127) -- 0:00:39 Average standard deviation of split frequencies: 0.012314 360500 -- (-1146.647) (-1144.933) [-1143.647] (-1144.141) * (-1145.742) (-1143.922) (-1145.132) [-1145.433] -- 0:00:39 361000 -- [-1147.346] (-1145.751) (-1144.032) (-1143.328) * (-1145.869) (-1152.277) (-1144.463) [-1145.882] -- 0:00:38 361500 -- (-1147.157) [-1144.521] (-1144.472) (-1143.305) * (-1146.094) [-1142.976] (-1143.424) (-1145.397) -- 0:00:38 362000 -- (-1143.493) (-1145.807) [-1143.823] (-1146.662) * (-1144.857) (-1145.599) (-1147.255) [-1144.686] -- 0:00:38 362500 -- (-1145.752) [-1143.688] (-1144.410) (-1147.198) * (-1143.767) (-1143.411) (-1144.692) [-1142.886] -- 0:00:38 363000 -- [-1146.510] (-1143.645) (-1144.844) (-1145.162) * (-1144.496) (-1142.989) (-1144.479) [-1143.164] -- 0:00:40 363500 -- (-1147.469) (-1149.949) (-1145.362) [-1144.197] * (-1145.582) (-1144.330) [-1143.806] (-1152.249) -- 0:00:40 364000 -- (-1145.689) [-1146.489] (-1144.239) (-1142.672) * (-1146.250) [-1144.161] (-1144.179) (-1146.437) -- 0:00:40 364500 -- (-1143.739) [-1144.747] (-1142.474) (-1142.705) * (-1142.866) (-1149.320) (-1143.586) [-1145.094] -- 0:00:40 365000 -- (-1145.127) (-1143.790) [-1145.965] (-1142.700) * (-1143.445) (-1148.450) (-1146.253) [-1147.577] -- 0:00:40 Average standard deviation of split frequencies: 0.013083 365500 -- (-1144.994) (-1147.981) [-1144.609] (-1142.868) * [-1143.561] (-1148.253) (-1143.277) (-1145.267) -- 0:00:39 366000 -- (-1145.587) (-1150.328) (-1143.427) [-1143.835] * (-1144.304) (-1152.131) (-1144.227) [-1143.183] -- 0:00:39 366500 -- [-1145.302] (-1148.792) (-1150.954) (-1145.926) * (-1145.134) [-1144.027] (-1144.951) (-1143.381) -- 0:00:39 367000 -- (-1144.325) [-1147.221] (-1150.459) (-1143.009) * [-1146.858] (-1147.693) (-1142.902) (-1154.827) -- 0:00:39 367500 -- (-1144.249) [-1144.750] (-1145.784) (-1145.081) * (-1145.389) (-1147.078) (-1145.636) [-1144.679] -- 0:00:39 368000 -- (-1142.827) (-1144.202) [-1147.365] (-1151.422) * (-1145.277) (-1148.248) [-1145.440] (-1145.494) -- 0:00:39 368500 -- [-1142.721] (-1143.417) (-1146.062) (-1144.452) * (-1143.451) (-1150.518) [-1143.818] (-1144.265) -- 0:00:39 369000 -- (-1143.079) [-1146.060] (-1143.753) (-1144.928) * (-1143.416) [-1144.916] (-1145.699) (-1144.032) -- 0:00:39 369500 -- [-1145.758] (-1149.183) (-1144.619) (-1149.230) * [-1142.750] (-1145.942) (-1146.505) (-1147.510) -- 0:00:39 370000 -- (-1143.768) (-1148.032) [-1144.483] (-1145.355) * (-1142.996) [-1143.815] (-1148.145) (-1145.880) -- 0:00:39 Average standard deviation of split frequencies: 0.012450 370500 -- [-1143.755] (-1149.101) (-1144.488) (-1146.449) * (-1148.165) [-1145.746] (-1144.516) (-1145.026) -- 0:00:39 371000 -- [-1144.576] (-1152.090) (-1144.227) (-1144.531) * (-1149.451) (-1143.991) (-1143.439) [-1148.230] -- 0:00:38 371500 -- (-1145.157) (-1143.500) [-1143.928] (-1145.926) * (-1152.200) (-1144.047) (-1143.622) [-1143.592] -- 0:00:38 372000 -- [-1145.695] (-1144.730) (-1144.569) (-1143.611) * [-1147.404] (-1145.545) (-1144.755) (-1148.669) -- 0:00:38 372500 -- (-1144.720) [-1144.928] (-1144.463) (-1147.288) * (-1146.095) (-1147.193) (-1143.952) [-1147.384] -- 0:00:38 373000 -- (-1145.130) (-1149.550) [-1144.274] (-1145.801) * [-1145.483] (-1145.500) (-1150.319) (-1144.302) -- 0:00:38 373500 -- (-1144.788) (-1146.554) [-1143.942] (-1146.723) * (-1144.557) (-1144.184) [-1145.305] (-1143.648) -- 0:00:38 374000 -- (-1144.193) [-1145.554] (-1144.028) (-1146.094) * (-1144.867) [-1144.322] (-1148.435) (-1144.733) -- 0:00:38 374500 -- (-1143.977) (-1143.887) [-1144.712] (-1145.728) * (-1145.413) [-1144.408] (-1144.984) (-1143.870) -- 0:00:38 375000 -- [-1146.624] (-1143.721) (-1143.431) (-1147.951) * (-1145.419) (-1144.535) [-1144.105] (-1148.127) -- 0:00:38 Average standard deviation of split frequencies: 0.012471 375500 -- (-1146.427) (-1144.855) [-1143.998] (-1143.900) * (-1144.446) (-1143.970) [-1143.614] (-1142.949) -- 0:00:38 376000 -- [-1146.950] (-1145.038) (-1143.993) (-1144.080) * (-1146.609) (-1144.581) (-1143.764) [-1150.445] -- 0:00:38 376500 -- (-1145.652) (-1144.042) (-1145.523) [-1143.072] * (-1145.337) (-1145.361) [-1143.432] (-1145.597) -- 0:00:38 377000 -- [-1145.525] (-1146.239) (-1147.994) (-1144.718) * (-1142.670) (-1145.554) (-1143.370) [-1147.595] -- 0:00:38 377500 -- (-1144.549) (-1147.740) (-1143.721) [-1142.686] * (-1143.736) [-1143.929] (-1143.413) (-1145.800) -- 0:00:37 378000 -- (-1146.046) (-1142.933) [-1143.177] (-1149.626) * (-1145.091) (-1143.916) [-1145.201] (-1144.925) -- 0:00:37 378500 -- (-1149.757) (-1147.182) [-1143.687] (-1147.401) * [-1143.689] (-1145.510) (-1144.178) (-1146.481) -- 0:00:37 379000 -- [-1144.230] (-1145.167) (-1146.617) (-1147.424) * [-1145.961] (-1146.511) (-1144.457) (-1147.265) -- 0:00:37 379500 -- [-1143.590] (-1144.968) (-1150.096) (-1152.065) * [-1145.491] (-1143.582) (-1144.575) (-1145.472) -- 0:00:39 380000 -- (-1148.326) (-1145.482) (-1144.534) [-1145.041] * (-1144.203) (-1145.825) (-1144.054) [-1144.851] -- 0:00:39 Average standard deviation of split frequencies: 0.012775 380500 -- (-1146.029) (-1149.314) (-1145.684) [-1146.708] * [-1144.354] (-1145.448) (-1144.160) (-1145.072) -- 0:00:39 381000 -- (-1144.256) (-1142.872) [-1143.531] (-1144.880) * [-1145.003] (-1147.379) (-1143.026) (-1143.052) -- 0:00:38 381500 -- [-1143.126] (-1145.040) (-1146.578) (-1145.292) * [-1144.957] (-1148.750) (-1150.885) (-1148.396) -- 0:00:38 382000 -- (-1145.757) (-1144.939) (-1142.984) [-1142.800] * (-1143.993) (-1144.226) (-1148.329) [-1143.987] -- 0:00:38 382500 -- (-1146.699) [-1143.569] (-1142.874) (-1142.778) * (-1146.559) (-1145.346) (-1145.504) [-1142.598] -- 0:00:38 383000 -- (-1144.090) [-1144.058] (-1147.698) (-1144.807) * (-1142.903) [-1146.242] (-1145.330) (-1143.183) -- 0:00:38 383500 -- [-1144.135] (-1144.439) (-1144.350) (-1143.763) * (-1144.851) (-1144.026) (-1144.264) [-1144.132] -- 0:00:38 384000 -- (-1144.047) (-1146.731) (-1144.019) [-1146.599] * (-1144.344) (-1143.758) [-1147.342] (-1143.080) -- 0:00:38 384500 -- [-1144.307] (-1153.565) (-1143.486) (-1143.851) * (-1144.204) [-1149.409] (-1147.087) (-1142.651) -- 0:00:38 385000 -- (-1146.791) (-1145.579) (-1143.638) [-1142.567] * (-1146.703) (-1147.001) [-1143.399] (-1146.999) -- 0:00:38 Average standard deviation of split frequencies: 0.012791 385500 -- [-1145.875] (-1152.888) (-1144.565) (-1143.878) * (-1144.968) [-1144.928] (-1142.847) (-1143.213) -- 0:00:38 386000 -- (-1143.908) (-1143.726) (-1145.135) [-1144.264] * (-1145.891) (-1144.731) (-1143.459) [-1145.534] -- 0:00:38 386500 -- [-1144.702] (-1145.504) (-1144.030) (-1144.878) * (-1146.619) (-1146.970) (-1142.708) [-1145.033] -- 0:00:38 387000 -- (-1144.555) (-1143.848) (-1146.902) [-1143.992] * [-1145.183] (-1145.548) (-1147.556) (-1143.751) -- 0:00:38 387500 -- [-1144.697] (-1144.550) (-1146.210) (-1145.658) * (-1145.252) [-1147.602] (-1142.738) (-1145.341) -- 0:00:37 388000 -- (-1143.974) [-1144.414] (-1143.059) (-1143.011) * (-1148.658) (-1147.403) [-1142.685] (-1145.398) -- 0:00:37 388500 -- (-1150.461) [-1143.794] (-1143.735) (-1146.455) * (-1146.777) (-1146.898) (-1144.007) [-1144.780] -- 0:00:37 389000 -- (-1143.944) (-1146.090) [-1145.105] (-1143.441) * (-1143.492) [-1146.657] (-1142.990) (-1145.503) -- 0:00:37 389500 -- [-1147.480] (-1144.914) (-1147.123) (-1144.640) * (-1146.595) (-1146.254) (-1145.388) [-1143.440] -- 0:00:37 390000 -- (-1143.549) (-1145.662) (-1149.572) [-1142.797] * [-1142.655] (-1142.958) (-1145.302) (-1145.332) -- 0:00:37 Average standard deviation of split frequencies: 0.012956 390500 -- (-1147.031) (-1146.228) [-1149.606] (-1142.797) * (-1144.853) [-1143.976] (-1143.561) (-1148.221) -- 0:00:37 391000 -- (-1144.378) [-1145.924] (-1145.402) (-1145.711) * (-1144.111) (-1145.054) [-1144.134] (-1144.483) -- 0:00:37 391500 -- (-1143.772) (-1143.371) (-1146.724) [-1147.107] * [-1143.786] (-1145.420) (-1142.767) (-1145.169) -- 0:00:37 392000 -- [-1144.362] (-1146.006) (-1146.739) (-1147.015) * [-1143.832] (-1145.256) (-1143.517) (-1143.611) -- 0:00:37 392500 -- (-1146.394) [-1145.202] (-1147.640) (-1146.985) * [-1144.061] (-1142.915) (-1143.672) (-1142.518) -- 0:00:37 393000 -- [-1143.951] (-1145.034) (-1147.219) (-1145.838) * (-1144.342) [-1143.029] (-1146.366) (-1145.475) -- 0:00:37 393500 -- (-1146.451) (-1144.501) [-1146.720] (-1143.898) * (-1143.501) (-1142.902) (-1143.466) [-1145.372] -- 0:00:36 394000 -- (-1149.712) (-1144.792) (-1145.191) [-1145.486] * [-1142.894] (-1144.094) (-1148.609) (-1143.183) -- 0:00:36 394500 -- [-1148.295] (-1144.320) (-1143.007) (-1143.611) * (-1142.638) (-1147.212) (-1144.715) [-1142.587] -- 0:00:36 395000 -- (-1149.360) [-1144.650] (-1145.317) (-1144.754) * [-1143.642] (-1144.273) (-1144.824) (-1145.595) -- 0:00:36 Average standard deviation of split frequencies: 0.012280 395500 -- [-1143.434] (-1146.037) (-1142.699) (-1146.500) * [-1143.831] (-1144.056) (-1146.188) (-1147.723) -- 0:00:38 396000 -- [-1143.466] (-1146.375) (-1145.091) (-1146.856) * [-1143.135] (-1145.079) (-1143.084) (-1143.144) -- 0:00:38 396500 -- (-1144.641) (-1145.293) (-1143.484) [-1145.464] * (-1146.201) [-1143.776] (-1144.458) (-1143.189) -- 0:00:38 397000 -- (-1150.201) (-1147.470) (-1148.827) [-1147.528] * [-1144.161] (-1144.050) (-1144.254) (-1143.061) -- 0:00:37 397500 -- (-1145.219) [-1145.613] (-1148.760) (-1146.390) * (-1143.473) (-1146.261) (-1142.929) [-1142.848] -- 0:00:37 398000 -- (-1142.681) (-1145.096) (-1146.638) [-1143.097] * (-1144.324) [-1143.619] (-1147.515) (-1142.683) -- 0:00:37 398500 -- (-1142.945) (-1145.688) [-1144.949] (-1144.124) * [-1142.415] (-1145.983) (-1147.961) (-1143.139) -- 0:00:37 399000 -- (-1143.919) [-1145.863] (-1145.451) (-1143.031) * (-1142.415) (-1146.415) [-1142.808] (-1142.769) -- 0:00:37 399500 -- [-1147.407] (-1148.494) (-1145.424) (-1150.999) * (-1144.032) (-1148.809) (-1142.747) [-1144.155] -- 0:00:37 400000 -- (-1142.864) (-1144.917) [-1145.788] (-1144.423) * (-1146.879) (-1150.601) [-1144.666] (-1143.341) -- 0:00:37 Average standard deviation of split frequencies: 0.011766 400500 -- [-1143.051] (-1145.504) (-1143.988) (-1146.061) * (-1144.869) [-1144.066] (-1145.936) (-1147.066) -- 0:00:37 401000 -- [-1142.961] (-1144.800) (-1143.868) (-1143.806) * [-1144.837] (-1143.988) (-1144.601) (-1147.591) -- 0:00:37 401500 -- [-1144.708] (-1147.636) (-1147.615) (-1143.751) * (-1146.799) (-1144.278) [-1143.931] (-1142.696) -- 0:00:37 402000 -- [-1143.491] (-1145.186) (-1145.037) (-1144.388) * (-1144.976) (-1146.843) (-1143.769) [-1143.837] -- 0:00:37 402500 -- [-1144.525] (-1146.034) (-1143.060) (-1143.997) * (-1146.082) [-1143.662] (-1145.622) (-1148.101) -- 0:00:37 403000 -- (-1144.524) (-1149.942) (-1144.494) [-1144.478] * (-1144.893) (-1143.378) [-1142.890] (-1146.264) -- 0:00:37 403500 -- (-1149.165) (-1148.722) (-1148.495) [-1147.670] * (-1150.562) (-1143.210) (-1143.425) [-1143.814] -- 0:00:36 404000 -- [-1143.022] (-1148.188) (-1143.150) (-1143.421) * (-1149.790) (-1144.755) (-1143.041) [-1144.507] -- 0:00:36 404500 -- (-1143.196) (-1149.021) (-1147.720) [-1146.694] * (-1144.314) [-1144.065] (-1143.454) (-1145.111) -- 0:00:36 405000 -- (-1143.036) [-1149.534] (-1142.300) (-1142.871) * [-1142.462] (-1144.132) (-1143.419) (-1142.702) -- 0:00:36 Average standard deviation of split frequencies: 0.011978 405500 -- (-1142.942) [-1142.868] (-1143.002) (-1143.818) * [-1142.555] (-1144.591) (-1144.150) (-1145.171) -- 0:00:36 406000 -- (-1142.599) (-1144.081) (-1146.828) [-1143.195] * (-1146.611) [-1144.190] (-1143.868) (-1145.785) -- 0:00:36 406500 -- (-1144.382) [-1142.600] (-1145.783) (-1143.196) * (-1149.510) (-1144.515) (-1143.088) [-1144.675] -- 0:00:36 407000 -- [-1143.037] (-1144.551) (-1146.499) (-1145.166) * [-1146.211] (-1146.606) (-1143.753) (-1144.095) -- 0:00:36 407500 -- (-1142.986) [-1143.384] (-1146.011) (-1146.736) * [-1145.448] (-1145.940) (-1143.476) (-1147.216) -- 0:00:36 408000 -- [-1143.516] (-1144.583) (-1143.321) (-1145.026) * (-1143.521) [-1145.444] (-1146.626) (-1143.371) -- 0:00:36 408500 -- (-1144.099) (-1145.102) [-1146.580] (-1143.742) * (-1144.136) (-1146.002) (-1142.722) [-1144.374] -- 0:00:36 409000 -- (-1145.555) (-1143.045) [-1142.597] (-1143.355) * [-1144.495] (-1143.505) (-1142.684) (-1143.444) -- 0:00:36 409500 -- (-1146.945) (-1146.578) [-1145.021] (-1144.390) * (-1146.162) (-1144.696) [-1144.064] (-1144.321) -- 0:00:36 410000 -- (-1147.738) (-1149.919) (-1145.538) [-1145.281] * (-1145.175) [-1145.414] (-1145.706) (-1145.060) -- 0:00:35 Average standard deviation of split frequencies: 0.011962 410500 -- (-1143.030) (-1148.280) (-1148.615) [-1147.925] * (-1144.061) [-1143.456] (-1147.439) (-1143.288) -- 0:00:35 411000 -- (-1142.615) (-1145.665) [-1148.257] (-1147.403) * (-1142.959) [-1143.457] (-1144.377) (-1149.638) -- 0:00:35 411500 -- (-1144.487) [-1146.363] (-1148.868) (-1145.932) * (-1143.531) (-1142.845) (-1142.932) [-1142.615] -- 0:00:37 412000 -- (-1145.287) (-1143.604) (-1146.866) [-1147.134] * [-1143.218] (-1143.609) (-1142.822) (-1144.581) -- 0:00:37 412500 -- (-1145.281) (-1145.185) [-1144.941] (-1149.781) * (-1146.551) [-1143.609] (-1145.212) (-1143.643) -- 0:00:37 413000 -- (-1142.521) (-1144.004) [-1142.862] (-1148.560) * (-1145.710) (-1142.963) [-1144.277] (-1144.148) -- 0:00:36 413500 -- [-1142.856] (-1143.367) (-1144.243) (-1146.669) * [-1143.569] (-1142.914) (-1143.071) (-1144.392) -- 0:00:36 414000 -- (-1143.950) [-1143.619] (-1145.413) (-1146.225) * (-1143.571) [-1144.544] (-1144.198) (-1143.016) -- 0:00:36 414500 -- (-1143.459) (-1146.065) [-1146.761] (-1143.202) * (-1143.120) (-1144.723) [-1149.869] (-1143.441) -- 0:00:36 415000 -- (-1145.523) (-1144.839) (-1143.567) [-1143.541] * (-1143.609) [-1144.125] (-1144.559) (-1143.268) -- 0:00:36 Average standard deviation of split frequencies: 0.011665 415500 -- [-1144.320] (-1143.564) (-1143.582) (-1143.816) * (-1143.485) (-1145.407) (-1144.276) [-1145.024] -- 0:00:36 416000 -- (-1153.041) (-1143.162) (-1143.560) [-1145.651] * (-1145.040) [-1143.565] (-1152.369) (-1145.842) -- 0:00:36 416500 -- [-1144.429] (-1143.821) (-1144.324) (-1146.426) * [-1145.042] (-1143.427) (-1150.962) (-1144.578) -- 0:00:36 417000 -- [-1145.154] (-1143.993) (-1143.602) (-1145.671) * (-1143.851) (-1148.649) [-1147.436] (-1143.328) -- 0:00:36 417500 -- (-1144.291) (-1144.970) [-1144.556] (-1144.878) * (-1144.806) (-1148.050) [-1143.541] (-1142.772) -- 0:00:36 418000 -- (-1143.495) [-1145.198] (-1142.716) (-1148.374) * (-1143.904) (-1143.477) [-1144.123] (-1142.871) -- 0:00:36 418500 -- (-1145.440) (-1144.967) (-1143.099) [-1144.887] * [-1144.188] (-1144.733) (-1144.045) (-1142.980) -- 0:00:36 419000 -- (-1145.062) (-1145.228) [-1144.354] (-1146.400) * (-1144.101) (-1144.243) (-1148.312) [-1143.628] -- 0:00:36 419500 -- (-1143.689) (-1142.831) [-1143.727] (-1143.026) * (-1146.927) (-1147.122) (-1146.525) [-1143.653] -- 0:00:35 420000 -- [-1144.689] (-1144.372) (-1143.149) (-1143.674) * [-1143.589] (-1154.802) (-1145.650) (-1143.359) -- 0:00:35 Average standard deviation of split frequencies: 0.012195 420500 -- [-1147.230] (-1142.433) (-1143.786) (-1143.325) * (-1142.651) [-1144.349] (-1143.723) (-1143.925) -- 0:00:35 421000 -- [-1145.316] (-1145.351) (-1144.276) (-1143.987) * (-1143.628) (-1143.727) [-1144.398] (-1144.660) -- 0:00:35 421500 -- [-1143.633] (-1144.648) (-1146.849) (-1145.257) * [-1145.244] (-1144.404) (-1143.785) (-1146.231) -- 0:00:35 422000 -- (-1143.264) (-1148.140) (-1146.009) [-1143.940] * (-1145.926) (-1143.621) [-1143.247] (-1145.971) -- 0:00:35 422500 -- (-1145.323) (-1145.646) (-1152.403) [-1143.866] * (-1146.663) [-1144.452] (-1145.464) (-1148.658) -- 0:00:35 423000 -- (-1144.147) (-1142.403) (-1145.920) [-1143.918] * (-1146.352) [-1145.174] (-1143.582) (-1143.708) -- 0:00:35 423500 -- (-1144.649) (-1142.857) (-1144.165) [-1146.649] * (-1150.299) [-1146.891] (-1144.908) (-1144.629) -- 0:00:35 424000 -- [-1143.601] (-1143.819) (-1144.168) (-1147.643) * (-1144.567) (-1146.460) [-1148.005] (-1143.604) -- 0:00:35 424500 -- (-1144.673) (-1143.681) [-1144.167] (-1143.634) * (-1147.657) (-1143.076) [-1144.923] (-1145.305) -- 0:00:35 425000 -- (-1147.395) (-1143.537) (-1143.372) [-1143.431] * (-1145.268) [-1145.171] (-1148.909) (-1145.192) -- 0:00:35 Average standard deviation of split frequencies: 0.011127 425500 -- (-1145.414) (-1144.058) (-1143.344) [-1142.972] * (-1143.838) [-1143.465] (-1144.241) (-1142.759) -- 0:00:35 426000 -- (-1145.958) [-1144.336] (-1146.057) (-1146.016) * [-1143.784] (-1148.754) (-1143.147) (-1145.867) -- 0:00:35 426500 -- (-1145.810) (-1145.201) (-1145.264) [-1143.214] * (-1144.453) (-1144.338) (-1143.972) [-1144.367] -- 0:00:34 427000 -- (-1143.290) [-1144.063] (-1144.606) (-1143.081) * (-1145.715) [-1146.805] (-1144.896) (-1144.567) -- 0:00:34 427500 -- (-1143.688) (-1146.102) (-1148.432) [-1144.404] * [-1144.783] (-1145.888) (-1149.774) (-1147.286) -- 0:00:34 428000 -- (-1145.385) [-1145.893] (-1147.131) (-1144.514) * (-1142.866) [-1144.755] (-1143.970) (-1145.204) -- 0:00:36 428500 -- (-1144.939) (-1146.602) (-1143.318) [-1142.783] * (-1144.699) [-1143.838] (-1143.871) (-1145.534) -- 0:00:36 429000 -- (-1145.656) (-1147.759) [-1148.088] (-1142.945) * (-1144.383) [-1144.499] (-1146.181) (-1146.769) -- 0:00:35 429500 -- [-1144.095] (-1148.912) (-1143.713) (-1143.915) * (-1149.734) [-1145.719] (-1145.667) (-1146.668) -- 0:00:35 430000 -- (-1146.968) (-1144.176) [-1143.319] (-1143.031) * [-1143.365] (-1145.298) (-1143.646) (-1145.400) -- 0:00:35 Average standard deviation of split frequencies: 0.010882 430500 -- (-1148.074) (-1144.281) [-1143.676] (-1143.743) * (-1144.090) (-1144.486) [-1144.372] (-1144.493) -- 0:00:35 431000 -- (-1150.432) (-1147.199) [-1143.268] (-1142.645) * (-1144.187) (-1144.779) [-1146.876] (-1144.534) -- 0:00:35 431500 -- (-1145.372) [-1143.712] (-1146.052) (-1143.017) * (-1146.310) (-1146.197) [-1145.636] (-1143.551) -- 0:00:35 432000 -- (-1144.543) (-1144.299) [-1144.215] (-1146.581) * (-1144.377) (-1145.965) [-1143.694] (-1142.799) -- 0:00:35 432500 -- (-1144.396) (-1142.481) (-1143.627) [-1145.290] * (-1144.115) [-1145.317] (-1149.113) (-1144.094) -- 0:00:35 433000 -- (-1148.345) [-1142.500] (-1145.351) (-1145.512) * [-1144.800] (-1145.093) (-1145.105) (-1143.699) -- 0:00:35 433500 -- (-1144.312) (-1143.773) (-1143.737) [-1146.662] * (-1143.703) [-1143.303] (-1146.605) (-1145.508) -- 0:00:35 434000 -- (-1144.081) (-1144.257) (-1143.424) [-1142.897] * (-1143.057) (-1147.116) (-1143.601) [-1145.014] -- 0:00:35 434500 -- (-1145.571) (-1143.555) [-1143.213] (-1143.553) * (-1142.424) (-1144.289) (-1144.442) [-1144.100] -- 0:00:35 435000 -- (-1148.001) (-1143.007) (-1146.288) [-1142.672] * (-1142.424) (-1145.859) (-1143.523) [-1144.927] -- 0:00:35 Average standard deviation of split frequencies: 0.010303 435500 -- (-1146.861) (-1144.154) (-1151.040) [-1143.255] * (-1142.545) [-1147.328] (-1144.978) (-1145.507) -- 0:00:34 436000 -- (-1144.811) [-1146.748] (-1147.623) (-1148.492) * (-1143.092) (-1143.581) (-1144.842) [-1142.875] -- 0:00:34 436500 -- (-1144.777) (-1145.683) (-1151.058) [-1143.962] * (-1142.969) [-1143.387] (-1144.672) (-1145.837) -- 0:00:34 437000 -- (-1144.768) [-1147.284] (-1152.553) (-1144.613) * [-1144.450] (-1142.800) (-1145.194) (-1144.504) -- 0:00:34 437500 -- (-1143.239) [-1144.304] (-1153.490) (-1146.140) * [-1142.704] (-1142.772) (-1146.795) (-1146.960) -- 0:00:34 438000 -- [-1144.523] (-1144.267) (-1146.477) (-1144.090) * (-1142.794) (-1145.818) (-1143.565) [-1143.290] -- 0:00:34 438500 -- (-1143.251) (-1143.350) (-1146.172) [-1144.211] * (-1142.985) (-1144.317) [-1143.390] (-1146.628) -- 0:00:34 439000 -- (-1147.348) (-1144.916) (-1144.778) [-1144.081] * (-1143.636) [-1144.379] (-1147.539) (-1148.873) -- 0:00:34 439500 -- [-1143.571] (-1146.104) (-1143.830) (-1143.109) * (-1144.329) (-1143.044) (-1143.072) [-1143.887] -- 0:00:34 440000 -- [-1143.559] (-1145.361) (-1145.735) (-1146.386) * (-1146.238) (-1148.366) [-1142.827] (-1144.344) -- 0:00:34 Average standard deviation of split frequencies: 0.010383 440500 -- (-1143.933) (-1142.549) (-1146.925) [-1142.837] * (-1144.408) (-1143.324) [-1142.623] (-1145.658) -- 0:00:34 441000 -- (-1146.317) (-1144.738) [-1145.044] (-1144.912) * (-1144.766) (-1144.570) [-1142.752] (-1145.654) -- 0:00:34 441500 -- (-1146.814) (-1149.214) [-1145.621] (-1142.502) * [-1145.959] (-1144.108) (-1149.556) (-1150.517) -- 0:00:34 442000 -- (-1144.139) (-1148.607) [-1144.130] (-1143.752) * (-1145.674) [-1144.588] (-1147.418) (-1145.947) -- 0:00:34 442500 -- (-1144.817) (-1147.023) (-1144.532) [-1143.549] * (-1144.717) (-1145.528) [-1142.771] (-1144.306) -- 0:00:34 443000 -- (-1143.541) (-1145.607) (-1142.836) [-1144.212] * (-1146.156) [-1143.369] (-1143.235) (-1145.259) -- 0:00:33 443500 -- [-1143.761] (-1145.330) (-1146.906) (-1152.381) * [-1147.236] (-1145.218) (-1148.310) (-1146.730) -- 0:00:33 444000 -- [-1142.378] (-1145.536) (-1146.285) (-1145.630) * (-1145.578) [-1149.928] (-1146.965) (-1145.459) -- 0:00:35 444500 -- (-1144.567) (-1144.618) (-1144.066) [-1147.653] * [-1151.091] (-1148.459) (-1147.008) (-1144.742) -- 0:00:34 445000 -- [-1145.101] (-1147.287) (-1144.298) (-1145.295) * (-1146.264) [-1144.088] (-1143.117) (-1144.723) -- 0:00:34 Average standard deviation of split frequencies: 0.011067 445500 -- (-1145.739) (-1151.183) [-1144.565] (-1146.109) * (-1144.630) [-1144.950] (-1143.330) (-1144.913) -- 0:00:34 446000 -- (-1150.095) (-1149.469) (-1144.745) [-1145.396] * (-1144.296) (-1145.184) [-1143.716] (-1147.566) -- 0:00:34 446500 -- (-1148.026) [-1145.266] (-1144.961) (-1143.765) * (-1144.040) (-1145.965) [-1143.760] (-1145.620) -- 0:00:34 447000 -- [-1147.971] (-1144.766) (-1146.504) (-1149.775) * (-1143.472) (-1150.244) (-1143.817) [-1144.437] -- 0:00:34 447500 -- [-1143.962] (-1143.393) (-1143.204) (-1147.623) * (-1145.835) [-1151.157] (-1144.249) (-1143.312) -- 0:00:34 448000 -- (-1148.464) [-1143.523] (-1144.962) (-1143.813) * (-1144.932) (-1145.029) (-1146.629) [-1143.560] -- 0:00:34 448500 -- (-1146.655) (-1147.515) (-1144.893) [-1144.691] * (-1144.383) [-1145.269] (-1146.029) (-1142.767) -- 0:00:34 449000 -- (-1146.036) (-1147.318) (-1143.366) [-1144.384] * (-1144.998) (-1144.484) [-1145.576] (-1144.760) -- 0:00:34 449500 -- [-1144.803] (-1147.099) (-1143.200) (-1144.508) * (-1144.300) [-1147.487] (-1147.528) (-1146.448) -- 0:00:34 450000 -- [-1143.841] (-1146.253) (-1149.437) (-1145.187) * (-1143.727) [-1145.672] (-1143.731) (-1145.105) -- 0:00:34 Average standard deviation of split frequencies: 0.009845 450500 -- (-1148.389) [-1142.950] (-1146.166) (-1144.057) * (-1147.003) (-1144.742) [-1143.403] (-1144.800) -- 0:00:34 451000 -- [-1148.764] (-1142.935) (-1143.606) (-1143.056) * [-1143.223] (-1145.462) (-1142.709) (-1143.666) -- 0:00:34 451500 -- [-1142.577] (-1144.475) (-1145.462) (-1143.113) * (-1145.135) (-1144.244) (-1142.648) [-1144.726] -- 0:00:34 452000 -- [-1143.398] (-1143.605) (-1144.718) (-1144.717) * (-1144.071) (-1144.591) (-1146.010) [-1144.378] -- 0:00:33 452500 -- [-1144.090] (-1142.845) (-1145.139) (-1144.542) * [-1144.135] (-1143.962) (-1146.282) (-1144.869) -- 0:00:33 453000 -- [-1145.914] (-1142.909) (-1145.279) (-1145.411) * [-1142.900] (-1145.146) (-1143.933) (-1147.159) -- 0:00:33 453500 -- [-1145.470] (-1143.094) (-1147.092) (-1144.713) * [-1145.206] (-1144.133) (-1144.645) (-1145.413) -- 0:00:33 454000 -- (-1147.192) [-1142.930] (-1145.834) (-1142.433) * (-1143.108) [-1144.196] (-1144.741) (-1146.805) -- 0:00:33 454500 -- (-1144.080) (-1144.730) (-1143.784) [-1143.808] * (-1144.992) (-1144.143) [-1143.988] (-1146.237) -- 0:00:33 455000 -- (-1143.473) (-1145.913) [-1144.007] (-1142.842) * (-1145.733) (-1143.583) (-1143.058) [-1145.325] -- 0:00:33 Average standard deviation of split frequencies: 0.009763 455500 -- [-1143.788] (-1145.949) (-1143.593) (-1143.801) * (-1144.481) [-1145.129] (-1143.158) (-1146.728) -- 0:00:33 456000 -- [-1147.163] (-1144.431) (-1149.183) (-1143.182) * (-1146.565) (-1143.861) [-1143.444] (-1147.137) -- 0:00:33 456500 -- (-1146.374) (-1144.876) [-1147.102] (-1142.969) * (-1144.179) (-1143.402) (-1148.184) [-1144.471] -- 0:00:33 457000 -- [-1146.449] (-1149.941) (-1145.178) (-1142.999) * [-1143.140] (-1143.032) (-1145.804) (-1147.124) -- 0:00:33 457500 -- [-1148.381] (-1145.800) (-1143.463) (-1144.537) * (-1142.915) (-1146.653) (-1143.642) [-1144.609] -- 0:00:33 458000 -- (-1143.668) [-1143.489] (-1143.340) (-1146.809) * (-1143.686) (-1144.978) [-1143.880] (-1144.524) -- 0:00:33 458500 -- (-1146.205) [-1143.482] (-1142.854) (-1143.767) * (-1145.890) (-1144.376) (-1144.328) [-1143.895] -- 0:00:33 459000 -- [-1146.344] (-1145.630) (-1143.374) (-1148.092) * (-1150.768) (-1144.160) [-1143.614] (-1144.430) -- 0:00:33 459500 -- [-1144.369] (-1147.005) (-1143.832) (-1146.288) * (-1145.313) (-1142.824) [-1145.418] (-1144.993) -- 0:00:32 460000 -- (-1145.173) (-1143.644) (-1144.759) [-1143.808] * (-1144.641) [-1145.243] (-1144.658) (-1145.002) -- 0:00:32 Average standard deviation of split frequencies: 0.009752 460500 -- (-1144.005) [-1143.763] (-1146.118) (-1145.463) * (-1142.642) (-1147.204) (-1143.381) [-1148.350] -- 0:00:33 461000 -- (-1143.684) (-1143.378) (-1149.035) [-1145.512] * (-1143.986) (-1149.835) [-1142.865] (-1144.487) -- 0:00:33 461500 -- (-1146.844) (-1145.401) [-1146.009] (-1147.028) * (-1143.754) [-1145.039] (-1142.982) (-1143.270) -- 0:00:33 462000 -- (-1143.310) (-1145.413) [-1148.303] (-1147.061) * [-1146.679] (-1145.282) (-1143.646) (-1143.978) -- 0:00:33 462500 -- [-1145.013] (-1145.852) (-1144.782) (-1149.688) * (-1143.416) (-1148.662) [-1144.620] (-1144.335) -- 0:00:33 463000 -- (-1142.929) [-1144.252] (-1144.384) (-1147.083) * (-1147.074) (-1145.210) (-1143.855) [-1145.535] -- 0:00:33 463500 -- (-1143.069) (-1144.499) (-1144.909) [-1144.619] * (-1144.276) [-1143.551] (-1146.423) (-1149.310) -- 0:00:33 464000 -- [-1143.585] (-1143.460) (-1145.135) (-1146.054) * (-1146.153) [-1144.966] (-1143.285) (-1149.087) -- 0:00:33 464500 -- (-1142.925) (-1146.029) [-1146.830] (-1143.121) * (-1149.368) (-1145.543) [-1143.928] (-1147.269) -- 0:00:33 465000 -- (-1143.105) [-1144.538] (-1144.356) (-1144.312) * (-1142.622) (-1147.130) [-1145.855] (-1148.677) -- 0:00:33 Average standard deviation of split frequencies: 0.009498 465500 -- [-1142.546] (-1146.334) (-1144.315) (-1146.092) * (-1143.126) (-1143.474) [-1144.415] (-1146.050) -- 0:00:33 466000 -- (-1147.549) (-1143.859) (-1146.017) [-1145.745] * (-1143.325) (-1144.694) [-1143.055] (-1146.812) -- 0:00:33 466500 -- [-1145.885] (-1145.899) (-1144.248) (-1145.245) * (-1147.336) (-1143.849) (-1145.261) [-1144.406] -- 0:00:33 467000 -- (-1144.339) [-1144.749] (-1147.013) (-1144.883) * (-1146.060) (-1144.840) [-1143.110] (-1145.004) -- 0:00:33 467500 -- (-1144.803) (-1148.837) (-1143.959) [-1145.089] * (-1149.378) [-1142.636] (-1144.748) (-1143.773) -- 0:00:33 468000 -- (-1143.786) (-1147.580) (-1143.317) [-1144.865] * (-1146.000) [-1143.053] (-1144.160) (-1143.838) -- 0:00:32 468500 -- (-1144.730) [-1145.883] (-1142.764) (-1143.903) * (-1145.564) (-1148.753) (-1148.843) [-1143.727] -- 0:00:32 469000 -- (-1144.504) (-1145.184) [-1144.079] (-1143.941) * [-1142.871] (-1142.955) (-1146.214) (-1144.277) -- 0:00:32 469500 -- (-1147.790) [-1146.758] (-1144.812) (-1149.040) * (-1143.138) (-1143.761) [-1144.058] (-1143.846) -- 0:00:32 470000 -- [-1144.246] (-1144.356) (-1143.375) (-1145.112) * (-1143.826) (-1146.419) (-1142.676) [-1146.086] -- 0:00:32 Average standard deviation of split frequencies: 0.009014 470500 -- (-1148.134) (-1142.663) (-1142.989) [-1144.426] * (-1143.529) (-1145.078) [-1142.573] (-1145.628) -- 0:00:32 471000 -- (-1144.802) (-1144.574) [-1142.894] (-1144.763) * (-1145.630) (-1146.792) (-1143.823) [-1145.781] -- 0:00:32 471500 -- (-1143.847) (-1145.002) [-1143.658] (-1143.356) * [-1144.604] (-1144.813) (-1143.033) (-1142.917) -- 0:00:32 472000 -- (-1143.367) (-1145.916) [-1144.707] (-1143.233) * (-1151.489) [-1143.895] (-1144.064) (-1146.126) -- 0:00:32 472500 -- (-1145.563) [-1143.421] (-1145.327) (-1148.114) * (-1144.613) (-1143.688) [-1145.726] (-1143.704) -- 0:00:32 473000 -- (-1143.004) (-1143.270) (-1144.316) [-1144.828] * (-1145.221) (-1142.755) [-1144.847] (-1143.333) -- 0:00:32 473500 -- (-1143.466) [-1143.588] (-1143.417) (-1142.338) * [-1147.713] (-1146.929) (-1145.895) (-1146.199) -- 0:00:32 474000 -- (-1143.526) (-1142.716) (-1144.366) [-1143.434] * [-1146.363] (-1145.650) (-1144.688) (-1147.441) -- 0:00:32 474500 -- (-1146.405) (-1142.716) [-1150.290] (-1146.357) * (-1147.431) (-1146.866) (-1143.521) [-1144.339] -- 0:00:32 475000 -- (-1144.674) (-1143.699) (-1145.024) [-1145.266] * (-1143.891) (-1146.835) (-1146.092) [-1146.836] -- 0:00:32 Average standard deviation of split frequencies: 0.009729 475500 -- (-1147.533) (-1142.937) (-1147.426) [-1144.239] * (-1144.012) (-1143.323) [-1145.418] (-1144.545) -- 0:00:31 476000 -- (-1149.270) (-1145.162) [-1144.147] (-1143.903) * (-1143.099) (-1143.185) [-1142.844] (-1145.795) -- 0:00:31 476500 -- [-1145.571] (-1142.441) (-1142.769) (-1144.010) * (-1142.829) (-1143.455) [-1143.378] (-1143.825) -- 0:00:32 477000 -- (-1145.494) (-1143.076) (-1143.428) [-1143.689] * (-1142.702) (-1144.557) [-1143.431] (-1144.551) -- 0:00:32 477500 -- [-1147.456] (-1146.877) (-1144.485) (-1143.575) * [-1142.866] (-1145.796) (-1145.426) (-1144.710) -- 0:00:32 478000 -- (-1145.820) (-1142.946) (-1142.595) [-1143.833] * (-1144.264) (-1142.747) (-1144.271) [-1146.772] -- 0:00:32 478500 -- [-1144.366] (-1143.848) (-1143.534) (-1148.149) * (-1143.702) (-1144.161) (-1143.404) [-1146.874] -- 0:00:32 479000 -- (-1144.176) (-1146.172) [-1143.137] (-1144.717) * (-1143.340) [-1143.202] (-1142.921) (-1143.294) -- 0:00:32 479500 -- (-1144.057) (-1144.309) (-1143.277) [-1142.526] * [-1144.041] (-1144.136) (-1142.709) (-1145.321) -- 0:00:32 480000 -- (-1145.252) (-1146.907) (-1148.771) [-1142.526] * (-1143.853) (-1145.263) (-1144.239) [-1144.285] -- 0:00:32 Average standard deviation of split frequencies: 0.009589 480500 -- (-1145.378) (-1142.958) [-1146.885] (-1142.569) * (-1144.340) (-1144.081) [-1145.644] (-1143.522) -- 0:00:32 481000 -- [-1143.262] (-1144.506) (-1143.675) (-1145.311) * (-1143.285) [-1145.768] (-1145.985) (-1147.395) -- 0:00:32 481500 -- (-1144.135) (-1148.922) (-1144.275) [-1146.483] * (-1142.832) [-1144.720] (-1148.617) (-1146.381) -- 0:00:32 482000 -- (-1146.245) [-1146.185] (-1142.949) (-1145.093) * [-1144.039] (-1143.273) (-1143.232) (-1149.049) -- 0:00:32 482500 -- [-1144.855] (-1144.441) (-1144.694) (-1146.998) * (-1144.196) [-1143.934] (-1145.673) (-1150.580) -- 0:00:32 483000 -- (-1144.069) (-1145.357) (-1144.209) [-1145.715] * [-1143.332] (-1143.387) (-1142.862) (-1144.115) -- 0:00:32 483500 -- (-1143.844) (-1146.958) [-1144.006] (-1145.347) * [-1143.248] (-1143.717) (-1142.664) (-1144.150) -- 0:00:32 484000 -- (-1144.484) (-1148.026) (-1143.370) [-1145.843] * (-1146.495) (-1144.960) (-1144.015) [-1145.671] -- 0:00:31 484500 -- [-1145.063] (-1145.538) (-1144.548) (-1145.949) * [-1144.239] (-1144.691) (-1144.658) (-1144.771) -- 0:00:31 485000 -- (-1146.817) (-1147.487) (-1144.892) [-1147.229] * (-1143.966) [-1145.987] (-1142.901) (-1145.324) -- 0:00:31 Average standard deviation of split frequencies: 0.009430 485500 -- (-1142.798) (-1147.429) [-1145.999] (-1144.481) * (-1144.567) [-1142.965] (-1148.138) (-1143.782) -- 0:00:31 486000 -- [-1143.329] (-1143.523) (-1146.249) (-1144.974) * [-1150.655] (-1142.882) (-1145.382) (-1146.011) -- 0:00:31 486500 -- (-1145.663) (-1143.384) [-1144.231] (-1145.289) * (-1146.749) (-1145.415) (-1145.140) [-1142.445] -- 0:00:31 487000 -- [-1143.720] (-1143.071) (-1149.620) (-1143.919) * (-1146.462) (-1145.672) [-1143.310] (-1143.038) -- 0:00:31 487500 -- (-1142.622) [-1143.963] (-1145.688) (-1145.190) * (-1145.716) (-1148.272) (-1145.224) [-1143.251] -- 0:00:31 488000 -- (-1144.714) (-1148.620) (-1146.644) [-1145.067] * (-1149.494) (-1148.319) [-1143.158] (-1151.886) -- 0:00:31 488500 -- (-1145.470) (-1144.857) (-1150.776) [-1143.924] * (-1144.439) (-1148.208) (-1143.777) [-1147.295] -- 0:00:31 489000 -- (-1145.138) (-1143.304) (-1147.763) [-1145.549] * (-1143.053) (-1143.811) [-1146.933] (-1147.058) -- 0:00:31 489500 -- (-1145.476) (-1143.557) (-1143.768) [-1143.173] * (-1143.454) [-1145.156] (-1149.303) (-1148.295) -- 0:00:31 490000 -- (-1144.443) (-1147.536) (-1144.341) [-1142.436] * [-1143.035] (-1142.636) (-1146.774) (-1145.432) -- 0:00:31 Average standard deviation of split frequencies: 0.009874 490500 -- [-1143.819] (-1143.342) (-1145.072) (-1144.157) * (-1144.142) (-1144.223) [-1148.406] (-1145.262) -- 0:00:31 491000 -- (-1147.423) (-1142.761) (-1146.287) [-1148.171] * (-1143.310) [-1146.526] (-1143.109) (-1145.854) -- 0:00:31 491500 -- (-1146.100) (-1143.760) (-1147.483) [-1144.342] * (-1143.310) (-1147.015) (-1143.685) [-1147.258] -- 0:00:31 492000 -- [-1143.367] (-1143.816) (-1146.156) (-1145.293) * (-1143.196) (-1143.219) [-1146.008] (-1151.408) -- 0:00:30 492500 -- (-1143.787) [-1146.033] (-1144.449) (-1144.631) * (-1144.695) [-1143.619] (-1146.837) (-1149.532) -- 0:00:30 493000 -- (-1143.240) (-1144.891) [-1142.584] (-1147.556) * (-1145.915) [-1144.993] (-1143.190) (-1144.553) -- 0:00:31 493500 -- (-1145.562) (-1146.573) (-1144.490) [-1145.471] * [-1143.258] (-1144.329) (-1144.831) (-1143.827) -- 0:00:31 494000 -- [-1147.198] (-1145.394) (-1144.794) (-1145.927) * [-1142.992] (-1143.173) (-1145.160) (-1151.751) -- 0:00:31 494500 -- [-1143.125] (-1145.518) (-1144.084) (-1144.008) * (-1144.021) (-1143.362) [-1145.788] (-1144.685) -- 0:00:31 495000 -- (-1143.191) (-1145.330) (-1143.232) [-1143.939] * (-1143.577) (-1145.773) [-1145.555] (-1148.023) -- 0:00:31 Average standard deviation of split frequencies: 0.010958 495500 -- (-1142.449) [-1145.330] (-1143.232) (-1150.277) * (-1143.852) (-1146.213) (-1147.217) [-1148.284] -- 0:00:31 496000 -- [-1142.737] (-1143.724) (-1145.330) (-1144.464) * (-1147.266) [-1145.101] (-1146.235) (-1144.967) -- 0:00:31 496500 -- (-1142.902) (-1146.820) (-1143.217) [-1146.009] * (-1145.601) (-1145.744) (-1146.445) [-1145.230] -- 0:00:31 497000 -- (-1143.091) [-1145.407] (-1145.629) (-1145.141) * (-1144.779) (-1147.354) (-1150.164) [-1146.563] -- 0:00:31 497500 -- (-1143.232) (-1143.254) [-1144.040] (-1146.141) * [-1144.141] (-1144.820) (-1143.799) (-1143.632) -- 0:00:31 498000 -- (-1142.628) (-1143.708) [-1147.523] (-1142.649) * (-1145.365) (-1144.218) (-1144.211) [-1143.259] -- 0:00:31 498500 -- (-1143.775) (-1143.998) (-1144.245) [-1145.625] * (-1145.425) [-1144.146] (-1144.980) (-1146.614) -- 0:00:31 499000 -- [-1144.563] (-1142.648) (-1144.205) (-1143.646) * (-1144.038) (-1146.121) [-1144.855] (-1144.442) -- 0:00:31 499500 -- (-1146.312) (-1142.927) [-1143.990] (-1142.597) * (-1143.391) [-1143.518] (-1144.417) (-1147.841) -- 0:00:31 500000 -- (-1143.681) (-1145.210) (-1144.656) [-1143.947] * [-1145.034] (-1143.981) (-1144.882) (-1144.756) -- 0:00:31 Average standard deviation of split frequencies: 0.010800 500500 -- [-1143.249] (-1146.714) (-1145.820) (-1146.412) * [-1146.699] (-1144.156) (-1146.918) (-1149.727) -- 0:00:30 501000 -- (-1143.390) [-1145.791] (-1144.222) (-1146.392) * (-1145.564) (-1144.214) [-1145.258] (-1142.986) -- 0:00:30 501500 -- [-1143.494] (-1142.965) (-1145.529) (-1145.224) * (-1145.167) (-1145.742) (-1146.964) [-1143.806] -- 0:00:30 502000 -- (-1144.415) [-1144.568] (-1142.868) (-1146.601) * [-1146.680] (-1146.137) (-1142.999) (-1145.322) -- 0:00:30 502500 -- (-1143.420) (-1149.285) [-1145.630] (-1145.782) * (-1143.809) (-1146.053) [-1143.786] (-1147.663) -- 0:00:30 503000 -- (-1143.093) (-1145.686) (-1143.282) [-1148.020] * (-1143.031) (-1146.554) (-1145.449) [-1145.627] -- 0:00:30 503500 -- (-1142.752) (-1143.039) (-1143.615) [-1142.995] * [-1145.008] (-1144.346) (-1146.086) (-1146.590) -- 0:00:30 504000 -- (-1146.294) (-1142.613) (-1143.423) [-1144.203] * (-1149.836) (-1143.450) [-1146.145] (-1146.317) -- 0:00:30 504500 -- [-1145.799] (-1148.329) (-1144.747) (-1148.822) * (-1146.015) [-1145.880] (-1145.983) (-1146.459) -- 0:00:30 505000 -- (-1145.993) (-1150.239) (-1147.432) [-1143.390] * (-1143.696) [-1145.292] (-1146.936) (-1144.578) -- 0:00:30 Average standard deviation of split frequencies: 0.010960 505500 -- (-1145.255) [-1145.524] (-1145.752) (-1147.239) * (-1143.745) [-1143.142] (-1145.353) (-1143.483) -- 0:00:30 506000 -- (-1148.019) (-1145.356) [-1145.656] (-1142.990) * (-1145.948) [-1144.420] (-1146.603) (-1143.950) -- 0:00:30 506500 -- [-1144.499] (-1145.243) (-1143.954) (-1145.567) * [-1145.809] (-1143.208) (-1145.406) (-1145.772) -- 0:00:30 507000 -- (-1143.558) (-1146.940) [-1146.661] (-1146.087) * (-1142.897) (-1144.452) [-1145.521] (-1142.987) -- 0:00:30 507500 -- [-1143.606] (-1146.254) (-1142.516) (-1146.419) * [-1145.358] (-1145.528) (-1145.175) (-1143.407) -- 0:00:30 508000 -- (-1143.732) (-1145.503) (-1146.637) [-1145.861] * (-1145.867) (-1146.550) (-1146.008) [-1147.562] -- 0:00:30 508500 -- (-1145.723) (-1144.846) (-1147.468) [-1142.770] * (-1145.748) (-1144.769) [-1146.370] (-1143.413) -- 0:00:29 509000 -- (-1144.365) (-1145.709) (-1148.437) [-1144.567] * (-1145.847) (-1145.815) [-1146.934] (-1143.569) -- 0:00:30 509500 -- [-1148.461] (-1142.514) (-1147.767) (-1142.684) * (-1146.606) (-1146.685) [-1144.508] (-1152.730) -- 0:00:30 510000 -- [-1143.940] (-1144.427) (-1146.229) (-1144.728) * [-1148.217] (-1146.412) (-1144.539) (-1152.346) -- 0:00:30 Average standard deviation of split frequencies: 0.010426 510500 -- (-1145.975) (-1144.461) (-1145.580) [-1142.788] * (-1144.507) (-1145.745) [-1147.739] (-1145.325) -- 0:00:30 511000 -- (-1147.084) (-1144.230) (-1147.041) [-1144.867] * (-1143.502) (-1144.811) [-1146.345] (-1145.649) -- 0:00:30 511500 -- (-1146.676) (-1144.628) (-1147.695) [-1143.851] * [-1143.609] (-1142.987) (-1146.905) (-1144.291) -- 0:00:30 512000 -- (-1148.859) (-1145.325) [-1146.775] (-1143.819) * (-1147.152) (-1143.729) [-1143.807] (-1144.618) -- 0:00:30 512500 -- [-1148.924] (-1143.475) (-1143.647) (-1145.454) * (-1146.870) [-1147.533] (-1143.044) (-1144.053) -- 0:00:30 513000 -- [-1148.045] (-1145.013) (-1143.118) (-1145.905) * (-1149.280) [-1144.785] (-1147.549) (-1144.128) -- 0:00:30 513500 -- (-1145.545) (-1143.841) [-1143.571] (-1148.961) * [-1150.785] (-1146.909) (-1143.002) (-1144.099) -- 0:00:30 514000 -- [-1144.434] (-1143.783) (-1143.530) (-1146.278) * (-1147.492) (-1143.587) (-1144.138) [-1142.967] -- 0:00:30 514500 -- (-1143.102) (-1146.005) [-1145.288] (-1144.385) * (-1148.898) (-1145.523) [-1143.191] (-1143.138) -- 0:00:30 515000 -- (-1144.038) (-1143.267) [-1146.036] (-1145.131) * (-1144.967) (-1146.676) [-1142.430] (-1143.791) -- 0:00:30 Average standard deviation of split frequencies: 0.009250 515500 -- (-1148.192) (-1143.950) [-1142.588] (-1145.150) * (-1144.995) [-1142.827] (-1142.833) (-1144.989) -- 0:00:30 516000 -- (-1143.127) (-1144.364) [-1149.730] (-1144.635) * (-1142.735) (-1143.150) [-1143.764] (-1143.052) -- 0:00:30 516500 -- [-1145.752] (-1146.051) (-1144.380) (-1147.076) * [-1144.738] (-1147.226) (-1144.181) (-1149.548) -- 0:00:29 517000 -- (-1143.286) [-1144.050] (-1143.802) (-1143.500) * (-1145.278) (-1145.038) (-1143.856) [-1143.938] -- 0:00:29 517500 -- [-1145.293] (-1143.831) (-1144.191) (-1146.254) * (-1149.473) [-1146.668] (-1143.956) (-1143.819) -- 0:00:29 518000 -- (-1144.084) (-1144.703) (-1144.695) [-1144.845] * (-1147.848) (-1145.225) [-1144.701] (-1145.789) -- 0:00:29 518500 -- (-1143.874) (-1150.214) (-1144.307) [-1144.859] * (-1143.139) (-1145.515) (-1144.187) [-1146.684] -- 0:00:29 519000 -- [-1144.146] (-1152.578) (-1143.992) (-1145.484) * [-1144.084] (-1145.741) (-1144.316) (-1143.827) -- 0:00:29 519500 -- (-1143.061) (-1147.373) [-1148.101] (-1151.669) * (-1145.499) (-1145.242) (-1143.009) [-1145.156] -- 0:00:29 520000 -- (-1146.168) [-1145.771] (-1144.733) (-1144.076) * (-1148.165) (-1147.635) (-1143.428) [-1143.792] -- 0:00:29 Average standard deviation of split frequencies: 0.008658 520500 -- [-1147.331] (-1143.134) (-1146.499) (-1144.414) * (-1148.201) (-1146.033) (-1143.495) [-1145.045] -- 0:00:29 521000 -- (-1147.168) [-1145.328] (-1148.669) (-1143.841) * (-1145.792) (-1144.752) [-1144.201] (-1145.380) -- 0:00:29 521500 -- (-1145.756) [-1145.552] (-1143.896) (-1142.939) * (-1146.663) (-1145.070) (-1145.168) [-1143.840] -- 0:00:29 522000 -- (-1143.555) (-1143.995) [-1143.843] (-1144.095) * [-1145.663] (-1143.667) (-1144.299) (-1143.759) -- 0:00:29 522500 -- [-1144.382] (-1148.729) (-1150.051) (-1146.378) * [-1143.083] (-1144.494) (-1144.110) (-1144.253) -- 0:00:29 523000 -- (-1146.512) (-1145.886) [-1146.336] (-1144.043) * [-1143.100] (-1145.898) (-1145.507) (-1143.556) -- 0:00:29 523500 -- (-1144.502) (-1145.772) (-1147.989) [-1143.523] * (-1145.866) (-1144.850) [-1147.348] (-1143.512) -- 0:00:29 524000 -- [-1144.371] (-1145.202) (-1145.998) (-1144.268) * [-1142.507] (-1142.467) (-1144.492) (-1143.747) -- 0:00:29 524500 -- [-1144.003] (-1147.298) (-1142.756) (-1143.680) * (-1142.743) (-1146.448) [-1147.716] (-1145.644) -- 0:00:29 525000 -- (-1143.504) [-1146.209] (-1142.692) (-1145.469) * [-1143.179] (-1143.991) (-1144.169) (-1145.617) -- 0:00:28 Average standard deviation of split frequencies: 0.008346 525500 -- (-1142.686) [-1145.952] (-1143.374) (-1149.561) * (-1142.346) [-1143.937] (-1147.321) (-1146.173) -- 0:00:29 526000 -- (-1144.047) [-1145.249] (-1143.746) (-1146.535) * [-1142.343] (-1145.623) (-1144.370) (-1144.759) -- 0:00:29 526500 -- (-1144.698) (-1146.968) (-1143.335) [-1148.087] * (-1145.153) (-1142.906) [-1145.923] (-1142.816) -- 0:00:29 527000 -- (-1143.603) (-1146.351) (-1142.843) [-1143.505] * (-1143.401) (-1143.513) [-1147.967] (-1148.531) -- 0:00:29 527500 -- (-1145.237) (-1145.804) [-1143.522] (-1142.942) * (-1145.741) (-1147.547) (-1142.897) [-1143.867] -- 0:00:29 528000 -- (-1144.606) (-1144.741) [-1145.480] (-1146.185) * (-1146.910) (-1147.642) (-1146.716) [-1143.168] -- 0:00:29 528500 -- (-1144.272) [-1144.700] (-1145.545) (-1145.685) * (-1150.983) [-1146.059] (-1144.110) (-1142.817) -- 0:00:29 529000 -- (-1143.566) (-1145.415) [-1144.968] (-1142.987) * (-1146.104) (-1146.578) (-1144.734) [-1144.879] -- 0:00:29 529500 -- (-1143.200) (-1144.996) (-1143.810) [-1142.649] * [-1143.409] (-1149.054) (-1144.502) (-1142.946) -- 0:00:29 530000 -- (-1149.336) (-1148.402) [-1143.305] (-1146.423) * (-1144.297) [-1146.828] (-1145.444) (-1144.983) -- 0:00:29 Average standard deviation of split frequencies: 0.009197 530500 -- [-1146.530] (-1143.829) (-1146.118) (-1146.997) * (-1143.880) (-1143.204) (-1144.407) [-1147.085] -- 0:00:29 531000 -- (-1146.624) (-1144.551) [-1145.577] (-1144.225) * (-1150.116) (-1145.622) (-1145.554) [-1147.567] -- 0:00:29 531500 -- (-1146.874) (-1144.336) [-1144.664] (-1146.159) * (-1145.081) (-1144.473) [-1143.979] (-1146.741) -- 0:00:29 532000 -- (-1146.280) [-1143.075] (-1146.022) (-1146.538) * [-1142.717] (-1150.080) (-1145.758) (-1146.123) -- 0:00:29 532500 -- (-1143.923) [-1143.088] (-1143.699) (-1150.316) * (-1143.122) (-1146.777) [-1145.502] (-1145.186) -- 0:00:28 533000 -- (-1145.093) (-1144.433) [-1142.794] (-1144.324) * (-1147.789) (-1144.677) (-1144.870) [-1144.223] -- 0:00:28 533500 -- (-1145.212) (-1145.331) (-1146.343) [-1144.666] * (-1147.046) (-1144.975) (-1146.204) [-1143.606] -- 0:00:28 534000 -- (-1143.804) [-1143.342] (-1145.502) (-1147.367) * (-1143.382) (-1143.814) [-1145.870] (-1147.393) -- 0:00:28 534500 -- (-1143.742) [-1144.305] (-1145.817) (-1146.147) * (-1149.285) [-1144.615] (-1147.037) (-1146.887) -- 0:00:28 535000 -- (-1143.941) (-1143.928) [-1145.741] (-1145.056) * (-1147.250) [-1143.172] (-1144.160) (-1146.141) -- 0:00:28 Average standard deviation of split frequencies: 0.008898 535500 -- [-1147.598] (-1144.094) (-1144.935) (-1143.805) * [-1143.062] (-1143.372) (-1145.526) (-1145.811) -- 0:00:28 536000 -- (-1144.083) (-1145.792) (-1143.943) [-1147.113] * (-1143.674) (-1148.219) (-1144.454) [-1147.142] -- 0:00:28 536500 -- (-1146.639) [-1143.642] (-1144.872) (-1146.349) * [-1143.475] (-1145.765) (-1145.542) (-1146.167) -- 0:00:28 537000 -- (-1144.586) [-1143.095] (-1146.794) (-1144.344) * (-1145.379) [-1143.197] (-1144.880) (-1144.963) -- 0:00:28 537500 -- [-1147.318] (-1143.555) (-1147.496) (-1143.097) * [-1144.074] (-1143.288) (-1143.395) (-1143.223) -- 0:00:28 538000 -- (-1143.578) (-1144.603) (-1148.274) [-1146.471] * (-1144.674) (-1143.209) (-1146.792) [-1144.455] -- 0:00:28 538500 -- (-1143.782) [-1144.981] (-1151.259) (-1144.188) * [-1144.710] (-1145.623) (-1142.936) (-1144.591) -- 0:00:28 539000 -- (-1143.974) (-1146.348) [-1143.803] (-1144.259) * (-1145.519) (-1144.216) (-1142.959) [-1143.809] -- 0:00:28 539500 -- (-1145.492) [-1144.321] (-1144.725) (-1146.358) * (-1146.914) (-1147.019) (-1144.711) [-1144.615] -- 0:00:28 540000 -- (-1144.818) (-1145.549) (-1144.383) [-1145.991] * (-1142.900) (-1144.961) [-1143.555] (-1143.277) -- 0:00:28 Average standard deviation of split frequencies: 0.008873 540500 -- (-1142.569) (-1144.731) [-1147.254] (-1143.956) * (-1144.883) (-1145.113) [-1144.136] (-1143.673) -- 0:00:28 541000 -- (-1144.353) (-1142.675) [-1145.281] (-1145.102) * (-1143.042) (-1145.943) (-1144.005) [-1145.800] -- 0:00:27 541500 -- (-1147.300) (-1144.740) [-1142.780] (-1147.131) * (-1147.547) (-1146.216) [-1143.399] (-1145.995) -- 0:00:28 542000 -- (-1149.673) [-1145.263] (-1143.413) (-1144.950) * (-1144.842) (-1142.756) (-1143.782) [-1142.905] -- 0:00:28 542500 -- [-1147.094] (-1144.568) (-1144.890) (-1145.017) * (-1145.707) [-1144.533] (-1144.810) (-1143.562) -- 0:00:28 543000 -- [-1145.366] (-1142.858) (-1145.521) (-1143.693) * (-1149.339) (-1146.109) (-1142.598) [-1143.931] -- 0:00:28 543500 -- (-1144.717) (-1146.189) [-1148.951] (-1143.659) * (-1144.732) [-1145.591] (-1144.702) (-1142.967) -- 0:00:28 544000 -- [-1143.866] (-1146.023) (-1146.128) (-1144.014) * [-1142.802] (-1144.318) (-1143.865) (-1143.272) -- 0:00:28 544500 -- (-1151.971) (-1147.355) (-1144.777) [-1145.040] * (-1143.606) (-1144.293) [-1143.683] (-1143.146) -- 0:00:28 545000 -- (-1146.299) [-1145.228] (-1144.181) (-1143.285) * (-1144.495) [-1145.104] (-1142.408) (-1142.587) -- 0:00:28 Average standard deviation of split frequencies: 0.008888 545500 -- (-1146.372) (-1145.418) [-1143.731] (-1146.484) * [-1143.786] (-1144.420) (-1145.734) (-1142.599) -- 0:00:28 546000 -- [-1146.227] (-1146.279) (-1143.019) (-1143.176) * (-1146.701) (-1143.818) (-1143.580) [-1144.793] -- 0:00:28 546500 -- (-1145.355) [-1145.914] (-1142.724) (-1144.109) * [-1146.814] (-1145.591) (-1147.749) (-1142.685) -- 0:00:28 547000 -- [-1148.361] (-1143.477) (-1142.432) (-1143.376) * (-1144.714) [-1150.178] (-1142.677) (-1143.807) -- 0:00:28 547500 -- [-1146.533] (-1145.861) (-1142.890) (-1145.263) * (-1144.691) (-1145.347) (-1143.827) [-1148.891] -- 0:00:28 548000 -- (-1145.811) (-1144.679) [-1144.116] (-1153.416) * (-1143.881) (-1146.114) (-1146.517) [-1145.945] -- 0:00:28 548500 -- (-1145.826) (-1143.859) [-1143.949] (-1145.745) * (-1144.386) [-1143.604] (-1144.857) (-1145.375) -- 0:00:27 549000 -- (-1143.712) (-1143.638) [-1147.551] (-1146.797) * [-1144.725] (-1146.360) (-1145.356) (-1144.457) -- 0:00:27 549500 -- (-1143.417) (-1144.409) (-1144.645) [-1145.056] * (-1142.620) (-1144.533) (-1147.143) [-1143.457] -- 0:00:27 550000 -- (-1143.304) [-1145.552] (-1146.038) (-1144.445) * (-1145.626) [-1143.279] (-1146.099) (-1142.567) -- 0:00:27 Average standard deviation of split frequencies: 0.009165 550500 -- [-1143.313] (-1145.135) (-1149.435) (-1146.944) * [-1144.737] (-1144.150) (-1147.876) (-1144.419) -- 0:00:27 551000 -- [-1145.131] (-1143.407) (-1142.936) (-1146.527) * (-1145.230) (-1144.202) [-1150.279] (-1143.817) -- 0:00:27 551500 -- (-1146.620) [-1145.139] (-1143.430) (-1143.775) * (-1143.340) [-1146.104] (-1146.264) (-1145.262) -- 0:00:27 552000 -- (-1144.749) (-1145.986) (-1146.156) [-1147.191] * (-1144.372) (-1142.811) (-1147.883) [-1145.951] -- 0:00:27 552500 -- [-1146.804] (-1146.591) (-1146.530) (-1145.763) * (-1142.617) (-1142.686) [-1142.816] (-1149.289) -- 0:00:27 553000 -- (-1144.717) (-1143.497) (-1143.840) [-1143.546] * [-1144.125] (-1143.987) (-1145.000) (-1143.765) -- 0:00:27 553500 -- (-1145.844) (-1146.058) [-1143.310] (-1147.952) * (-1143.309) (-1143.848) [-1143.096] (-1143.377) -- 0:00:27 554000 -- [-1147.972] (-1145.689) (-1143.153) (-1150.247) * (-1145.381) (-1143.596) [-1143.087] (-1142.972) -- 0:00:27 554500 -- (-1146.661) [-1144.972] (-1144.146) (-1144.019) * (-1142.412) [-1143.481] (-1143.436) (-1143.142) -- 0:00:27 555000 -- (-1146.367) (-1143.593) (-1147.240) [-1143.247] * (-1142.587) [-1144.362] (-1145.968) (-1143.628) -- 0:00:27 Average standard deviation of split frequencies: 0.009077 555500 -- (-1143.824) [-1145.060] (-1143.166) (-1143.112) * [-1144.938] (-1144.059) (-1147.102) (-1143.524) -- 0:00:27 556000 -- (-1145.505) (-1150.456) [-1143.950] (-1143.377) * [-1144.757] (-1144.192) (-1144.107) (-1143.732) -- 0:00:27 556500 -- (-1143.097) (-1146.027) [-1144.740] (-1144.302) * (-1143.505) [-1144.167] (-1149.988) (-1143.732) -- 0:00:27 557000 -- (-1144.215) (-1143.012) [-1144.993] (-1145.843) * (-1143.521) [-1146.839] (-1146.172) (-1144.476) -- 0:00:27 557500 -- (-1145.670) [-1143.011] (-1150.200) (-1144.005) * [-1146.068] (-1146.284) (-1147.799) (-1148.060) -- 0:00:26 558000 -- (-1143.914) (-1143.637) [-1145.588] (-1142.749) * (-1143.835) (-1147.415) (-1145.942) [-1143.918] -- 0:00:27 558500 -- (-1143.914) (-1144.722) (-1145.347) [-1143.470] * (-1144.999) (-1144.594) (-1144.596) [-1143.654] -- 0:00:27 559000 -- (-1144.058) [-1148.569] (-1144.853) (-1142.598) * [-1145.829] (-1147.562) (-1142.306) (-1145.385) -- 0:00:27 559500 -- [-1143.490] (-1146.094) (-1144.523) (-1143.656) * (-1146.166) [-1143.267] (-1142.468) (-1144.832) -- 0:00:27 560000 -- [-1145.618] (-1145.468) (-1143.631) (-1142.976) * (-1147.551) (-1143.515) (-1142.803) [-1142.512] -- 0:00:27 Average standard deviation of split frequencies: 0.008776 560500 -- (-1143.135) (-1144.527) (-1145.809) [-1144.416] * (-1143.608) (-1142.613) (-1142.853) [-1142.357] -- 0:00:27 561000 -- [-1143.476] (-1149.825) (-1146.597) (-1146.918) * [-1142.863] (-1143.215) (-1143.333) (-1142.985) -- 0:00:27 561500 -- (-1144.462) (-1146.594) [-1144.764] (-1146.194) * (-1145.485) (-1144.050) [-1143.103] (-1147.389) -- 0:00:27 562000 -- [-1143.709] (-1145.106) (-1143.070) (-1144.046) * (-1148.158) (-1143.327) [-1143.985] (-1144.185) -- 0:00:27 562500 -- (-1143.378) (-1148.744) (-1144.957) [-1144.319] * (-1143.212) (-1143.288) (-1145.263) [-1143.755] -- 0:00:27 563000 -- (-1144.029) (-1144.834) [-1143.002] (-1145.148) * (-1144.619) [-1144.715] (-1145.457) (-1144.272) -- 0:00:27 563500 -- [-1146.447] (-1145.834) (-1145.886) (-1144.722) * (-1144.733) (-1148.038) (-1143.462) [-1145.066] -- 0:00:27 564000 -- [-1145.525] (-1146.889) (-1147.279) (-1143.427) * (-1144.515) (-1142.524) [-1143.102] (-1145.066) -- 0:00:27 564500 -- (-1146.009) (-1146.282) (-1143.106) [-1143.438] * (-1145.284) (-1144.794) (-1143.102) [-1144.549] -- 0:00:27 565000 -- (-1151.006) [-1145.921] (-1142.684) (-1147.645) * (-1144.169) [-1145.546] (-1143.200) (-1144.863) -- 0:00:26 Average standard deviation of split frequencies: 0.008917 565500 -- (-1143.148) [-1144.649] (-1143.188) (-1143.076) * (-1144.736) [-1149.925] (-1146.324) (-1142.935) -- 0:00:26 566000 -- (-1147.545) [-1143.582] (-1144.346) (-1143.848) * (-1148.751) [-1143.598] (-1146.236) (-1143.275) -- 0:00:26 566500 -- (-1147.200) (-1144.304) [-1142.408] (-1144.248) * (-1145.411) (-1145.123) [-1144.879] (-1142.713) -- 0:00:26 567000 -- (-1147.178) (-1144.490) (-1149.210) [-1144.083] * (-1143.717) [-1147.892] (-1146.461) (-1142.578) -- 0:00:26 567500 -- (-1146.249) [-1144.159] (-1149.276) (-1143.356) * (-1144.067) (-1149.808) (-1145.907) [-1143.326] -- 0:00:26 568000 -- (-1143.980) (-1143.906) (-1148.655) [-1144.700] * (-1145.113) (-1147.041) (-1146.844) [-1142.916] -- 0:00:26 568500 -- [-1143.923] (-1146.785) (-1146.900) (-1142.971) * (-1146.800) [-1143.973] (-1142.457) (-1142.620) -- 0:00:26 569000 -- (-1144.019) (-1144.937) [-1147.885] (-1142.784) * (-1146.639) (-1143.597) [-1143.205] (-1142.320) -- 0:00:26 569500 -- (-1143.641) [-1143.730] (-1146.845) (-1145.313) * (-1142.531) [-1144.036] (-1144.674) (-1143.058) -- 0:00:26 570000 -- [-1144.622] (-1144.879) (-1144.197) (-1143.417) * [-1145.040] (-1143.139) (-1145.908) (-1143.624) -- 0:00:26 Average standard deviation of split frequencies: 0.009345 570500 -- [-1145.076] (-1144.818) (-1146.278) (-1144.405) * (-1148.198) (-1143.956) (-1146.337) [-1145.440] -- 0:00:26 571000 -- [-1146.127] (-1142.940) (-1149.273) (-1144.017) * (-1145.153) (-1147.819) [-1144.624] (-1147.204) -- 0:00:26 571500 -- [-1144.909] (-1143.318) (-1144.643) (-1144.796) * [-1145.465] (-1143.369) (-1145.945) (-1145.228) -- 0:00:26 572000 -- (-1143.675) (-1146.404) (-1145.320) [-1143.635] * [-1144.454] (-1143.233) (-1144.548) (-1149.191) -- 0:00:26 572500 -- (-1144.357) (-1147.809) (-1144.430) [-1142.858] * (-1145.962) (-1143.338) (-1144.960) [-1142.943] -- 0:00:26 573000 -- (-1144.477) (-1144.902) (-1145.974) [-1148.381] * (-1146.435) (-1145.250) (-1144.873) [-1144.955] -- 0:00:26 573500 -- [-1147.038] (-1142.525) (-1143.220) (-1146.407) * (-1150.224) (-1146.170) (-1144.267) [-1144.091] -- 0:00:26 574000 -- (-1148.486) (-1146.204) (-1147.119) [-1144.260] * (-1145.950) (-1147.728) (-1143.896) [-1146.845] -- 0:00:25 574500 -- [-1151.306] (-1143.157) (-1143.281) (-1142.739) * (-1145.674) (-1146.671) [-1145.685] (-1143.639) -- 0:00:26 575000 -- (-1147.869) [-1145.706] (-1142.882) (-1143.587) * (-1144.906) (-1145.024) (-1145.178) [-1143.080] -- 0:00:26 Average standard deviation of split frequencies: 0.009207 575500 -- (-1144.259) (-1144.220) (-1142.604) [-1144.462] * [-1144.801] (-1145.110) (-1144.011) (-1143.636) -- 0:00:26 576000 -- (-1150.999) (-1151.257) [-1144.570] (-1143.999) * (-1147.251) (-1144.956) (-1143.855) [-1143.339] -- 0:00:26 576500 -- (-1147.406) [-1144.345] (-1145.433) (-1143.081) * [-1146.445] (-1143.036) (-1146.279) (-1145.345) -- 0:00:26 577000 -- (-1144.596) (-1147.158) (-1143.542) [-1143.086] * [-1144.933] (-1144.862) (-1144.974) (-1144.780) -- 0:00:26 577500 -- (-1148.362) (-1143.855) (-1144.339) [-1143.829] * (-1145.026) (-1145.841) [-1145.002] (-1146.936) -- 0:00:26 578000 -- (-1147.067) [-1144.143] (-1147.023) (-1143.294) * (-1144.081) [-1143.568] (-1145.753) (-1148.312) -- 0:00:26 578500 -- (-1145.470) (-1145.121) (-1145.551) [-1144.206] * (-1146.077) (-1144.907) (-1144.930) [-1147.939] -- 0:00:26 579000 -- (-1144.689) [-1145.252] (-1143.979) (-1143.647) * (-1145.262) (-1144.768) [-1145.436] (-1148.217) -- 0:00:26 579500 -- (-1143.746) (-1144.078) [-1143.853] (-1143.175) * [-1144.928] (-1143.389) (-1146.027) (-1146.286) -- 0:00:26 580000 -- [-1144.663] (-1143.442) (-1147.246) (-1143.165) * [-1147.854] (-1143.310) (-1147.468) (-1146.080) -- 0:00:26 Average standard deviation of split frequencies: 0.009539 580500 -- [-1145.313] (-1144.665) (-1144.221) (-1143.540) * (-1149.827) [-1143.320] (-1146.332) (-1143.047) -- 0:00:26 581000 -- (-1150.990) (-1145.025) [-1147.399] (-1146.453) * (-1146.850) (-1142.839) [-1143.458] (-1144.409) -- 0:00:25 581500 -- [-1145.932] (-1145.657) (-1143.651) (-1145.266) * [-1145.452] (-1145.415) (-1145.721) (-1144.439) -- 0:00:25 582000 -- (-1145.020) (-1145.553) (-1143.493) [-1143.526] * (-1145.016) (-1150.735) (-1145.054) [-1143.698] -- 0:00:25 582500 -- (-1145.711) (-1142.846) (-1145.258) [-1143.585] * (-1147.415) (-1148.348) (-1149.297) [-1143.810] -- 0:00:25 583000 -- [-1145.878] (-1144.331) (-1145.247) (-1144.511) * (-1146.294) [-1145.810] (-1143.634) (-1147.000) -- 0:00:25 583500 -- [-1145.299] (-1142.732) (-1144.503) (-1144.623) * (-1144.689) (-1146.150) (-1145.179) [-1144.155] -- 0:00:25 584000 -- [-1147.039] (-1142.727) (-1144.416) (-1148.209) * [-1144.235] (-1145.443) (-1143.349) (-1143.565) -- 0:00:25 584500 -- (-1146.216) [-1143.978] (-1146.485) (-1149.484) * (-1152.380) (-1143.704) [-1144.594] (-1143.427) -- 0:00:25 585000 -- (-1143.395) (-1150.316) (-1143.411) [-1144.572] * (-1146.999) (-1148.141) (-1142.570) [-1145.580] -- 0:00:25 Average standard deviation of split frequencies: 0.009452 585500 -- (-1145.071) (-1145.511) (-1147.175) [-1143.542] * (-1147.035) [-1142.889] (-1144.474) (-1143.113) -- 0:00:25 586000 -- [-1143.996] (-1143.064) (-1145.133) (-1144.827) * (-1144.258) [-1142.719] (-1146.349) (-1145.502) -- 0:00:25 586500 -- (-1143.658) (-1142.936) [-1144.114] (-1143.838) * (-1143.515) [-1142.553] (-1143.412) (-1144.592) -- 0:00:25 587000 -- (-1143.052) [-1144.984] (-1143.028) (-1147.753) * (-1145.542) [-1143.002] (-1142.687) (-1148.113) -- 0:00:25 587500 -- (-1143.789) (-1143.166) [-1145.905] (-1143.009) * (-1144.778) (-1143.110) (-1144.108) [-1146.197] -- 0:00:25 588000 -- [-1146.542] (-1143.123) (-1147.201) (-1143.139) * (-1143.324) (-1144.201) [-1145.879] (-1148.745) -- 0:00:25 588500 -- (-1146.953) (-1142.963) [-1148.205] (-1142.739) * (-1144.312) [-1142.937] (-1147.089) (-1146.382) -- 0:00:25 589000 -- (-1147.030) [-1143.787] (-1146.516) (-1150.870) * (-1144.475) (-1143.773) (-1145.943) [-1143.526] -- 0:00:25 589500 -- (-1144.884) (-1142.507) (-1145.380) [-1147.345] * [-1143.870] (-1143.652) (-1145.254) (-1146.740) -- 0:00:25 590000 -- (-1143.584) [-1144.646] (-1143.320) (-1144.557) * (-1143.842) (-1150.332) [-1146.443] (-1144.500) -- 0:00:25 Average standard deviation of split frequencies: 0.009078 590500 -- [-1143.181] (-1143.963) (-1146.969) (-1142.791) * (-1142.955) [-1151.432] (-1143.528) (-1145.906) -- 0:00:25 591000 -- (-1144.866) (-1143.490) [-1144.600] (-1143.935) * (-1143.892) (-1148.579) (-1143.982) [-1146.081] -- 0:00:25 591500 -- [-1145.299] (-1142.694) (-1143.440) (-1143.200) * [-1144.856] (-1148.485) (-1146.353) (-1149.092) -- 0:00:25 592000 -- (-1150.839) [-1144.005] (-1143.724) (-1144.666) * (-1145.127) [-1147.557] (-1146.975) (-1143.734) -- 0:00:25 592500 -- (-1147.191) [-1144.830] (-1145.170) (-1144.578) * (-1142.496) [-1146.715] (-1143.719) (-1143.297) -- 0:00:25 593000 -- (-1144.535) (-1143.472) [-1143.832] (-1146.574) * (-1146.393) [-1145.226] (-1147.446) (-1143.227) -- 0:00:25 593500 -- (-1145.314) (-1147.019) [-1143.260] (-1144.220) * (-1145.010) [-1144.777] (-1146.182) (-1142.519) -- 0:00:25 594000 -- (-1146.614) (-1148.062) (-1144.851) [-1146.948] * (-1145.669) [-1144.404] (-1144.413) (-1142.885) -- 0:00:25 594500 -- (-1150.907) (-1143.394) [-1144.649] (-1148.084) * (-1149.544) (-1146.461) (-1146.372) [-1145.087] -- 0:00:25 595000 -- [-1145.502] (-1146.334) (-1144.807) (-1146.754) * [-1144.040] (-1144.733) (-1143.261) (-1147.614) -- 0:00:25 Average standard deviation of split frequencies: 0.009195 595500 -- (-1142.819) (-1143.735) (-1146.391) [-1149.922] * (-1143.151) [-1145.069] (-1142.570) (-1145.084) -- 0:00:25 596000 -- (-1142.935) (-1143.976) (-1145.995) [-1146.741] * [-1143.806] (-1143.890) (-1142.866) (-1148.165) -- 0:00:25 596500 -- (-1148.130) (-1145.406) [-1145.757] (-1148.324) * [-1144.731] (-1143.988) (-1145.788) (-1148.772) -- 0:00:25 597000 -- [-1146.032] (-1143.471) (-1145.321) (-1145.598) * (-1145.918) (-1144.005) [-1142.514] (-1146.008) -- 0:00:24 597500 -- (-1144.703) (-1145.719) (-1144.863) [-1143.789] * [-1144.014] (-1144.848) (-1146.622) (-1142.837) -- 0:00:24 598000 -- (-1144.829) [-1143.437] (-1146.590) (-1143.786) * [-1142.398] (-1145.298) (-1146.119) (-1143.834) -- 0:00:24 598500 -- [-1145.947] (-1142.919) (-1148.367) (-1147.362) * (-1142.390) (-1148.529) (-1152.085) [-1146.170] -- 0:00:24 599000 -- (-1147.244) [-1143.294] (-1149.628) (-1146.580) * [-1143.742] (-1145.069) (-1145.895) (-1146.975) -- 0:00:24 599500 -- (-1143.895) [-1146.898] (-1143.546) (-1145.529) * (-1143.867) (-1145.342) [-1147.774] (-1149.504) -- 0:00:24 600000 -- (-1143.896) (-1145.458) (-1148.743) [-1144.821] * (-1143.649) [-1145.630] (-1144.349) (-1143.633) -- 0:00:24 Average standard deviation of split frequencies: 0.009467 600500 -- (-1144.747) (-1143.525) (-1144.276) [-1142.966] * (-1145.621) [-1143.549] (-1145.890) (-1145.522) -- 0:00:24 601000 -- (-1145.047) (-1143.110) [-1146.014] (-1143.563) * (-1144.291) (-1144.621) [-1144.524] (-1148.123) -- 0:00:24 601500 -- (-1145.137) [-1145.169] (-1143.179) (-1144.885) * (-1145.892) [-1143.537] (-1142.742) (-1146.012) -- 0:00:24 602000 -- (-1143.292) [-1143.314] (-1145.328) (-1144.389) * [-1143.649] (-1145.140) (-1142.987) (-1144.695) -- 0:00:24 602500 -- (-1145.187) [-1144.260] (-1144.119) (-1144.451) * (-1143.395) [-1144.189] (-1144.189) (-1146.182) -- 0:00:24 603000 -- (-1143.746) (-1143.102) (-1145.277) [-1145.723] * (-1143.221) [-1143.990] (-1143.024) (-1146.242) -- 0:00:24 603500 -- (-1145.833) (-1142.763) (-1146.407) [-1144.608] * (-1144.127) (-1144.387) [-1146.256] (-1147.486) -- 0:00:24 604000 -- [-1144.208] (-1143.308) (-1144.236) (-1143.680) * (-1146.659) (-1150.427) (-1146.468) [-1146.316] -- 0:00:24 604500 -- (-1146.140) (-1143.970) (-1145.726) [-1143.492] * (-1144.789) [-1145.644] (-1144.229) (-1145.056) -- 0:00:24 605000 -- (-1142.604) (-1144.730) [-1146.456] (-1145.995) * [-1144.040] (-1147.824) (-1143.678) (-1145.572) -- 0:00:24 Average standard deviation of split frequencies: 0.009821 605500 -- (-1147.690) [-1145.221] (-1146.611) (-1146.063) * (-1144.057) [-1148.753] (-1143.012) (-1146.187) -- 0:00:24 606000 -- (-1146.936) [-1147.526] (-1145.268) (-1146.843) * [-1146.101] (-1145.803) (-1147.033) (-1143.636) -- 0:00:24 606500 -- (-1145.240) (-1145.060) (-1145.446) [-1143.117] * (-1144.931) (-1142.750) [-1144.734] (-1143.074) -- 0:00:24 607000 -- [-1144.854] (-1142.594) (-1145.562) (-1143.795) * (-1144.547) (-1142.287) [-1144.562] (-1143.085) -- 0:00:24 607500 -- [-1145.522] (-1144.535) (-1144.540) (-1144.751) * (-1147.862) (-1142.383) [-1143.330] (-1148.194) -- 0:00:24 608000 -- (-1143.109) (-1145.224) (-1145.884) [-1144.102] * (-1146.775) (-1144.923) (-1146.364) [-1145.489] -- 0:00:24 608500 -- (-1144.210) (-1144.722) (-1143.373) [-1142.967] * (-1145.910) (-1145.994) [-1143.485] (-1144.889) -- 0:00:24 609000 -- (-1147.064) [-1145.240] (-1142.855) (-1145.592) * (-1144.791) (-1143.977) [-1145.156] (-1147.275) -- 0:00:24 609500 -- (-1147.720) (-1143.407) (-1143.679) [-1145.802] * (-1144.092) (-1146.288) [-1145.139] (-1145.306) -- 0:00:24 610000 -- [-1145.624] (-1144.201) (-1144.841) (-1149.375) * (-1144.051) [-1144.867] (-1147.884) (-1145.153) -- 0:00:24 Average standard deviation of split frequencies: 0.009842 610500 -- (-1145.224) (-1143.311) (-1144.405) [-1144.513] * (-1144.534) (-1145.693) (-1149.360) [-1143.295] -- 0:00:24 611000 -- (-1143.649) [-1143.723] (-1146.168) (-1144.164) * (-1145.997) (-1147.107) (-1148.703) [-1144.180] -- 0:00:24 611500 -- (-1145.577) [-1145.314] (-1144.281) (-1145.778) * (-1144.204) (-1145.679) [-1143.435] (-1143.055) -- 0:00:24 612000 -- [-1144.966] (-1147.611) (-1145.644) (-1146.388) * (-1143.605) (-1147.412) (-1143.189) [-1144.638] -- 0:00:24 612500 -- [-1142.850] (-1147.484) (-1145.874) (-1144.204) * (-1143.900) [-1142.775] (-1144.225) (-1143.675) -- 0:00:24 613000 -- (-1147.956) (-1143.416) [-1147.471] (-1145.053) * (-1143.572) (-1144.304) (-1144.130) [-1145.207] -- 0:00:23 613500 -- (-1146.739) (-1142.949) [-1144.749] (-1145.247) * (-1142.701) (-1143.283) (-1143.831) [-1142.660] -- 0:00:23 614000 -- (-1144.927) (-1143.500) (-1144.654) [-1144.517] * [-1145.848] (-1143.497) (-1147.529) (-1143.676) -- 0:00:23 614500 -- [-1145.264] (-1144.120) (-1146.571) (-1144.452) * (-1143.068) (-1145.163) (-1143.807) [-1145.605] -- 0:00:23 615000 -- (-1145.044) (-1142.460) [-1142.718] (-1143.107) * (-1142.932) (-1143.948) (-1144.093) [-1143.219] -- 0:00:23 Average standard deviation of split frequencies: 0.009518 615500 -- (-1143.651) (-1143.518) (-1144.150) [-1142.946] * [-1143.220] (-1143.100) (-1145.215) (-1144.203) -- 0:00:23 616000 -- (-1144.747) (-1145.358) [-1146.092] (-1144.103) * (-1142.626) [-1142.918] (-1142.485) (-1144.003) -- 0:00:23 616500 -- (-1143.554) (-1143.616) (-1145.730) [-1143.130] * (-1145.135) [-1144.840] (-1145.972) (-1145.174) -- 0:00:23 617000 -- (-1147.401) (-1144.299) (-1145.889) [-1142.751] * (-1144.451) (-1144.689) (-1145.276) [-1144.527] -- 0:00:23 617500 -- (-1149.482) (-1145.577) (-1144.571) [-1146.712] * (-1147.159) (-1143.020) (-1143.728) [-1151.379] -- 0:00:23 618000 -- [-1144.952] (-1145.400) (-1143.826) (-1146.353) * (-1144.124) [-1143.579] (-1143.057) (-1151.754) -- 0:00:23 618500 -- (-1146.116) (-1144.848) [-1145.572] (-1144.222) * (-1143.776) [-1143.116] (-1145.353) (-1146.797) -- 0:00:23 619000 -- [-1146.806] (-1144.107) (-1145.921) (-1150.001) * (-1146.696) [-1145.481] (-1143.396) (-1146.242) -- 0:00:23 619500 -- (-1150.978) (-1145.957) [-1143.301] (-1147.567) * (-1143.859) (-1143.372) (-1145.708) [-1147.473] -- 0:00:23 620000 -- (-1147.486) [-1144.253] (-1144.476) (-1144.147) * [-1144.357] (-1145.758) (-1144.617) (-1144.758) -- 0:00:23 Average standard deviation of split frequencies: 0.009684 620500 -- (-1145.191) (-1143.609) [-1144.354] (-1145.620) * (-1143.732) (-1142.683) [-1143.545] (-1144.532) -- 0:00:23 621000 -- (-1145.985) [-1144.535] (-1145.769) (-1152.392) * (-1143.846) (-1144.255) [-1142.656] (-1143.544) -- 0:00:23 621500 -- [-1146.781] (-1144.251) (-1144.219) (-1147.114) * (-1145.108) [-1143.214] (-1143.963) (-1143.958) -- 0:00:23 622000 -- (-1146.110) [-1145.417] (-1146.925) (-1145.245) * (-1143.589) [-1142.601] (-1146.042) (-1145.131) -- 0:00:23 622500 -- [-1142.779] (-1145.358) (-1145.263) (-1143.934) * (-1144.897) (-1143.983) [-1144.756] (-1147.327) -- 0:00:23 623000 -- (-1144.067) (-1143.092) [-1144.594] (-1145.057) * (-1146.194) [-1142.835] (-1151.598) (-1144.945) -- 0:00:22 623500 -- (-1144.103) (-1143.131) (-1145.695) [-1144.954] * (-1142.260) [-1142.977] (-1151.525) (-1146.053) -- 0:00:23 624000 -- (-1146.070) [-1145.048] (-1145.950) (-1146.972) * (-1144.485) [-1146.713] (-1146.983) (-1145.781) -- 0:00:23 624500 -- (-1146.364) (-1145.518) [-1148.996] (-1147.419) * [-1143.896] (-1145.550) (-1149.724) (-1144.159) -- 0:00:23 625000 -- (-1143.399) (-1145.901) [-1147.289] (-1146.829) * (-1143.464) [-1146.364] (-1146.651) (-1144.109) -- 0:00:23 Average standard deviation of split frequencies: 0.009837 625500 -- (-1145.005) (-1144.549) [-1145.110] (-1144.005) * (-1143.456) (-1146.365) [-1143.081] (-1143.528) -- 0:00:23 626000 -- [-1145.767] (-1143.870) (-1143.531) (-1145.437) * (-1143.306) [-1142.658] (-1145.694) (-1148.981) -- 0:00:23 626500 -- (-1143.674) (-1143.514) (-1145.410) [-1143.767] * (-1144.137) [-1146.129] (-1144.894) (-1143.484) -- 0:00:23 627000 -- (-1144.431) (-1144.298) (-1143.221) [-1142.710] * (-1145.430) (-1146.067) (-1145.564) [-1145.136] -- 0:00:23 627500 -- (-1144.983) (-1144.151) (-1143.026) [-1143.888] * (-1147.272) (-1145.449) [-1143.246] (-1144.538) -- 0:00:23 628000 -- [-1144.493] (-1142.673) (-1143.912) (-1143.859) * (-1146.879) [-1142.867] (-1146.301) (-1143.770) -- 0:00:23 628500 -- [-1144.066] (-1144.239) (-1144.367) (-1143.484) * (-1143.672) (-1142.790) [-1143.944] (-1146.663) -- 0:00:23 629000 -- (-1147.515) (-1142.842) [-1145.714] (-1142.903) * [-1145.890] (-1144.455) (-1143.315) (-1144.848) -- 0:00:23 629500 -- (-1145.616) (-1144.918) [-1145.621] (-1142.941) * (-1145.893) [-1144.690] (-1143.776) (-1143.395) -- 0:00:22 630000 -- [-1148.838] (-1142.804) (-1146.323) (-1143.020) * (-1148.195) (-1143.856) [-1142.942] (-1144.658) -- 0:00:22 Average standard deviation of split frequencies: 0.009811 630500 -- (-1150.152) (-1142.722) (-1148.049) [-1143.293] * (-1146.519) (-1144.478) (-1142.747) [-1142.788] -- 0:00:22 631000 -- (-1148.750) (-1146.904) (-1146.060) [-1144.196] * (-1144.254) [-1145.720] (-1145.134) (-1142.888) -- 0:00:22 631500 -- (-1146.400) [-1151.381] (-1142.895) (-1144.547) * (-1150.533) (-1143.301) [-1142.832] (-1147.662) -- 0:00:22 632000 -- (-1144.806) [-1146.769] (-1145.228) (-1142.858) * (-1143.559) [-1143.853] (-1142.818) (-1144.457) -- 0:00:22 632500 -- (-1143.591) (-1143.393) [-1144.043] (-1142.838) * [-1144.423] (-1143.467) (-1145.948) (-1143.957) -- 0:00:22 633000 -- (-1147.795) [-1143.806] (-1143.992) (-1144.697) * (-1148.834) (-1145.070) [-1146.740] (-1143.570) -- 0:00:22 633500 -- (-1145.918) (-1144.009) [-1143.347] (-1142.750) * (-1145.581) (-1143.544) [-1147.162] (-1149.152) -- 0:00:22 634000 -- (-1143.489) (-1144.951) (-1143.558) [-1143.486] * [-1148.306] (-1143.513) (-1144.654) (-1145.881) -- 0:00:22 634500 -- (-1146.956) [-1147.835] (-1144.500) (-1145.798) * (-1146.427) (-1143.655) (-1146.586) [-1148.382] -- 0:00:22 635000 -- [-1144.364] (-1152.047) (-1143.044) (-1147.772) * [-1145.208] (-1143.357) (-1145.768) (-1149.601) -- 0:00:22 Average standard deviation of split frequencies: 0.009775 635500 -- (-1142.947) (-1144.144) (-1142.403) [-1143.044] * [-1145.966] (-1151.374) (-1145.722) (-1148.562) -- 0:00:22 636000 -- (-1145.380) (-1146.496) [-1143.511] (-1145.280) * (-1145.112) (-1147.744) [-1146.448] (-1146.851) -- 0:00:22 636500 -- (-1146.807) (-1144.113) [-1143.096] (-1143.399) * [-1145.896] (-1145.904) (-1146.231) (-1146.812) -- 0:00:22 637000 -- (-1147.056) [-1143.565] (-1144.792) (-1143.114) * [-1144.304] (-1145.509) (-1143.791) (-1142.542) -- 0:00:22 637500 -- (-1144.339) [-1144.585] (-1143.102) (-1144.362) * (-1144.085) [-1144.729] (-1143.836) (-1144.903) -- 0:00:22 638000 -- [-1144.602] (-1143.991) (-1144.571) (-1145.530) * (-1143.373) (-1145.252) (-1143.312) [-1145.409] -- 0:00:22 638500 -- [-1143.719] (-1145.652) (-1144.843) (-1146.247) * [-1144.048] (-1144.282) (-1145.241) (-1142.720) -- 0:00:22 639000 -- (-1145.444) (-1142.820) (-1149.832) [-1143.683] * (-1146.205) [-1147.915] (-1146.313) (-1143.492) -- 0:00:22 639500 -- (-1149.549) (-1143.382) (-1147.074) [-1143.298] * (-1144.196) [-1143.108] (-1143.732) (-1145.831) -- 0:00:22 640000 -- (-1146.583) (-1142.289) (-1146.966) [-1144.834] * (-1144.883) [-1144.069] (-1144.249) (-1145.358) -- 0:00:22 Average standard deviation of split frequencies: 0.009427 640500 -- (-1148.304) [-1144.189] (-1143.735) (-1144.791) * (-1142.702) (-1146.031) [-1145.421] (-1145.190) -- 0:00:22 641000 -- (-1145.559) (-1143.577) (-1149.721) [-1143.468] * (-1142.821) (-1147.323) [-1143.464] (-1142.607) -- 0:00:22 641500 -- (-1143.239) (-1149.671) (-1146.748) [-1143.401] * [-1144.982] (-1143.530) (-1143.457) (-1145.655) -- 0:00:22 642000 -- [-1142.916] (-1147.497) (-1144.641) (-1143.371) * (-1144.101) [-1143.535] (-1144.616) (-1145.734) -- 0:00:22 642500 -- (-1145.857) (-1146.353) [-1143.119] (-1147.440) * (-1146.740) (-1145.302) [-1144.360] (-1146.120) -- 0:00:22 643000 -- (-1145.621) [-1145.991] (-1144.671) (-1145.924) * (-1146.396) [-1147.212] (-1148.947) (-1142.906) -- 0:00:22 643500 -- (-1144.810) (-1151.182) (-1142.361) [-1144.932] * (-1146.281) (-1145.680) [-1144.171] (-1142.719) -- 0:00:22 644000 -- (-1147.760) [-1144.389] (-1143.180) (-1146.090) * (-1143.618) (-1144.831) (-1146.866) [-1144.616] -- 0:00:22 644500 -- (-1144.049) [-1144.637] (-1143.486) (-1150.676) * (-1143.898) (-1143.454) (-1144.368) [-1145.447] -- 0:00:22 645000 -- (-1146.059) [-1151.125] (-1143.253) (-1144.672) * (-1144.625) [-1143.454] (-1147.900) (-1144.968) -- 0:00:22 Average standard deviation of split frequencies: 0.008802 645500 -- (-1146.015) (-1145.139) (-1146.136) [-1143.629] * (-1146.323) (-1146.439) (-1147.887) [-1146.594] -- 0:00:21 646000 -- (-1144.503) (-1143.753) (-1144.087) [-1145.690] * (-1143.322) [-1148.009] (-1143.007) (-1143.667) -- 0:00:21 646500 -- (-1145.265) (-1143.825) (-1146.629) [-1143.286] * (-1142.771) [-1143.552] (-1145.772) (-1143.951) -- 0:00:21 647000 -- [-1144.272] (-1146.792) (-1146.989) (-1142.638) * (-1143.453) (-1142.611) [-1143.788] (-1144.914) -- 0:00:21 647500 -- (-1145.518) (-1144.736) (-1144.814) [-1146.380] * (-1143.126) (-1143.930) [-1144.692] (-1143.331) -- 0:00:21 648000 -- (-1143.591) [-1142.437] (-1143.138) (-1147.176) * (-1143.630) [-1144.065] (-1143.776) (-1143.892) -- 0:00:21 648500 -- [-1148.669] (-1142.922) (-1142.346) (-1144.058) * (-1145.316) (-1145.669) [-1143.798] (-1144.276) -- 0:00:21 649000 -- (-1149.066) (-1144.121) (-1143.199) [-1145.347] * [-1144.916] (-1149.762) (-1147.912) (-1148.047) -- 0:00:21 649500 -- [-1146.237] (-1143.736) (-1144.375) (-1145.062) * (-1144.903) (-1147.949) [-1145.972] (-1146.222) -- 0:00:21 650000 -- (-1148.334) (-1144.320) (-1144.427) [-1144.120] * (-1146.466) (-1146.210) [-1145.749] (-1147.332) -- 0:00:21 Average standard deviation of split frequencies: 0.008468 650500 -- (-1147.659) (-1144.736) [-1145.707] (-1143.331) * (-1143.148) [-1143.587] (-1145.831) (-1142.423) -- 0:00:21 651000 -- [-1146.154] (-1148.613) (-1150.557) (-1149.830) * (-1145.087) (-1143.349) [-1145.591] (-1145.537) -- 0:00:21 651500 -- (-1145.156) (-1149.724) [-1145.568] (-1144.835) * (-1144.232) [-1143.206] (-1150.981) (-1144.962) -- 0:00:21 652000 -- (-1143.560) (-1144.820) (-1148.230) [-1144.306] * (-1146.939) (-1144.158) (-1144.846) [-1144.324] -- 0:00:21 652500 -- [-1142.874] (-1146.412) (-1149.781) (-1144.571) * [-1147.847] (-1148.203) (-1150.098) (-1143.906) -- 0:00:21 653000 -- (-1143.137) (-1147.961) (-1145.250) [-1144.977] * [-1145.668] (-1144.531) (-1143.476) (-1145.185) -- 0:00:21 653500 -- (-1143.063) (-1143.309) [-1144.021] (-1144.387) * (-1145.953) (-1142.963) (-1142.856) [-1144.927] -- 0:00:21 654000 -- [-1144.286] (-1144.312) (-1146.395) (-1144.438) * (-1145.434) [-1143.637] (-1142.875) (-1145.011) -- 0:00:21 654500 -- (-1144.159) (-1143.803) [-1144.004] (-1144.670) * [-1145.461] (-1143.459) (-1146.343) (-1144.205) -- 0:00:21 655000 -- [-1144.716] (-1143.023) (-1146.481) (-1143.519) * [-1146.154] (-1144.771) (-1145.203) (-1143.924) -- 0:00:21 Average standard deviation of split frequencies: 0.007860 655500 -- (-1142.945) (-1144.656) (-1143.068) [-1144.020] * (-1144.101) (-1144.216) [-1143.060] (-1143.844) -- 0:00:21 656000 -- (-1146.302) [-1145.159] (-1143.098) (-1143.924) * (-1144.092) [-1144.346] (-1144.613) (-1146.873) -- 0:00:21 656500 -- (-1145.795) (-1145.628) (-1144.558) [-1143.211] * [-1145.653] (-1145.114) (-1143.227) (-1146.181) -- 0:00:21 657000 -- (-1145.866) (-1144.553) [-1144.672] (-1143.166) * (-1149.369) (-1147.223) [-1144.454] (-1146.182) -- 0:00:21 657500 -- [-1144.610] (-1145.257) (-1145.210) (-1145.525) * (-1145.242) (-1145.259) [-1143.250] (-1147.003) -- 0:00:21 658000 -- [-1142.987] (-1143.602) (-1144.343) (-1144.525) * (-1145.252) (-1144.886) (-1143.286) [-1144.803] -- 0:00:21 658500 -- (-1143.379) [-1144.603] (-1144.067) (-1149.586) * [-1144.737] (-1147.156) (-1146.595) (-1144.550) -- 0:00:21 659000 -- (-1144.039) [-1146.684] (-1143.814) (-1146.010) * [-1144.808] (-1148.870) (-1144.178) (-1146.032) -- 0:00:21 659500 -- (-1145.932) (-1145.659) [-1145.009] (-1144.021) * (-1144.203) (-1146.336) (-1145.736) [-1146.043] -- 0:00:21 660000 -- [-1142.925] (-1143.235) (-1144.716) (-1148.565) * (-1145.457) (-1148.862) (-1145.168) [-1145.252] -- 0:00:21 Average standard deviation of split frequencies: 0.007849 660500 -- [-1145.121] (-1146.437) (-1145.135) (-1147.520) * (-1142.773) (-1147.406) [-1143.958] (-1143.735) -- 0:00:21 661000 -- (-1144.795) (-1146.474) (-1145.041) [-1144.435] * (-1142.488) (-1144.612) (-1144.853) [-1145.566] -- 0:00:21 661500 -- [-1144.587] (-1144.012) (-1146.336) (-1148.761) * (-1142.679) (-1144.645) [-1144.580] (-1143.511) -- 0:00:20 662000 -- (-1143.118) (-1145.967) (-1145.297) [-1143.316] * [-1144.309] (-1145.287) (-1144.378) (-1143.892) -- 0:00:20 662500 -- (-1144.607) [-1144.592] (-1145.652) (-1143.077) * (-1147.420) (-1143.909) [-1142.638] (-1147.502) -- 0:00:20 663000 -- (-1144.543) [-1144.701] (-1144.839) (-1150.239) * (-1145.013) [-1144.537] (-1142.648) (-1144.979) -- 0:00:20 663500 -- (-1143.136) [-1144.686] (-1146.889) (-1147.042) * (-1143.416) (-1148.390) (-1143.525) [-1146.364] -- 0:00:20 664000 -- (-1144.771) (-1145.399) (-1147.688) [-1144.231] * (-1146.294) (-1149.172) [-1145.029] (-1145.366) -- 0:00:20 664500 -- [-1144.562] (-1144.270) (-1142.810) (-1147.851) * (-1143.423) [-1144.379] (-1144.697) (-1143.642) -- 0:00:20 665000 -- [-1143.995] (-1144.417) (-1143.153) (-1148.824) * [-1144.799] (-1148.235) (-1144.700) (-1145.047) -- 0:00:20 Average standard deviation of split frequencies: 0.007521 665500 -- (-1142.871) (-1146.150) [-1143.525] (-1146.178) * (-1144.573) [-1143.979] (-1146.129) (-1143.864) -- 0:00:20 666000 -- (-1144.976) [-1144.977] (-1144.448) (-1144.844) * [-1146.266] (-1145.007) (-1149.286) (-1143.789) -- 0:00:20 666500 -- (-1149.393) (-1145.962) (-1144.301) [-1145.268] * (-1146.010) (-1144.625) [-1145.311] (-1142.648) -- 0:00:20 667000 -- (-1149.756) (-1143.932) (-1145.969) [-1146.788] * [-1144.500] (-1147.781) (-1145.045) (-1143.170) -- 0:00:20 667500 -- [-1144.922] (-1143.936) (-1143.591) (-1144.238) * (-1143.973) (-1147.582) (-1144.469) [-1144.581] -- 0:00:20 668000 -- [-1144.198] (-1149.347) (-1143.378) (-1144.603) * (-1143.103) (-1144.007) [-1143.682] (-1143.516) -- 0:00:20 668500 -- (-1143.944) (-1153.694) [-1143.284] (-1146.307) * (-1144.020) (-1144.407) (-1144.010) [-1142.330] -- 0:00:20 669000 -- (-1143.801) (-1148.752) [-1144.242] (-1144.391) * (-1144.725) [-1148.584] (-1143.541) (-1144.535) -- 0:00:20 669500 -- [-1146.875] (-1145.690) (-1145.161) (-1145.100) * [-1144.340] (-1148.346) (-1143.154) (-1143.730) -- 0:00:20 670000 -- (-1144.568) (-1143.882) [-1144.040] (-1145.051) * (-1144.237) (-1144.259) (-1143.163) [-1144.248] -- 0:00:20 Average standard deviation of split frequencies: 0.006888 670500 -- [-1144.069] (-1143.462) (-1144.702) (-1143.571) * [-1144.377] (-1143.907) (-1146.154) (-1144.203) -- 0:00:20 671000 -- [-1144.218] (-1144.088) (-1143.724) (-1145.407) * [-1143.839] (-1147.664) (-1143.673) (-1144.310) -- 0:00:20 671500 -- (-1143.615) [-1144.662] (-1144.920) (-1146.324) * (-1143.222) (-1145.146) (-1143.987) [-1144.380] -- 0:00:20 672000 -- (-1143.436) [-1145.034] (-1143.317) (-1142.584) * (-1142.929) (-1145.996) [-1143.955] (-1144.994) -- 0:00:20 672500 -- (-1143.097) [-1146.054] (-1145.265) (-1144.693) * [-1142.329] (-1148.765) (-1143.084) (-1145.158) -- 0:00:20 673000 -- (-1143.577) (-1150.358) [-1145.634] (-1145.538) * (-1147.071) (-1146.595) (-1144.325) [-1143.353] -- 0:00:20 673500 -- [-1145.588] (-1146.788) (-1146.937) (-1142.896) * (-1143.069) (-1143.637) [-1145.327] (-1149.224) -- 0:00:20 674000 -- (-1144.756) [-1143.192] (-1146.665) (-1146.638) * (-1144.466) (-1146.486) (-1146.638) [-1144.480] -- 0:00:20 674500 -- (-1145.038) (-1143.236) [-1143.664] (-1145.732) * [-1143.203] (-1145.789) (-1147.156) (-1144.197) -- 0:00:20 675000 -- (-1144.157) (-1142.902) [-1143.591] (-1146.293) * (-1144.073) (-1148.417) (-1148.370) [-1144.039] -- 0:00:20 Average standard deviation of split frequencies: 0.006509 675500 -- (-1144.889) [-1143.364] (-1143.587) (-1144.089) * (-1144.286) (-1144.282) (-1145.819) [-1142.509] -- 0:00:20 676000 -- (-1147.313) [-1145.378] (-1144.748) (-1144.413) * [-1149.058] (-1149.955) (-1144.033) (-1143.931) -- 0:00:20 676500 -- (-1145.032) (-1143.422) (-1146.722) [-1143.784] * [-1142.629] (-1145.006) (-1144.080) (-1148.752) -- 0:00:20 677000 -- (-1144.685) [-1143.159] (-1144.509) (-1146.044) * (-1143.359) (-1144.014) (-1143.155) [-1145.258] -- 0:00:20 677500 -- (-1143.995) [-1143.342] (-1144.597) (-1145.260) * (-1144.150) [-1147.600] (-1147.108) (-1147.346) -- 0:00:19 678000 -- (-1144.683) [-1143.367] (-1144.495) (-1145.432) * (-1143.407) (-1146.858) [-1144.577] (-1147.076) -- 0:00:19 678500 -- [-1144.136] (-1148.220) (-1142.489) (-1145.350) * (-1144.106) [-1143.099] (-1144.506) (-1146.827) -- 0:00:19 679000 -- [-1142.719] (-1152.225) (-1143.314) (-1146.169) * (-1143.961) [-1148.734] (-1144.467) (-1143.534) -- 0:00:19 679500 -- [-1144.902] (-1144.148) (-1146.151) (-1144.127) * (-1144.201) [-1142.571] (-1147.624) (-1144.958) -- 0:00:19 680000 -- [-1144.691] (-1144.148) (-1148.404) (-1146.479) * [-1144.163] (-1144.918) (-1143.656) (-1145.534) -- 0:00:19 Average standard deviation of split frequencies: 0.006464 680500 -- (-1143.858) [-1145.493] (-1145.058) (-1143.842) * (-1143.587) (-1144.565) [-1142.770] (-1144.122) -- 0:00:19 681000 -- (-1142.986) (-1145.208) (-1144.744) [-1144.371] * (-1142.705) (-1142.705) (-1143.400) [-1143.276] -- 0:00:19 681500 -- [-1143.439] (-1144.310) (-1143.995) (-1145.033) * (-1143.788) (-1145.108) (-1144.447) [-1146.335] -- 0:00:19 682000 -- (-1143.003) (-1144.410) (-1143.601) [-1144.791] * (-1143.283) (-1145.411) (-1144.250) [-1144.541] -- 0:00:19 682500 -- (-1143.060) (-1145.583) (-1142.405) [-1143.992] * (-1143.198) (-1145.748) (-1148.240) [-1143.217] -- 0:00:19 683000 -- (-1149.999) [-1144.912] (-1148.166) (-1143.060) * [-1145.423] (-1145.800) (-1149.699) (-1143.236) -- 0:00:19 683500 -- (-1148.818) (-1143.091) (-1146.326) [-1144.707] * (-1144.957) (-1143.454) [-1143.560] (-1147.436) -- 0:00:19 684000 -- (-1145.040) (-1143.121) [-1145.073] (-1147.748) * (-1143.734) (-1146.106) [-1142.932] (-1146.865) -- 0:00:19 684500 -- (-1143.695) (-1143.264) (-1144.531) [-1145.824] * [-1144.924] (-1145.472) (-1142.679) (-1143.161) -- 0:00:19 685000 -- [-1145.523] (-1143.380) (-1142.766) (-1143.052) * (-1146.062) (-1148.334) [-1145.048] (-1144.947) -- 0:00:19 Average standard deviation of split frequencies: 0.006780 685500 -- (-1145.933) (-1146.092) (-1145.052) [-1147.262] * (-1144.919) [-1145.960] (-1148.699) (-1143.811) -- 0:00:19 686000 -- (-1144.462) [-1145.342] (-1143.891) (-1151.829) * [-1147.931] (-1143.425) (-1146.425) (-1145.352) -- 0:00:19 686500 -- (-1147.584) [-1146.687] (-1143.978) (-1151.226) * (-1146.007) [-1143.589] (-1143.052) (-1145.438) -- 0:00:19 687000 -- (-1145.768) (-1143.890) (-1146.019) [-1144.298] * (-1147.077) (-1144.428) (-1143.678) [-1144.152] -- 0:00:19 687500 -- (-1144.458) (-1143.835) [-1143.595] (-1143.382) * (-1147.028) (-1144.811) [-1143.187] (-1144.938) -- 0:00:19 688000 -- (-1145.479) (-1144.169) [-1143.871] (-1143.773) * (-1144.081) (-1143.957) [-1143.714] (-1144.120) -- 0:00:19 688500 -- (-1143.622) (-1146.323) (-1145.208) [-1144.013] * (-1143.158) [-1142.877] (-1143.363) (-1146.658) -- 0:00:19 689000 -- (-1144.479) (-1144.163) (-1145.063) [-1144.113] * (-1143.058) (-1144.664) (-1143.752) [-1144.337] -- 0:00:19 689500 -- [-1145.903] (-1145.190) (-1144.066) (-1145.177) * [-1142.790] (-1143.622) (-1144.865) (-1143.669) -- 0:00:19 690000 -- (-1144.833) [-1146.769] (-1143.655) (-1146.929) * (-1147.210) (-1146.733) [-1144.856] (-1144.711) -- 0:00:19 Average standard deviation of split frequencies: 0.006871 690500 -- (-1142.737) (-1143.847) (-1143.633) [-1142.849] * (-1146.560) [-1146.998] (-1144.298) (-1146.488) -- 0:00:19 691000 -- [-1144.544] (-1146.652) (-1143.917) (-1143.526) * (-1151.410) (-1142.938) (-1149.281) [-1144.309] -- 0:00:19 691500 -- (-1146.797) (-1144.054) [-1142.900] (-1152.650) * [-1144.028] (-1144.438) (-1146.940) (-1144.031) -- 0:00:19 692000 -- [-1147.850] (-1144.325) (-1143.980) (-1143.318) * [-1144.454] (-1143.253) (-1143.589) (-1144.891) -- 0:00:19 692500 -- (-1143.894) [-1145.983] (-1145.217) (-1145.872) * (-1146.470) (-1145.259) [-1144.096] (-1144.852) -- 0:00:19 693000 -- (-1144.169) [-1147.586] (-1145.578) (-1148.212) * [-1149.571] (-1144.495) (-1146.179) (-1143.977) -- 0:00:19 693500 -- (-1147.345) (-1144.116) [-1147.203] (-1145.275) * [-1143.019] (-1143.785) (-1144.754) (-1148.314) -- 0:00:19 694000 -- [-1149.420] (-1143.783) (-1148.558) (-1143.388) * (-1143.019) (-1144.262) (-1145.044) [-1145.581] -- 0:00:18 694500 -- (-1148.024) (-1144.849) [-1144.960] (-1143.820) * (-1147.977) [-1144.832] (-1145.412) (-1146.737) -- 0:00:18 695000 -- (-1152.336) (-1142.817) (-1147.601) [-1143.662] * (-1146.023) (-1146.527) (-1146.952) [-1143.456] -- 0:00:18 Average standard deviation of split frequencies: 0.006367 695500 -- (-1143.106) (-1142.740) (-1143.955) [-1144.961] * (-1146.980) (-1144.373) (-1146.405) [-1144.294] -- 0:00:18 696000 -- [-1144.267] (-1145.699) (-1145.402) (-1144.588) * (-1146.958) [-1142.670] (-1144.117) (-1143.253) -- 0:00:18 696500 -- (-1144.845) (-1143.630) (-1144.125) [-1145.261] * [-1143.434] (-1143.952) (-1143.566) (-1143.657) -- 0:00:18 697000 -- (-1144.274) [-1142.915] (-1144.288) (-1146.216) * (-1143.812) [-1143.446] (-1144.326) (-1143.795) -- 0:00:18 697500 -- (-1143.465) (-1147.020) [-1143.445] (-1148.556) * (-1144.972) [-1145.755] (-1145.570) (-1147.671) -- 0:00:18 698000 -- (-1145.347) (-1146.664) (-1143.547) [-1142.839] * (-1146.448) (-1143.792) (-1145.597) [-1144.544] -- 0:00:18 698500 -- (-1148.707) (-1144.022) (-1147.916) [-1145.462] * (-1146.616) [-1142.796] (-1145.469) (-1144.378) -- 0:00:18 699000 -- (-1145.475) (-1144.065) [-1147.917] (-1147.041) * (-1146.154) [-1151.206] (-1145.196) (-1143.799) -- 0:00:18 699500 -- [-1145.186] (-1143.068) (-1145.522) (-1145.925) * (-1145.454) (-1146.484) [-1144.352] (-1145.287) -- 0:00:18 700000 -- (-1142.732) (-1151.982) (-1146.158) [-1145.154] * (-1142.959) [-1145.883] (-1147.101) (-1148.698) -- 0:00:18 Average standard deviation of split frequencies: 0.006504 700500 -- (-1142.677) (-1144.443) [-1146.113] (-1144.212) * (-1144.453) [-1143.554] (-1150.795) (-1147.804) -- 0:00:18 701000 -- (-1144.086) (-1144.338) (-1145.490) [-1145.219] * (-1144.142) [-1145.003] (-1147.645) (-1148.253) -- 0:00:18 701500 -- (-1144.051) [-1143.817] (-1143.488) (-1143.876) * (-1144.085) (-1144.774) (-1151.573) [-1146.007] -- 0:00:18 702000 -- [-1146.844] (-1143.286) (-1145.315) (-1146.469) * [-1144.645] (-1144.534) (-1143.822) (-1143.136) -- 0:00:18 702500 -- (-1144.206) (-1147.131) (-1143.836) [-1143.376] * (-1143.438) [-1146.614] (-1144.508) (-1144.113) -- 0:00:18 703000 -- (-1144.613) [-1145.092] (-1147.375) (-1143.227) * (-1144.055) (-1145.151) (-1146.678) [-1144.356] -- 0:00:18 703500 -- (-1143.286) [-1144.165] (-1145.543) (-1145.179) * [-1144.596] (-1144.404) (-1148.978) (-1145.092) -- 0:00:18 704000 -- (-1143.426) (-1143.810) (-1144.509) [-1145.920] * [-1143.293] (-1144.686) (-1148.967) (-1144.122) -- 0:00:18 704500 -- [-1144.091] (-1148.562) (-1145.026) (-1146.491) * (-1144.115) (-1145.244) (-1146.787) [-1145.699] -- 0:00:18 705000 -- (-1143.758) [-1142.933] (-1144.336) (-1148.259) * [-1144.085] (-1146.776) (-1147.164) (-1143.222) -- 0:00:18 Average standard deviation of split frequencies: 0.006321 705500 -- (-1144.439) [-1144.100] (-1144.753) (-1146.870) * (-1143.141) (-1143.450) [-1145.877] (-1143.402) -- 0:00:18 706000 -- [-1144.666] (-1143.148) (-1148.519) (-1143.984) * (-1142.920) (-1143.889) [-1144.575] (-1143.676) -- 0:00:18 706500 -- [-1143.510] (-1145.230) (-1145.497) (-1144.260) * (-1145.379) (-1143.923) (-1143.669) [-1144.168] -- 0:00:18 707000 -- (-1145.087) [-1145.151] (-1143.994) (-1144.928) * (-1146.296) [-1143.786] (-1144.447) (-1144.535) -- 0:00:18 707500 -- [-1144.104] (-1143.934) (-1149.929) (-1145.921) * (-1143.128) [-1143.455] (-1149.336) (-1143.897) -- 0:00:18 708000 -- (-1142.423) (-1143.223) [-1142.734] (-1147.944) * (-1145.337) (-1147.257) (-1146.456) [-1143.871] -- 0:00:18 708500 -- [-1144.821] (-1143.637) (-1145.170) (-1148.248) * (-1144.035) (-1144.748) (-1144.424) [-1142.626] -- 0:00:18 709000 -- (-1143.464) (-1143.858) [-1143.510] (-1143.217) * (-1148.120) (-1147.228) (-1144.018) [-1143.213] -- 0:00:18 709500 -- (-1144.463) (-1143.858) (-1146.949) [-1144.194] * (-1148.969) [-1147.322] (-1144.323) (-1143.093) -- 0:00:18 710000 -- [-1144.576] (-1143.595) (-1149.484) (-1144.649) * (-1144.262) (-1147.062) [-1144.247] (-1143.551) -- 0:00:17 Average standard deviation of split frequencies: 0.006279 710500 -- [-1144.187] (-1143.231) (-1145.642) (-1145.996) * (-1143.381) (-1144.836) (-1144.810) [-1143.703] -- 0:00:17 711000 -- (-1145.407) (-1143.236) [-1143.869] (-1143.636) * (-1147.501) (-1144.059) (-1143.181) [-1144.371] -- 0:00:17 711500 -- [-1144.416] (-1144.616) (-1143.801) (-1146.318) * [-1147.235] (-1144.335) (-1145.944) (-1143.459) -- 0:00:17 712000 -- [-1149.568] (-1145.410) (-1143.273) (-1143.994) * (-1144.229) [-1143.520] (-1149.065) (-1146.387) -- 0:00:17 712500 -- [-1150.487] (-1146.730) (-1148.445) (-1143.846) * (-1144.387) (-1143.354) [-1144.062] (-1143.252) -- 0:00:17 713000 -- (-1143.249) [-1143.090] (-1144.472) (-1142.764) * (-1143.850) (-1142.644) [-1144.328] (-1143.647) -- 0:00:17 713500 -- [-1145.559] (-1142.632) (-1144.099) (-1146.371) * (-1144.969) [-1144.286] (-1144.015) (-1143.711) -- 0:00:17 714000 -- (-1144.064) (-1142.492) (-1149.587) [-1144.680] * [-1147.275] (-1145.147) (-1144.733) (-1147.008) -- 0:00:17 714500 -- (-1144.117) [-1144.475] (-1149.397) (-1148.963) * (-1145.479) [-1143.887] (-1148.027) (-1143.070) -- 0:00:17 715000 -- (-1144.644) [-1145.030] (-1143.476) (-1146.615) * (-1143.948) [-1142.734] (-1143.267) (-1143.969) -- 0:00:17 Average standard deviation of split frequencies: 0.006189 715500 -- [-1143.860] (-1143.035) (-1143.496) (-1149.527) * (-1145.277) [-1142.715] (-1143.757) (-1146.140) -- 0:00:17 716000 -- [-1144.655] (-1143.295) (-1142.939) (-1143.302) * (-1149.591) (-1145.806) (-1142.974) [-1146.860] -- 0:00:17 716500 -- (-1144.224) (-1144.675) (-1147.772) [-1142.607] * (-1149.098) (-1146.717) [-1143.330] (-1142.950) -- 0:00:17 717000 -- (-1150.247) (-1143.950) [-1143.206] (-1146.522) * [-1148.125] (-1143.854) (-1147.674) (-1145.225) -- 0:00:17 717500 -- (-1146.071) (-1147.738) [-1142.898] (-1145.658) * [-1147.029] (-1143.047) (-1144.267) (-1153.104) -- 0:00:17 718000 -- (-1143.588) (-1145.526) [-1143.525] (-1147.253) * (-1145.919) (-1142.977) [-1144.285] (-1154.188) -- 0:00:17 718500 -- (-1142.993) (-1143.495) [-1144.162] (-1144.873) * (-1146.813) (-1145.212) [-1145.398] (-1145.592) -- 0:00:17 719000 -- (-1143.964) (-1144.777) (-1144.763) [-1144.247] * (-1147.385) [-1144.550] (-1143.616) (-1143.389) -- 0:00:17 719500 -- (-1145.838) (-1144.449) [-1144.210] (-1147.450) * [-1147.992] (-1146.558) (-1143.407) (-1145.509) -- 0:00:17 720000 -- [-1145.295] (-1143.730) (-1143.212) (-1148.987) * [-1145.139] (-1143.735) (-1146.380) (-1143.071) -- 0:00:17 Average standard deviation of split frequencies: 0.005887 720500 -- (-1145.143) (-1146.763) (-1145.872) [-1147.669] * (-1145.940) [-1144.625] (-1145.568) (-1143.506) -- 0:00:17 721000 -- (-1151.572) [-1146.378] (-1142.806) (-1144.420) * (-1149.920) (-1145.383) [-1142.412] (-1144.671) -- 0:00:17 721500 -- [-1145.835] (-1144.904) (-1143.688) (-1147.126) * (-1148.515) (-1144.471) [-1143.770] (-1146.468) -- 0:00:17 722000 -- (-1143.195) (-1147.962) (-1148.837) [-1144.515] * [-1144.539] (-1144.887) (-1143.163) (-1147.149) -- 0:00:17 722500 -- [-1143.802] (-1146.009) (-1145.731) (-1144.882) * (-1150.912) (-1143.990) (-1142.771) [-1143.020] -- 0:00:17 723000 -- [-1144.106] (-1143.170) (-1146.104) (-1143.984) * (-1144.141) (-1143.521) (-1143.188) [-1143.952] -- 0:00:17 723500 -- (-1146.625) [-1143.162] (-1145.554) (-1145.487) * [-1146.109] (-1144.327) (-1144.809) (-1148.421) -- 0:00:17 724000 -- [-1146.624] (-1144.275) (-1144.150) (-1146.425) * (-1143.572) [-1147.447] (-1146.372) (-1149.596) -- 0:00:17 724500 -- (-1143.933) (-1143.559) (-1143.936) [-1142.189] * [-1143.735] (-1146.033) (-1149.719) (-1143.565) -- 0:00:17 725000 -- [-1142.914] (-1143.461) (-1146.489) (-1143.091) * [-1145.457] (-1147.191) (-1143.170) (-1146.095) -- 0:00:17 Average standard deviation of split frequencies: 0.005930 725500 -- (-1145.321) (-1147.152) (-1143.364) [-1143.156] * (-1143.665) [-1144.258] (-1143.405) (-1143.795) -- 0:00:17 726000 -- (-1146.617) (-1145.225) [-1144.904] (-1144.132) * [-1143.395] (-1143.761) (-1145.276) (-1146.500) -- 0:00:16 726500 -- [-1145.553] (-1144.096) (-1145.418) (-1143.910) * [-1143.636] (-1143.700) (-1144.107) (-1147.358) -- 0:00:16 727000 -- (-1144.853) (-1144.301) (-1145.061) [-1144.197] * [-1143.666] (-1144.592) (-1144.761) (-1143.968) -- 0:00:16 727500 -- (-1144.843) [-1147.304] (-1143.994) (-1147.166) * (-1144.279) (-1149.212) [-1144.925] (-1150.345) -- 0:00:16 728000 -- (-1143.826) (-1145.974) [-1143.678] (-1145.375) * [-1143.626] (-1144.325) (-1143.486) (-1145.013) -- 0:00:16 728500 -- (-1148.087) (-1144.547) [-1143.473] (-1143.726) * (-1146.202) (-1144.389) (-1144.629) [-1147.131] -- 0:00:16 729000 -- (-1148.474) [-1142.500] (-1148.418) (-1143.977) * (-1143.883) (-1144.975) [-1144.240] (-1144.463) -- 0:00:16 729500 -- (-1146.606) [-1143.123] (-1150.171) (-1146.849) * (-1144.084) [-1151.422] (-1147.754) (-1147.542) -- 0:00:16 730000 -- [-1147.673] (-1144.171) (-1145.647) (-1145.371) * (-1145.852) (-1152.094) (-1146.754) [-1147.397] -- 0:00:16 Average standard deviation of split frequencies: 0.006237 730500 -- [-1145.747] (-1145.321) (-1145.737) (-1144.059) * (-1145.406) (-1146.114) [-1144.740] (-1144.279) -- 0:00:16 731000 -- (-1148.432) (-1143.649) [-1145.028] (-1144.409) * [-1143.791] (-1146.781) (-1144.054) (-1143.183) -- 0:00:16 731500 -- [-1145.668] (-1143.393) (-1143.350) (-1147.578) * (-1146.232) (-1143.499) [-1146.195] (-1143.686) -- 0:00:16 732000 -- [-1143.386] (-1146.837) (-1143.031) (-1145.256) * (-1144.213) (-1142.878) [-1143.807] (-1145.803) -- 0:00:16 732500 -- [-1146.077] (-1147.034) (-1143.815) (-1149.255) * (-1144.351) [-1142.894] (-1143.904) (-1142.484) -- 0:00:16 733000 -- (-1148.007) [-1144.416] (-1143.911) (-1154.826) * (-1143.542) [-1143.427] (-1145.180) (-1142.725) -- 0:00:16 733500 -- (-1145.879) (-1146.669) (-1146.265) [-1147.013] * (-1142.820) (-1143.720) (-1142.878) [-1143.333] -- 0:00:16 734000 -- (-1146.891) (-1146.565) [-1145.121] (-1145.383) * (-1143.441) (-1143.578) (-1144.601) [-1144.873] -- 0:00:16 734500 -- [-1145.582] (-1147.961) (-1142.997) (-1147.419) * [-1143.674] (-1144.783) (-1144.603) (-1143.897) -- 0:00:16 735000 -- (-1148.085) (-1144.378) (-1142.971) [-1144.878] * (-1143.634) (-1147.334) (-1146.320) [-1144.797] -- 0:00:16 Average standard deviation of split frequencies: 0.005978 735500 -- (-1146.332) [-1144.187] (-1142.995) (-1145.013) * (-1143.174) [-1145.802] (-1145.343) (-1143.755) -- 0:00:16 736000 -- (-1144.582) [-1144.286] (-1144.590) (-1146.610) * (-1145.427) [-1150.386] (-1144.144) (-1143.670) -- 0:00:16 736500 -- (-1144.511) (-1143.809) (-1144.274) [-1142.721] * (-1148.788) [-1144.852] (-1145.057) (-1143.988) -- 0:00:16 737000 -- [-1144.098] (-1143.850) (-1145.590) (-1142.780) * (-1147.161) (-1146.320) [-1144.868] (-1144.492) -- 0:00:16 737500 -- [-1143.969] (-1144.451) (-1144.157) (-1144.198) * [-1143.030] (-1143.620) (-1146.207) (-1143.159) -- 0:00:16 738000 -- (-1147.069) (-1143.633) (-1143.461) [-1145.176] * (-1145.045) (-1145.768) [-1147.126] (-1143.290) -- 0:00:16 738500 -- (-1144.860) [-1143.886] (-1144.193) (-1144.694) * (-1143.531) (-1144.751) (-1145.431) [-1142.805] -- 0:00:16 739000 -- [-1147.419] (-1145.229) (-1146.798) (-1147.252) * (-1142.677) (-1147.550) [-1145.749] (-1143.854) -- 0:00:16 739500 -- (-1143.023) (-1144.598) [-1145.600] (-1146.462) * (-1146.066) [-1146.048] (-1146.149) (-1146.061) -- 0:00:16 740000 -- (-1143.058) [-1146.126] (-1144.118) (-1146.696) * (-1143.489) (-1143.373) (-1145.566) [-1146.786] -- 0:00:16 Average standard deviation of split frequencies: 0.006280 740500 -- (-1145.231) (-1148.863) (-1145.616) [-1146.263] * (-1144.806) (-1145.653) [-1145.232] (-1144.249) -- 0:00:16 741000 -- (-1146.705) [-1143.117] (-1143.497) (-1147.330) * [-1142.882] (-1144.089) (-1142.450) (-1146.339) -- 0:00:16 741500 -- (-1147.882) [-1143.408] (-1142.879) (-1146.932) * (-1144.771) (-1143.081) [-1147.375] (-1143.932) -- 0:00:16 742000 -- (-1147.376) [-1144.950] (-1143.511) (-1145.469) * (-1142.270) (-1143.879) [-1146.055] (-1145.371) -- 0:00:15 742500 -- (-1144.899) (-1144.350) (-1145.537) [-1143.605] * (-1142.991) (-1148.953) [-1146.910] (-1144.770) -- 0:00:15 743000 -- (-1146.432) (-1146.321) (-1142.941) [-1148.030] * (-1145.196) (-1143.304) (-1150.118) [-1146.250] -- 0:00:15 743500 -- (-1143.598) (-1150.398) (-1143.419) [-1143.529] * (-1148.276) (-1144.101) [-1144.071] (-1143.120) -- 0:00:15 744000 -- [-1146.714] (-1143.715) (-1144.479) (-1144.453) * (-1145.008) (-1143.728) [-1147.393] (-1142.368) -- 0:00:15 744500 -- [-1145.228] (-1147.201) (-1148.797) (-1145.004) * (-1145.997) [-1143.428] (-1144.590) (-1142.663) -- 0:00:15 745000 -- (-1144.952) [-1149.355] (-1146.077) (-1143.723) * (-1145.582) (-1143.454) (-1143.864) [-1145.413] -- 0:00:15 Average standard deviation of split frequencies: 0.006235 745500 -- (-1146.053) (-1145.437) (-1151.059) [-1144.864] * (-1144.763) [-1144.128] (-1143.864) (-1145.724) -- 0:00:15 746000 -- [-1142.429] (-1146.196) (-1149.551) (-1143.293) * (-1152.544) (-1143.296) (-1143.535) [-1143.514] -- 0:00:15 746500 -- (-1145.699) (-1147.088) (-1143.617) [-1142.858] * (-1146.119) (-1144.468) [-1145.872] (-1145.083) -- 0:00:15 747000 -- [-1146.111] (-1145.180) (-1147.860) (-1144.856) * (-1142.619) (-1144.652) [-1144.137] (-1143.061) -- 0:00:15 747500 -- (-1146.157) (-1143.752) (-1145.671) [-1143.789] * (-1147.827) (-1144.661) [-1143.624] (-1144.890) -- 0:00:15 748000 -- (-1143.665) (-1147.024) [-1145.150] (-1145.591) * (-1145.168) (-1153.760) [-1143.180] (-1147.492) -- 0:00:15 748500 -- [-1143.849] (-1150.778) (-1145.073) (-1143.083) * [-1145.042] (-1146.690) (-1145.095) (-1144.283) -- 0:00:15 749000 -- (-1143.969) (-1149.260) (-1142.776) [-1143.404] * (-1147.430) (-1145.054) (-1145.396) [-1142.587] -- 0:00:15 749500 -- [-1147.469] (-1148.449) (-1143.687) (-1143.897) * (-1143.165) (-1146.081) (-1146.710) [-1144.141] -- 0:00:15 750000 -- (-1146.024) (-1145.478) [-1143.244] (-1147.235) * (-1142.860) (-1143.994) (-1143.272) [-1143.885] -- 0:00:15 Average standard deviation of split frequencies: 0.006196 750500 -- (-1144.565) [-1144.203] (-1144.531) (-1146.175) * (-1144.385) (-1148.905) (-1143.428) [-1143.703] -- 0:00:15 751000 -- (-1142.543) (-1143.065) [-1143.907] (-1143.280) * (-1144.743) (-1144.741) (-1143.671) [-1143.423] -- 0:00:15 751500 -- (-1142.575) (-1146.767) [-1143.875] (-1146.145) * (-1144.630) (-1147.213) [-1144.182] (-1143.777) -- 0:00:15 752000 -- [-1142.545] (-1144.797) (-1143.483) (-1142.692) * (-1143.239) (-1145.955) [-1149.613] (-1143.168) -- 0:00:15 752500 -- (-1143.385) (-1149.974) (-1145.233) [-1143.970] * (-1143.429) [-1149.263] (-1147.194) (-1145.428) -- 0:00:15 753000 -- (-1145.764) [-1145.126] (-1142.338) (-1144.194) * [-1142.668] (-1145.949) (-1145.825) (-1144.476) -- 0:00:15 753500 -- (-1144.505) [-1143.977] (-1145.489) (-1144.213) * (-1143.384) (-1146.383) (-1148.780) [-1146.022] -- 0:00:15 754000 -- (-1143.892) [-1143.547] (-1147.783) (-1146.851) * (-1145.478) [-1145.582] (-1146.228) (-1147.083) -- 0:00:15 754500 -- (-1147.525) (-1148.894) [-1145.266] (-1144.177) * [-1145.478] (-1146.146) (-1144.088) (-1146.205) -- 0:00:15 755000 -- [-1146.341] (-1147.041) (-1143.935) (-1143.422) * (-1148.834) (-1144.986) (-1142.664) [-1143.754] -- 0:00:15 Average standard deviation of split frequencies: 0.006360 755500 -- (-1145.792) (-1145.079) (-1144.943) [-1143.620] * [-1146.805] (-1144.999) (-1144.595) (-1145.279) -- 0:00:15 756000 -- (-1147.479) (-1145.302) [-1143.622] (-1147.316) * (-1144.153) (-1144.061) [-1144.312] (-1144.588) -- 0:00:15 756500 -- (-1145.563) (-1145.629) [-1144.356] (-1144.796) * (-1147.093) [-1143.780] (-1143.880) (-1143.483) -- 0:00:15 757000 -- (-1147.486) [-1144.008] (-1143.620) (-1143.200) * (-1143.785) [-1144.837] (-1147.624) (-1143.813) -- 0:00:15 757500 -- (-1144.958) [-1144.713] (-1143.619) (-1144.223) * (-1146.772) [-1143.746] (-1145.256) (-1143.689) -- 0:00:15 758000 -- [-1147.373] (-1144.100) (-1147.020) (-1144.127) * (-1142.992) (-1145.421) [-1144.823] (-1144.692) -- 0:00:15 758500 -- [-1142.730] (-1147.349) (-1143.940) (-1142.506) * (-1142.991) [-1144.763] (-1143.313) (-1144.892) -- 0:00:14 759000 -- (-1142.481) (-1147.139) (-1144.044) [-1142.907] * [-1147.443] (-1142.626) (-1142.893) (-1147.193) -- 0:00:14 759500 -- (-1142.456) (-1147.729) (-1147.796) [-1145.818] * (-1143.196) (-1144.033) [-1144.285] (-1144.084) -- 0:00:14 760000 -- [-1145.982] (-1149.857) (-1146.606) (-1143.690) * (-1145.919) (-1143.988) [-1143.134] (-1144.974) -- 0:00:14 Average standard deviation of split frequencies: 0.006197 760500 -- (-1146.431) (-1144.697) [-1146.091] (-1144.012) * (-1144.003) (-1143.650) (-1144.087) [-1146.297] -- 0:00:14 761000 -- (-1149.513) [-1143.066] (-1146.694) (-1144.143) * (-1144.448) (-1144.639) (-1143.565) [-1146.496] -- 0:00:14 761500 -- [-1143.528] (-1145.224) (-1146.225) (-1144.808) * [-1142.810] (-1146.099) (-1142.692) (-1147.612) -- 0:00:14 762000 -- [-1143.557] (-1145.122) (-1147.445) (-1144.937) * [-1144.653] (-1145.425) (-1145.236) (-1142.467) -- 0:00:14 762500 -- (-1144.375) [-1146.276] (-1144.211) (-1142.974) * (-1145.327) [-1143.898] (-1150.364) (-1142.322) -- 0:00:14 763000 -- (-1146.575) [-1143.737] (-1145.553) (-1143.312) * (-1143.774) (-1145.223) [-1144.132] (-1145.479) -- 0:00:14 763500 -- (-1146.990) [-1147.646] (-1146.536) (-1143.440) * (-1144.947) [-1144.092] (-1146.933) (-1145.083) -- 0:00:14 764000 -- (-1144.188) [-1143.430] (-1149.171) (-1148.506) * (-1143.715) [-1142.864] (-1143.084) (-1146.753) -- 0:00:14 764500 -- [-1145.442] (-1145.712) (-1143.120) (-1144.731) * (-1143.039) (-1144.857) (-1142.460) [-1146.641] -- 0:00:14 765000 -- (-1146.769) [-1144.009] (-1143.835) (-1150.721) * (-1143.002) (-1144.673) [-1143.572] (-1143.893) -- 0:00:14 Average standard deviation of split frequencies: 0.005826 765500 -- (-1145.901) [-1145.370] (-1143.295) (-1148.698) * (-1143.384) [-1143.558] (-1143.801) (-1145.923) -- 0:00:14 766000 -- (-1146.649) (-1143.388) [-1148.147] (-1149.363) * (-1143.249) (-1145.865) [-1143.849] (-1144.385) -- 0:00:14 766500 -- (-1144.622) [-1143.618] (-1144.609) (-1145.686) * (-1143.729) [-1143.466] (-1145.595) (-1146.444) -- 0:00:14 767000 -- (-1145.750) (-1144.195) [-1145.153] (-1143.200) * (-1146.750) (-1144.108) [-1147.822] (-1146.539) -- 0:00:14 767500 -- (-1144.164) [-1143.827] (-1143.480) (-1148.919) * (-1147.944) (-1147.243) [-1145.256] (-1143.241) -- 0:00:14 768000 -- (-1144.070) (-1145.458) [-1143.659] (-1145.558) * [-1146.150] (-1144.164) (-1144.947) (-1146.364) -- 0:00:14 768500 -- [-1146.445] (-1143.832) (-1145.621) (-1145.243) * (-1143.593) (-1143.284) [-1146.009] (-1145.770) -- 0:00:14 769000 -- (-1144.868) (-1146.843) (-1144.429) [-1143.868] * [-1143.977] (-1143.184) (-1143.249) (-1144.332) -- 0:00:14 769500 -- [-1143.859] (-1146.552) (-1144.684) (-1147.294) * (-1145.807) [-1143.268] (-1144.351) (-1144.318) -- 0:00:14 770000 -- (-1146.328) (-1144.724) [-1144.436] (-1144.309) * (-1144.177) (-1145.073) (-1142.559) [-1144.687] -- 0:00:14 Average standard deviation of split frequencies: 0.006198 770500 -- [-1143.760] (-1145.138) (-1142.799) (-1143.541) * (-1143.508) (-1143.854) [-1149.060] (-1146.162) -- 0:00:14 771000 -- (-1146.193) (-1143.631) (-1144.752) [-1144.328] * (-1145.523) (-1142.712) [-1145.734] (-1144.217) -- 0:00:14 771500 -- (-1145.746) [-1146.289] (-1143.993) (-1149.068) * (-1144.647) (-1143.043) [-1142.719] (-1144.552) -- 0:00:14 772000 -- (-1146.723) [-1148.410] (-1144.340) (-1144.818) * (-1146.049) [-1144.452] (-1146.033) (-1145.930) -- 0:00:14 772500 -- [-1145.535] (-1146.419) (-1143.174) (-1144.612) * (-1146.059) (-1142.718) [-1144.593] (-1144.803) -- 0:00:14 773000 -- [-1143.210] (-1147.799) (-1142.503) (-1145.913) * (-1147.327) (-1144.362) [-1147.509] (-1144.794) -- 0:00:14 773500 -- (-1143.814) [-1143.513] (-1148.004) (-1144.275) * (-1144.173) (-1143.512) (-1145.350) [-1142.872] -- 0:00:14 774000 -- (-1144.988) [-1145.500] (-1147.546) (-1145.764) * (-1146.222) (-1145.677) (-1146.915) [-1143.387] -- 0:00:14 774500 -- (-1145.083) [-1143.100] (-1143.244) (-1143.715) * [-1143.930] (-1144.149) (-1145.322) (-1145.733) -- 0:00:13 775000 -- (-1145.525) (-1143.023) [-1142.422] (-1143.384) * (-1144.436) (-1144.707) (-1143.997) [-1145.575] -- 0:00:13 Average standard deviation of split frequencies: 0.006034 775500 -- (-1146.887) (-1143.084) [-1144.849] (-1144.227) * (-1144.215) [-1143.205] (-1143.193) (-1143.780) -- 0:00:13 776000 -- (-1146.360) [-1147.429] (-1147.398) (-1144.089) * (-1144.035) (-1144.110) [-1142.937] (-1148.192) -- 0:00:13 776500 -- (-1143.748) [-1143.187] (-1144.048) (-1143.885) * (-1144.945) (-1144.376) [-1142.885] (-1147.569) -- 0:00:13 777000 -- (-1146.243) (-1146.993) (-1142.893) [-1143.406] * (-1145.818) (-1144.228) [-1143.709] (-1147.127) -- 0:00:13 777500 -- (-1146.392) (-1147.255) (-1142.837) [-1143.285] * [-1143.861] (-1145.197) (-1144.233) (-1147.013) -- 0:00:13 778000 -- (-1143.592) (-1143.556) (-1144.479) [-1142.329] * [-1144.146] (-1144.940) (-1143.001) (-1145.341) -- 0:00:13 778500 -- (-1144.266) (-1143.304) (-1144.379) [-1147.157] * (-1144.443) [-1144.429] (-1143.466) (-1145.284) -- 0:00:13 779000 -- (-1145.398) (-1146.103) [-1143.206] (-1143.486) * (-1144.941) (-1143.669) (-1144.374) [-1145.786] -- 0:00:13 779500 -- (-1143.576) [-1146.759] (-1143.382) (-1145.059) * [-1144.948] (-1144.648) (-1146.432) (-1145.123) -- 0:00:13 780000 -- [-1143.639] (-1150.413) (-1143.151) (-1143.864) * [-1147.476] (-1144.601) (-1144.911) (-1146.147) -- 0:00:13 Average standard deviation of split frequencies: 0.006119 780500 -- (-1145.713) (-1151.030) (-1146.449) [-1142.990] * (-1145.367) (-1143.265) (-1145.878) [-1144.421] -- 0:00:13 781000 -- [-1144.369] (-1150.098) (-1144.511) (-1144.899) * [-1143.901] (-1146.772) (-1146.728) (-1145.493) -- 0:00:13 781500 -- (-1145.672) (-1144.291) [-1147.226] (-1142.844) * (-1148.880) (-1145.254) [-1145.890] (-1145.009) -- 0:00:13 782000 -- (-1144.276) (-1145.245) [-1145.487] (-1143.734) * (-1144.604) (-1146.819) [-1145.395] (-1145.862) -- 0:00:13 782500 -- (-1143.674) (-1145.461) (-1145.194) [-1143.894] * (-1147.901) (-1144.347) (-1144.196) [-1143.959] -- 0:00:13 783000 -- (-1143.994) [-1144.411] (-1146.608) (-1144.079) * [-1144.120] (-1146.954) (-1145.562) (-1144.505) -- 0:00:13 783500 -- (-1146.062) (-1143.463) (-1147.072) [-1147.161] * (-1146.236) [-1143.611] (-1144.029) (-1146.478) -- 0:00:13 784000 -- (-1142.870) (-1144.497) [-1144.160] (-1146.049) * [-1145.237] (-1144.776) (-1145.236) (-1146.193) -- 0:00:13 784500 -- (-1144.298) [-1143.494] (-1144.030) (-1144.330) * (-1146.687) [-1148.036] (-1145.683) (-1145.862) -- 0:00:13 785000 -- (-1148.410) [-1143.489] (-1144.898) (-1144.459) * (-1149.337) (-1148.282) (-1144.289) [-1142.889] -- 0:00:13 Average standard deviation of split frequencies: 0.006437 785500 -- (-1149.283) [-1143.224] (-1142.431) (-1143.811) * (-1144.024) (-1145.766) (-1147.903) [-1142.667] -- 0:00:13 786000 -- (-1148.842) [-1142.645] (-1148.550) (-1144.967) * [-1144.000] (-1144.493) (-1144.373) (-1142.769) -- 0:00:13 786500 -- (-1149.062) (-1143.044) [-1144.352] (-1148.011) * (-1146.021) (-1146.189) (-1143.799) [-1143.774] -- 0:00:13 787000 -- (-1143.669) [-1143.553] (-1143.366) (-1147.115) * [-1145.545] (-1146.272) (-1146.688) (-1145.286) -- 0:00:13 787500 -- (-1146.178) (-1143.480) [-1142.589] (-1146.047) * [-1142.778] (-1145.186) (-1142.642) (-1145.284) -- 0:00:13 788000 -- [-1142.634] (-1144.370) (-1143.563) (-1145.250) * [-1146.164] (-1145.468) (-1150.200) (-1143.176) -- 0:00:13 788500 -- (-1144.546) (-1144.626) [-1143.550] (-1146.813) * (-1143.900) (-1148.505) [-1147.324] (-1142.536) -- 0:00:13 789000 -- (-1143.208) (-1144.195) (-1144.722) [-1144.547] * (-1145.589) (-1144.560) [-1142.880] (-1145.939) -- 0:00:13 789500 -- [-1145.010] (-1143.804) (-1148.048) (-1146.499) * (-1144.657) (-1145.415) [-1142.836] (-1142.855) -- 0:00:13 790000 -- (-1150.994) (-1144.004) (-1147.441) [-1148.182] * (-1144.396) [-1145.489] (-1146.560) (-1143.332) -- 0:00:13 Average standard deviation of split frequencies: 0.006280 790500 -- (-1143.874) (-1144.864) [-1145.570] (-1143.512) * (-1145.429) (-1148.894) (-1146.585) [-1142.980] -- 0:00:12 791000 -- (-1145.095) (-1143.683) [-1143.610] (-1145.489) * (-1148.364) (-1144.410) (-1143.961) [-1142.900] -- 0:00:12 791500 -- (-1146.276) (-1145.380) [-1144.222] (-1144.429) * (-1143.450) [-1146.302] (-1147.567) (-1148.886) -- 0:00:12 792000 -- (-1143.478) (-1145.354) (-1146.009) [-1144.688] * (-1143.269) [-1145.866] (-1143.948) (-1142.975) -- 0:00:12 792500 -- [-1146.855] (-1146.630) (-1143.223) (-1144.895) * (-1148.950) (-1144.658) [-1143.173] (-1144.401) -- 0:00:12 793000 -- (-1146.854) (-1146.695) [-1144.445] (-1146.501) * (-1148.014) (-1144.946) [-1142.368] (-1144.576) -- 0:00:12 793500 -- (-1144.050) (-1146.373) [-1144.481] (-1143.697) * (-1149.160) (-1145.454) (-1144.222) [-1145.061] -- 0:00:12 794000 -- [-1143.273] (-1145.158) (-1144.922) (-1145.966) * (-1150.312) [-1144.520] (-1143.066) (-1145.252) -- 0:00:12 794500 -- [-1143.391] (-1142.534) (-1143.527) (-1144.327) * (-1146.582) [-1143.157] (-1143.967) (-1145.058) -- 0:00:12 795000 -- (-1145.600) [-1143.851] (-1147.399) (-1144.969) * (-1145.421) [-1144.457] (-1147.582) (-1144.443) -- 0:00:12 Average standard deviation of split frequencies: 0.006514 795500 -- (-1144.559) [-1147.665] (-1146.417) (-1145.107) * (-1145.116) [-1144.411] (-1144.565) (-1147.988) -- 0:00:12 796000 -- (-1144.065) (-1146.813) [-1143.807] (-1144.827) * (-1143.797) [-1142.864] (-1145.585) (-1144.431) -- 0:00:12 796500 -- (-1144.162) (-1146.153) [-1144.570] (-1144.472) * [-1144.676] (-1146.666) (-1150.019) (-1150.022) -- 0:00:12 797000 -- (-1146.950) (-1144.772) [-1143.403] (-1144.642) * (-1142.258) [-1147.204] (-1145.466) (-1143.980) -- 0:00:12 797500 -- (-1144.118) (-1144.080) [-1145.336] (-1147.051) * (-1143.262) (-1147.766) (-1143.732) [-1145.803] -- 0:00:12 798000 -- (-1145.013) [-1147.275] (-1148.029) (-1143.678) * [-1145.993] (-1147.229) (-1143.985) (-1147.928) -- 0:00:12 798500 -- [-1143.085] (-1144.229) (-1145.793) (-1143.953) * (-1145.104) (-1142.951) (-1143.015) [-1143.861] -- 0:00:12 799000 -- (-1144.528) (-1143.362) (-1145.557) [-1146.196] * (-1146.362) (-1142.892) (-1144.842) [-1143.525] -- 0:00:12 799500 -- (-1147.396) (-1146.931) [-1150.656] (-1145.336) * [-1146.582] (-1142.771) (-1142.964) (-1143.693) -- 0:00:12 800000 -- (-1145.411) (-1143.738) [-1144.233] (-1145.760) * (-1144.177) [-1145.163] (-1145.739) (-1144.942) -- 0:00:12 Average standard deviation of split frequencies: 0.006398 800500 -- (-1146.322) (-1143.899) [-1147.667] (-1147.309) * (-1145.245) [-1143.525] (-1144.250) (-1143.952) -- 0:00:12 801000 -- (-1143.866) (-1146.128) [-1142.358] (-1148.720) * (-1143.830) [-1143.412] (-1144.326) (-1145.106) -- 0:00:12 801500 -- (-1143.241) [-1147.439] (-1146.629) (-1143.237) * (-1144.009) [-1144.619] (-1146.803) (-1147.350) -- 0:00:12 802000 -- [-1143.882] (-1144.737) (-1145.239) (-1144.538) * (-1146.284) (-1144.187) (-1142.763) [-1147.224] -- 0:00:12 802500 -- [-1146.528] (-1148.694) (-1146.721) (-1143.307) * (-1145.502) (-1148.357) [-1142.681] (-1144.556) -- 0:00:12 803000 -- [-1142.850] (-1142.832) (-1143.944) (-1146.408) * (-1144.000) [-1147.577] (-1142.662) (-1145.789) -- 0:00:12 803500 -- (-1142.628) (-1143.928) (-1145.269) [-1143.652] * (-1143.620) (-1142.792) [-1149.002] (-1147.513) -- 0:00:12 804000 -- (-1143.204) [-1145.888] (-1144.908) (-1145.160) * [-1143.592] (-1147.440) (-1153.287) (-1145.788) -- 0:00:12 804500 -- (-1142.950) [-1144.618] (-1144.212) (-1142.871) * (-1143.760) (-1146.396) (-1153.883) [-1146.261] -- 0:00:12 805000 -- (-1143.040) [-1146.198] (-1143.510) (-1142.872) * (-1142.903) (-1144.605) [-1144.317] (-1143.214) -- 0:00:12 Average standard deviation of split frequencies: 0.006395 805500 -- (-1146.861) [-1143.903] (-1143.773) (-1142.887) * [-1144.200] (-1144.841) (-1144.033) (-1142.843) -- 0:00:12 806000 -- [-1148.331] (-1144.080) (-1143.299) (-1142.892) * (-1147.541) [-1143.336] (-1146.401) (-1143.483) -- 0:00:12 806500 -- (-1143.546) [-1145.780] (-1143.860) (-1143.017) * (-1144.839) [-1147.147] (-1143.230) (-1147.381) -- 0:00:11 807000 -- (-1144.922) (-1144.822) (-1143.288) [-1144.373] * (-1143.637) (-1145.761) [-1144.382] (-1148.347) -- 0:00:11 807500 -- (-1151.031) [-1144.340] (-1143.715) (-1144.466) * (-1143.115) [-1145.221] (-1143.017) (-1148.440) -- 0:00:11 808000 -- (-1145.593) (-1146.598) (-1145.549) [-1146.340] * (-1143.573) (-1143.615) [-1143.521] (-1144.806) -- 0:00:11 808500 -- (-1143.633) [-1143.645] (-1145.968) (-1143.416) * (-1144.875) (-1143.170) (-1144.758) [-1143.369] -- 0:00:11 809000 -- (-1145.112) (-1144.104) [-1146.695] (-1145.929) * (-1145.325) [-1144.346] (-1147.049) (-1147.005) -- 0:00:11 809500 -- [-1143.329] (-1143.014) (-1146.274) (-1145.925) * (-1143.587) (-1143.129) [-1142.887] (-1146.135) -- 0:00:11 810000 -- (-1144.988) (-1142.666) (-1144.044) [-1145.856] * (-1143.865) [-1144.642] (-1144.482) (-1143.407) -- 0:00:11 Average standard deviation of split frequencies: 0.006552 810500 -- (-1145.232) (-1142.791) (-1145.391) [-1144.458] * [-1143.677] (-1144.716) (-1145.054) (-1143.040) -- 0:00:11 811000 -- (-1144.670) (-1142.898) [-1146.453] (-1149.276) * [-1144.542] (-1145.173) (-1143.743) (-1143.523) -- 0:00:11 811500 -- (-1146.774) [-1149.554] (-1146.066) (-1149.352) * (-1144.307) (-1142.847) [-1143.653] (-1146.770) -- 0:00:11 812000 -- (-1148.073) [-1145.659] (-1145.490) (-1145.052) * (-1147.819) [-1143.569] (-1143.294) (-1143.612) -- 0:00:11 812500 -- (-1145.187) [-1144.609] (-1149.967) (-1148.180) * (-1146.094) [-1143.500] (-1146.367) (-1148.009) -- 0:00:11 813000 -- [-1144.777] (-1144.868) (-1147.517) (-1148.026) * (-1143.926) [-1145.132] (-1144.283) (-1143.883) -- 0:00:11 813500 -- (-1147.385) [-1148.988] (-1143.995) (-1147.251) * (-1147.911) (-1145.913) [-1144.285] (-1144.348) -- 0:00:11 814000 -- (-1146.474) (-1148.589) (-1146.629) [-1146.504] * (-1145.692) (-1148.942) [-1143.857] (-1144.613) -- 0:00:11 814500 -- [-1145.206] (-1143.063) (-1150.003) (-1143.805) * (-1147.053) (-1145.085) [-1143.786] (-1144.663) -- 0:00:11 815000 -- (-1147.622) (-1145.153) (-1147.271) [-1143.089] * (-1144.341) (-1145.235) (-1142.678) [-1143.544] -- 0:00:11 Average standard deviation of split frequencies: 0.006547 815500 -- (-1147.004) (-1142.538) (-1145.001) [-1144.877] * (-1143.432) (-1146.679) (-1143.067) [-1142.580] -- 0:00:11 816000 -- (-1145.323) (-1143.660) [-1143.924] (-1145.354) * (-1143.279) (-1148.066) (-1144.734) [-1142.899] -- 0:00:11 816500 -- (-1145.261) (-1143.660) (-1143.200) [-1143.918] * (-1145.095) (-1149.150) (-1148.161) [-1143.721] -- 0:00:11 817000 -- (-1142.541) (-1143.471) (-1144.415) [-1142.575] * [-1148.660] (-1146.936) (-1143.402) (-1143.810) -- 0:00:11 817500 -- [-1146.636] (-1143.529) (-1144.209) (-1144.347) * (-1143.529) (-1148.109) [-1142.276] (-1144.629) -- 0:00:11 818000 -- [-1145.753] (-1146.214) (-1144.669) (-1143.765) * (-1147.099) (-1144.158) (-1150.111) [-1144.559] -- 0:00:11 818500 -- [-1144.209] (-1146.130) (-1143.495) (-1144.502) * [-1144.834] (-1145.594) (-1150.164) (-1144.776) -- 0:00:11 819000 -- (-1146.142) [-1144.420] (-1144.642) (-1147.425) * [-1143.096] (-1147.738) (-1146.265) (-1147.432) -- 0:00:11 819500 -- (-1146.112) (-1142.726) [-1145.413] (-1147.109) * (-1143.570) (-1145.475) (-1144.716) [-1143.986] -- 0:00:11 820000 -- (-1144.619) (-1146.057) (-1144.335) [-1144.864] * (-1144.009) (-1144.957) (-1149.275) [-1143.400] -- 0:00:11 Average standard deviation of split frequencies: 0.006395 820500 -- [-1142.640] (-1145.484) (-1144.093) (-1146.002) * (-1146.445) [-1143.701] (-1145.175) (-1144.776) -- 0:00:11 821000 -- (-1143.825) [-1143.642] (-1142.751) (-1148.308) * (-1144.172) (-1144.324) [-1147.221] (-1144.931) -- 0:00:11 821500 -- (-1146.214) (-1142.842) [-1145.170] (-1145.641) * (-1145.280) (-1142.997) (-1144.422) [-1145.781] -- 0:00:11 822000 -- (-1144.295) [-1142.728] (-1143.800) (-1145.085) * (-1143.494) (-1145.108) [-1144.111] (-1153.066) -- 0:00:11 822500 -- [-1144.894] (-1143.878) (-1145.945) (-1144.325) * [-1143.675] (-1143.911) (-1144.067) (-1144.404) -- 0:00:11 823000 -- (-1143.900) (-1144.610) [-1143.114] (-1145.823) * (-1142.882) [-1144.629] (-1145.487) (-1145.501) -- 0:00:10 823500 -- [-1146.736] (-1149.137) (-1143.142) (-1146.033) * [-1144.648] (-1144.086) (-1143.696) (-1143.692) -- 0:00:10 824000 -- (-1144.939) [-1143.049] (-1143.447) (-1144.255) * [-1144.573] (-1145.532) (-1143.076) (-1147.223) -- 0:00:10 824500 -- (-1143.755) (-1142.821) [-1144.039] (-1144.579) * (-1143.981) [-1145.538] (-1144.034) (-1142.666) -- 0:00:10 825000 -- (-1146.009) [-1143.901] (-1144.067) (-1143.743) * [-1143.910] (-1144.564) (-1143.297) (-1143.846) -- 0:00:10 Average standard deviation of split frequencies: 0.006126 825500 -- (-1145.476) [-1143.374] (-1144.643) (-1143.113) * [-1144.295] (-1143.199) (-1144.123) (-1147.033) -- 0:00:10 826000 -- (-1143.682) (-1146.077) [-1144.573] (-1144.216) * (-1144.319) (-1145.108) [-1145.570] (-1148.603) -- 0:00:10 826500 -- [-1144.419] (-1145.825) (-1144.498) (-1150.902) * [-1145.072] (-1145.139) (-1144.764) (-1147.864) -- 0:00:10 827000 -- (-1143.599) (-1143.957) (-1144.499) [-1145.887] * (-1145.433) [-1146.646] (-1145.287) (-1144.906) -- 0:00:10 827500 -- (-1146.263) (-1142.877) [-1145.133] (-1144.337) * (-1146.715) (-1147.997) [-1144.018] (-1144.500) -- 0:00:10 828000 -- (-1142.470) (-1143.325) [-1147.598] (-1145.693) * (-1145.867) [-1143.565] (-1145.538) (-1148.795) -- 0:00:10 828500 -- (-1144.467) (-1143.793) (-1144.356) [-1147.134] * (-1147.126) (-1143.316) [-1142.911] (-1144.088) -- 0:00:10 829000 -- [-1145.447] (-1142.683) (-1145.815) (-1147.555) * (-1143.084) [-1144.168] (-1142.756) (-1144.407) -- 0:00:10 829500 -- (-1143.963) [-1145.061] (-1143.481) (-1144.893) * (-1144.193) (-1143.976) [-1143.968] (-1145.420) -- 0:00:10 830000 -- (-1143.325) (-1145.922) [-1146.080] (-1143.014) * [-1146.832] (-1143.225) (-1145.062) (-1143.282) -- 0:00:10 Average standard deviation of split frequencies: 0.006053 830500 -- [-1143.910] (-1149.735) (-1142.954) (-1142.884) * [-1143.503] (-1144.342) (-1143.891) (-1144.383) -- 0:00:10 831000 -- [-1144.820] (-1144.280) (-1145.117) (-1148.400) * (-1144.858) (-1143.585) [-1142.624] (-1144.217) -- 0:00:10 831500 -- [-1143.796] (-1146.105) (-1143.620) (-1146.858) * [-1143.049] (-1143.480) (-1145.803) (-1145.201) -- 0:00:10 832000 -- (-1145.021) (-1143.896) (-1143.528) [-1143.832] * (-1143.947) (-1147.047) [-1142.787] (-1145.052) -- 0:00:10 832500 -- (-1148.233) (-1143.132) (-1142.622) [-1146.430] * [-1144.754] (-1145.725) (-1145.210) (-1143.587) -- 0:00:10 833000 -- (-1145.484) [-1144.073] (-1144.848) (-1143.118) * (-1144.394) [-1146.378] (-1146.270) (-1144.598) -- 0:00:10 833500 -- (-1145.047) (-1144.965) (-1143.966) [-1147.288] * (-1147.470) [-1143.673] (-1144.022) (-1145.371) -- 0:00:10 834000 -- (-1143.969) (-1147.249) [-1143.702] (-1150.924) * (-1148.833) (-1146.887) (-1144.613) [-1146.237] -- 0:00:10 834500 -- [-1147.502] (-1142.848) (-1143.838) (-1144.379) * (-1147.565) [-1147.847] (-1145.069) (-1150.788) -- 0:00:10 835000 -- [-1143.168] (-1146.529) (-1147.033) (-1143.483) * (-1147.471) (-1147.010) (-1143.349) [-1144.519] -- 0:00:10 Average standard deviation of split frequencies: 0.005789 835500 -- (-1143.198) (-1143.095) [-1144.230] (-1144.267) * [-1146.121] (-1143.789) (-1144.340) (-1146.134) -- 0:00:10 836000 -- (-1142.983) (-1143.302) (-1145.611) [-1143.115] * (-1144.911) (-1143.711) [-1143.097] (-1144.743) -- 0:00:10 836500 -- (-1143.372) [-1145.036] (-1144.761) (-1144.070) * [-1146.093] (-1143.538) (-1143.304) (-1143.934) -- 0:00:10 837000 -- (-1146.232) (-1145.335) [-1144.761] (-1143.420) * [-1146.900] (-1145.622) (-1149.624) (-1144.864) -- 0:00:10 837500 -- [-1143.366] (-1146.898) (-1145.755) (-1147.219) * (-1145.516) (-1145.131) [-1142.995] (-1143.718) -- 0:00:10 838000 -- [-1143.031] (-1150.903) (-1146.529) (-1143.631) * (-1145.420) (-1144.705) [-1142.699] (-1147.889) -- 0:00:10 838500 -- [-1143.697] (-1146.449) (-1147.477) (-1142.340) * (-1143.568) [-1144.510] (-1142.799) (-1148.699) -- 0:00:10 839000 -- [-1143.052] (-1143.353) (-1144.406) (-1145.615) * (-1142.491) (-1142.480) [-1144.263] (-1144.371) -- 0:00:09 839500 -- (-1147.674) (-1146.108) [-1143.463] (-1145.402) * [-1145.484] (-1142.414) (-1143.962) (-1144.263) -- 0:00:09 840000 -- (-1144.029) (-1147.187) [-1143.341] (-1144.560) * (-1142.860) (-1142.409) (-1144.767) [-1143.624] -- 0:00:09 Average standard deviation of split frequencies: 0.005495 840500 -- [-1145.101] (-1145.004) (-1145.517) (-1146.956) * (-1143.905) (-1144.082) (-1144.786) [-1142.890] -- 0:00:09 841000 -- (-1142.873) (-1146.288) (-1143.495) [-1145.770] * (-1145.649) (-1146.962) (-1145.615) [-1144.352] -- 0:00:09 841500 -- (-1144.369) [-1145.106] (-1146.012) (-1145.119) * (-1145.787) (-1147.282) (-1143.446) [-1144.152] -- 0:00:09 842000 -- (-1143.444) (-1145.360) [-1145.070] (-1144.461) * (-1145.528) [-1144.721] (-1143.376) (-1144.579) -- 0:00:09 842500 -- (-1143.506) (-1143.424) [-1145.190] (-1146.656) * [-1145.032] (-1145.145) (-1143.838) (-1147.150) -- 0:00:09 843000 -- [-1145.885] (-1144.742) (-1145.085) (-1144.261) * (-1147.251) (-1142.766) [-1146.471] (-1144.551) -- 0:00:09 843500 -- [-1142.847] (-1144.077) (-1146.212) (-1146.471) * (-1143.698) (-1142.473) (-1142.825) [-1145.125] -- 0:00:09 844000 -- (-1142.657) (-1142.839) [-1149.081] (-1143.964) * (-1143.928) [-1142.927] (-1143.578) (-1143.883) -- 0:00:09 844500 -- (-1143.209) (-1144.296) (-1146.850) [-1145.312] * (-1149.967) [-1143.890] (-1147.305) (-1146.403) -- 0:00:09 845000 -- (-1148.481) [-1143.176] (-1146.547) (-1144.051) * (-1148.907) (-1143.100) [-1147.311] (-1144.370) -- 0:00:09 Average standard deviation of split frequencies: 0.005386 845500 -- (-1151.166) [-1143.607] (-1145.076) (-1145.188) * (-1148.123) [-1144.791] (-1144.831) (-1150.288) -- 0:00:09 846000 -- (-1142.887) (-1146.264) [-1145.151] (-1142.926) * [-1144.512] (-1146.747) (-1144.953) (-1144.148) -- 0:00:09 846500 -- [-1144.268] (-1145.167) (-1148.380) (-1142.724) * [-1146.247] (-1143.183) (-1146.632) (-1144.715) -- 0:00:09 847000 -- (-1143.832) (-1143.167) [-1145.540] (-1145.607) * [-1143.388] (-1144.019) (-1145.688) (-1143.688) -- 0:00:09 847500 -- [-1146.900] (-1144.549) (-1148.708) (-1144.143) * (-1143.623) (-1144.143) [-1146.998] (-1144.282) -- 0:00:09 848000 -- (-1154.900) (-1142.730) (-1144.918) [-1145.901] * (-1144.065) [-1145.089] (-1148.590) (-1143.945) -- 0:00:09 848500 -- (-1145.667) (-1143.323) (-1142.800) [-1145.226] * (-1144.185) [-1144.040] (-1143.630) (-1145.732) -- 0:00:09 849000 -- (-1145.676) (-1148.401) (-1143.823) [-1142.588] * [-1145.757] (-1149.865) (-1142.956) (-1145.918) -- 0:00:09 849500 -- [-1145.676] (-1143.442) (-1144.520) (-1146.619) * (-1147.160) (-1143.888) (-1143.739) [-1148.766] -- 0:00:09 850000 -- (-1145.044) (-1143.427) (-1144.147) [-1142.862] * (-1144.209) (-1145.706) (-1147.980) [-1142.590] -- 0:00:09 Average standard deviation of split frequencies: 0.005061 850500 -- (-1142.845) (-1143.662) [-1144.097] (-1144.026) * (-1143.864) (-1143.407) (-1142.837) [-1142.981] -- 0:00:09 851000 -- [-1143.269] (-1143.045) (-1144.512) (-1143.321) * (-1144.328) [-1144.638] (-1143.246) (-1143.174) -- 0:00:09 851500 -- (-1146.210) (-1144.200) (-1145.556) [-1145.712] * (-1144.188) (-1144.188) [-1142.483] (-1146.448) -- 0:00:09 852000 -- (-1146.246) (-1146.293) (-1142.844) [-1143.675] * (-1142.417) (-1144.384) (-1143.764) [-1145.156] -- 0:00:09 852500 -- (-1146.724) (-1142.693) (-1149.191) [-1142.556] * [-1142.751] (-1144.473) (-1144.499) (-1142.989) -- 0:00:09 853000 -- (-1147.432) (-1145.750) (-1144.863) [-1144.375] * (-1148.079) [-1144.922] (-1144.122) (-1142.894) -- 0:00:09 853500 -- (-1144.088) [-1144.436] (-1144.698) (-1144.398) * (-1144.576) [-1144.223] (-1143.447) (-1144.368) -- 0:00:09 854000 -- [-1145.109] (-1146.408) (-1142.602) (-1146.347) * (-1144.403) (-1145.684) (-1146.463) [-1146.135] -- 0:00:09 854500 -- (-1144.215) [-1144.431] (-1145.514) (-1144.921) * (-1142.674) (-1146.542) [-1144.494] (-1143.672) -- 0:00:09 855000 -- (-1143.225) (-1147.534) (-1145.743) [-1144.628] * [-1147.840] (-1146.371) (-1146.804) (-1145.521) -- 0:00:08 Average standard deviation of split frequencies: 0.004736 855500 -- (-1146.251) [-1144.179] (-1145.162) (-1145.470) * (-1143.388) (-1144.150) [-1143.018] (-1143.810) -- 0:00:08 856000 -- (-1145.628) (-1144.300) (-1144.759) [-1146.857] * (-1144.303) [-1143.397] (-1145.600) (-1143.055) -- 0:00:08 856500 -- (-1144.778) (-1145.747) (-1143.005) [-1144.705] * (-1144.892) (-1143.310) (-1143.567) [-1145.738] -- 0:00:08 857000 -- (-1143.452) [-1144.767] (-1147.368) (-1143.566) * (-1146.926) (-1144.718) (-1143.664) [-1144.155] -- 0:00:08 857500 -- (-1145.128) [-1143.213] (-1145.064) (-1144.096) * (-1149.370) [-1143.818] (-1147.668) (-1144.598) -- 0:00:08 858000 -- (-1145.879) [-1143.471] (-1146.163) (-1145.069) * (-1144.020) [-1146.681] (-1144.132) (-1146.112) -- 0:00:08 858500 -- (-1146.006) [-1146.163] (-1144.133) (-1144.430) * (-1144.388) (-1146.440) (-1148.512) [-1148.509] -- 0:00:08 859000 -- [-1145.792] (-1144.779) (-1146.705) (-1144.852) * (-1144.390) (-1143.665) [-1144.315] (-1143.584) -- 0:00:08 859500 -- [-1144.716] (-1142.824) (-1151.718) (-1142.541) * [-1143.697] (-1144.386) (-1147.043) (-1145.254) -- 0:00:08 860000 -- (-1142.438) [-1144.320] (-1154.089) (-1142.520) * (-1143.126) (-1142.898) [-1146.377] (-1144.703) -- 0:00:08 Average standard deviation of split frequencies: 0.004455 860500 -- [-1142.755] (-1144.754) (-1144.283) (-1142.919) * (-1150.286) (-1147.864) (-1146.053) [-1147.823] -- 0:00:08 861000 -- (-1143.840) [-1147.085] (-1144.097) (-1143.295) * (-1145.597) (-1144.576) (-1143.516) [-1146.941] -- 0:00:08 861500 -- (-1145.616) (-1157.760) (-1143.738) [-1143.141] * [-1146.253] (-1143.174) (-1146.582) (-1148.133) -- 0:00:08 862000 -- (-1146.614) (-1146.283) [-1144.841] (-1145.647) * (-1146.878) (-1145.536) (-1147.073) [-1146.646] -- 0:00:08 862500 -- [-1144.620] (-1146.527) (-1145.916) (-1145.879) * [-1147.527] (-1144.669) (-1145.402) (-1148.587) -- 0:00:08 863000 -- (-1145.731) (-1146.080) (-1146.004) [-1144.261] * (-1143.892) [-1142.937] (-1143.793) (-1145.267) -- 0:00:08 863500 -- (-1144.095) (-1142.635) [-1145.569] (-1145.658) * (-1144.634) (-1145.414) [-1143.422] (-1143.288) -- 0:00:08 864000 -- (-1143.270) (-1142.639) [-1144.294] (-1144.305) * (-1145.256) (-1143.458) [-1147.264] (-1144.399) -- 0:00:08 864500 -- (-1143.076) (-1142.620) [-1146.470] (-1144.448) * [-1143.610] (-1145.733) (-1143.032) (-1144.372) -- 0:00:08 865000 -- (-1142.882) (-1142.930) [-1145.540] (-1144.956) * (-1144.856) [-1144.274] (-1143.529) (-1144.918) -- 0:00:08 Average standard deviation of split frequencies: 0.004101 865500 -- (-1142.994) (-1143.991) [-1145.310] (-1143.042) * [-1143.852] (-1144.409) (-1145.892) (-1143.005) -- 0:00:08 866000 -- [-1143.099] (-1143.891) (-1144.321) (-1144.933) * (-1144.866) (-1145.480) (-1144.228) [-1143.527] -- 0:00:08 866500 -- (-1147.251) (-1143.883) (-1143.851) [-1142.677] * (-1143.820) [-1144.297] (-1144.285) (-1144.058) -- 0:00:08 867000 -- (-1143.697) (-1143.028) (-1143.181) [-1142.942] * (-1143.808) (-1149.641) (-1144.035) [-1144.846] -- 0:00:08 867500 -- (-1143.625) (-1143.733) [-1144.854] (-1142.604) * (-1144.005) (-1147.079) (-1143.818) [-1145.625] -- 0:00:08 868000 -- (-1144.111) (-1142.845) [-1146.945] (-1146.416) * [-1145.867] (-1145.212) (-1145.568) (-1144.606) -- 0:00:08 868500 -- (-1151.190) (-1143.600) (-1145.649) [-1146.078] * (-1146.619) [-1145.811] (-1146.837) (-1147.945) -- 0:00:08 869000 -- [-1145.757] (-1144.671) (-1143.817) (-1147.612) * [-1147.062] (-1142.658) (-1144.222) (-1144.722) -- 0:00:08 869500 -- (-1144.428) (-1144.827) [-1145.044] (-1147.355) * (-1144.023) (-1142.594) (-1144.825) [-1144.958] -- 0:00:08 870000 -- (-1144.077) (-1143.145) [-1143.518] (-1143.204) * (-1146.722) (-1144.391) [-1146.628] (-1148.182) -- 0:00:08 Average standard deviation of split frequencies: 0.004440 870500 -- (-1144.257) (-1143.139) [-1142.861] (-1144.162) * (-1144.811) [-1144.824] (-1146.493) (-1144.834) -- 0:00:08 871000 -- (-1145.356) [-1144.341] (-1144.302) (-1143.814) * (-1144.016) (-1145.653) (-1148.340) [-1150.954] -- 0:00:07 871500 -- [-1142.995] (-1143.370) (-1145.437) (-1147.653) * [-1143.274] (-1146.815) (-1144.855) (-1143.591) -- 0:00:07 872000 -- (-1145.166) (-1143.626) [-1144.466] (-1146.820) * (-1144.777) (-1150.603) (-1145.596) [-1143.434] -- 0:00:07 872500 -- (-1144.595) [-1143.626] (-1146.722) (-1145.607) * (-1145.537) (-1146.740) [-1145.130] (-1144.960) -- 0:00:07 873000 -- [-1144.624] (-1143.389) (-1147.869) (-1145.600) * (-1147.288) (-1143.798) [-1143.476] (-1142.470) -- 0:00:07 873500 -- (-1143.766) (-1143.896) (-1145.871) [-1144.565] * (-1146.049) (-1144.451) [-1143.673] (-1142.497) -- 0:00:07 874000 -- (-1146.866) (-1144.051) (-1143.185) [-1147.076] * (-1143.693) (-1145.355) [-1143.017] (-1143.218) -- 0:00:07 874500 -- (-1145.730) (-1143.782) [-1143.495] (-1151.714) * (-1144.074) (-1146.204) (-1145.364) [-1144.552] -- 0:00:07 875000 -- (-1146.735) (-1142.833) [-1142.907] (-1146.896) * [-1146.519] (-1144.248) (-1146.846) (-1145.953) -- 0:00:07 Average standard deviation of split frequencies: 0.004413 875500 -- (-1143.584) (-1144.079) (-1143.866) [-1142.816] * [-1143.693] (-1145.535) (-1145.289) (-1146.059) -- 0:00:07 876000 -- (-1142.849) [-1143.969] (-1143.157) (-1144.535) * (-1145.300) (-1144.667) (-1145.552) [-1148.856] -- 0:00:07 876500 -- (-1142.835) (-1143.838) [-1143.373] (-1143.017) * (-1144.571) (-1144.322) (-1147.308) [-1145.306] -- 0:00:07 877000 -- (-1142.911) [-1145.312] (-1142.526) (-1142.752) * (-1144.163) (-1142.372) (-1143.332) [-1144.880] -- 0:00:07 877500 -- [-1145.045] (-1144.489) (-1146.136) (-1143.056) * (-1145.397) [-1142.372] (-1146.997) (-1144.967) -- 0:00:07 878000 -- [-1145.731] (-1142.698) (-1143.779) (-1143.056) * [-1143.162] (-1144.608) (-1143.022) (-1151.444) -- 0:00:07 878500 -- (-1144.181) (-1143.891) (-1148.618) [-1142.400] * (-1146.396) [-1143.304] (-1143.043) (-1147.028) -- 0:00:07 879000 -- (-1143.773) (-1145.234) (-1144.722) [-1143.733] * (-1146.571) (-1147.995) [-1144.113] (-1148.030) -- 0:00:07 879500 -- [-1147.577] (-1149.720) (-1142.913) (-1142.645) * (-1147.014) (-1149.286) [-1144.234] (-1142.684) -- 0:00:07 880000 -- (-1147.510) (-1144.880) (-1143.956) [-1143.800] * (-1145.390) (-1145.847) [-1143.516] (-1146.647) -- 0:00:07 Average standard deviation of split frequencies: 0.004639 880500 -- (-1148.943) [-1144.822] (-1143.897) (-1143.453) * [-1145.071] (-1148.304) (-1144.271) (-1148.262) -- 0:00:07 881000 -- [-1145.704] (-1146.221) (-1143.928) (-1145.117) * [-1142.942] (-1143.324) (-1144.314) (-1148.089) -- 0:00:07 881500 -- (-1145.376) [-1145.209] (-1145.528) (-1144.029) * (-1142.895) (-1144.977) [-1142.949] (-1143.109) -- 0:00:07 882000 -- (-1145.684) [-1146.544] (-1151.791) (-1146.329) * (-1143.506) (-1145.449) [-1144.536] (-1143.407) -- 0:00:07 882500 -- [-1143.472] (-1146.888) (-1145.433) (-1145.240) * (-1145.099) [-1142.574] (-1143.073) (-1146.759) -- 0:00:07 883000 -- (-1145.841) (-1149.642) (-1144.657) [-1143.193] * (-1148.103) (-1142.931) [-1143.165] (-1148.284) -- 0:00:07 883500 -- (-1143.600) [-1144.359] (-1145.093) (-1144.936) * [-1142.930] (-1144.391) (-1144.419) (-1145.029) -- 0:00:07 884000 -- [-1145.796] (-1147.993) (-1144.222) (-1143.107) * (-1143.884) [-1143.897] (-1148.011) (-1143.973) -- 0:00:07 884500 -- [-1143.729] (-1143.105) (-1145.483) (-1142.307) * [-1144.797] (-1147.807) (-1144.827) (-1147.543) -- 0:00:07 885000 -- (-1146.282) (-1143.107) (-1143.354) [-1142.308] * [-1145.509] (-1143.325) (-1144.774) (-1143.783) -- 0:00:07 Average standard deviation of split frequencies: 0.004824 885500 -- [-1142.895] (-1143.664) (-1143.028) (-1146.686) * (-1143.485) (-1146.976) (-1146.420) [-1143.529] -- 0:00:07 886000 -- (-1145.731) (-1144.145) (-1147.254) [-1145.688] * [-1144.688] (-1150.164) (-1143.991) (-1142.782) -- 0:00:07 886500 -- (-1146.912) (-1144.185) [-1144.950] (-1144.202) * (-1143.762) [-1144.868] (-1143.898) (-1143.486) -- 0:00:07 887000 -- (-1146.340) (-1147.298) (-1145.118) [-1143.830] * [-1143.947] (-1143.797) (-1143.025) (-1150.064) -- 0:00:07 887500 -- (-1146.590) (-1146.547) [-1144.393] (-1143.870) * (-1143.555) (-1146.407) (-1152.439) [-1151.572] -- 0:00:06 888000 -- [-1143.619] (-1147.503) (-1144.285) (-1144.816) * (-1148.146) (-1145.587) [-1148.360] (-1144.670) -- 0:00:06 888500 -- (-1144.371) (-1143.811) (-1144.497) [-1144.888] * (-1143.958) (-1143.925) (-1148.104) [-1143.594] -- 0:00:06 889000 -- (-1147.049) (-1144.218) [-1143.391] (-1144.953) * (-1146.367) (-1144.432) (-1143.245) [-1143.434] -- 0:00:06 889500 -- [-1146.462] (-1143.269) (-1145.455) (-1142.849) * (-1143.404) [-1145.379] (-1148.307) (-1148.999) -- 0:00:06 890000 -- (-1147.425) (-1144.745) [-1146.489] (-1143.230) * [-1146.820] (-1145.106) (-1151.340) (-1155.213) -- 0:00:06 Average standard deviation of split frequencies: 0.004834 890500 -- [-1143.286] (-1146.756) (-1142.909) (-1142.984) * (-1146.568) (-1147.739) (-1148.167) [-1148.299] -- 0:00:06 891000 -- (-1144.639) (-1149.905) [-1145.308] (-1145.862) * (-1148.105) (-1142.533) (-1143.543) [-1143.137] -- 0:00:06 891500 -- (-1144.542) (-1143.824) (-1143.199) [-1143.343] * (-1143.933) [-1144.650] (-1148.854) (-1144.832) -- 0:00:06 892000 -- [-1143.415] (-1144.518) (-1145.173) (-1147.748) * [-1143.571] (-1145.371) (-1143.545) (-1144.203) -- 0:00:06 892500 -- (-1143.493) (-1146.082) [-1144.101] (-1151.087) * (-1147.688) (-1144.397) (-1142.976) [-1144.512] -- 0:00:06 893000 -- [-1143.426] (-1148.906) (-1143.646) (-1147.709) * (-1143.501) (-1144.078) (-1145.734) [-1143.714] -- 0:00:06 893500 -- (-1149.961) [-1149.412] (-1143.722) (-1148.683) * (-1147.548) [-1145.357] (-1149.033) (-1143.739) -- 0:00:06 894000 -- (-1148.943) (-1150.205) [-1144.635] (-1147.769) * (-1144.701) (-1147.244) (-1144.933) [-1144.809] -- 0:00:06 894500 -- (-1146.335) [-1146.625] (-1144.103) (-1144.325) * (-1145.209) (-1148.682) (-1143.248) [-1143.709] -- 0:00:06 895000 -- (-1146.103) (-1147.284) (-1145.214) [-1144.295] * [-1145.553] (-1145.726) (-1147.548) (-1143.902) -- 0:00:06 Average standard deviation of split frequencies: 0.004244 895500 -- (-1150.453) (-1146.329) [-1143.488] (-1144.198) * [-1143.396] (-1144.043) (-1144.480) (-1142.797) -- 0:00:06 896000 -- (-1144.858) (-1145.793) (-1143.775) [-1144.521] * [-1143.098] (-1143.650) (-1144.651) (-1144.157) -- 0:00:06 896500 -- (-1145.923) (-1145.503) [-1143.029] (-1143.296) * [-1143.650] (-1146.517) (-1149.519) (-1144.767) -- 0:00:06 897000 -- (-1148.099) [-1144.912] (-1142.807) (-1143.923) * [-1146.061] (-1145.034) (-1144.112) (-1143.421) -- 0:00:06 897500 -- (-1144.756) [-1144.333] (-1143.843) (-1144.977) * [-1144.637] (-1144.689) (-1144.109) (-1144.599) -- 0:00:06 898000 -- (-1144.606) (-1146.380) [-1143.119] (-1143.550) * [-1145.618] (-1143.170) (-1143.361) (-1146.315) -- 0:00:06 898500 -- (-1145.340) [-1146.108] (-1147.123) (-1144.314) * (-1147.657) [-1143.830] (-1144.650) (-1143.497) -- 0:00:06 899000 -- (-1145.424) (-1148.361) (-1142.809) [-1143.750] * [-1145.688] (-1146.040) (-1142.332) (-1146.185) -- 0:00:06 899500 -- [-1144.476] (-1144.347) (-1145.099) (-1144.125) * (-1147.646) [-1142.720] (-1143.487) (-1146.276) -- 0:00:06 900000 -- (-1144.477) [-1144.007] (-1151.443) (-1147.958) * [-1146.621] (-1144.858) (-1142.632) (-1146.414) -- 0:00:06 Average standard deviation of split frequencies: 0.004152 900500 -- (-1144.633) (-1144.160) [-1144.922] (-1145.130) * (-1143.989) (-1144.100) [-1142.545] (-1143.245) -- 0:00:06 901000 -- (-1143.830) (-1147.286) (-1153.149) [-1142.502] * [-1143.654] (-1144.231) (-1144.377) (-1145.224) -- 0:00:06 901500 -- (-1145.611) (-1147.168) (-1145.310) [-1145.421] * (-1144.129) (-1143.827) [-1143.714] (-1144.624) -- 0:00:06 902000 -- [-1147.719] (-1143.687) (-1146.879) (-1149.799) * [-1146.306] (-1143.913) (-1143.768) (-1145.454) -- 0:00:06 902500 -- (-1143.951) (-1146.817) [-1146.371] (-1146.278) * (-1144.166) (-1145.180) [-1144.412] (-1143.811) -- 0:00:06 903000 -- [-1145.685] (-1144.700) (-1145.280) (-1149.373) * (-1142.989) (-1144.297) (-1144.092) [-1145.073] -- 0:00:06 903500 -- (-1144.715) (-1142.890) [-1144.439] (-1145.313) * (-1142.451) (-1143.846) (-1144.158) [-1143.267] -- 0:00:05 904000 -- (-1146.330) (-1143.864) [-1144.511] (-1144.860) * (-1142.308) (-1144.357) [-1144.002] (-1144.409) -- 0:00:05 904500 -- (-1145.714) (-1144.521) (-1145.866) [-1149.380] * [-1143.950] (-1143.895) (-1143.444) (-1145.517) -- 0:00:05 905000 -- [-1146.082] (-1144.443) (-1144.321) (-1143.468) * (-1146.284) [-1143.770] (-1143.027) (-1144.091) -- 0:00:05 Average standard deviation of split frequencies: 0.004544 905500 -- (-1144.856) [-1143.846] (-1142.895) (-1142.860) * [-1144.895] (-1145.948) (-1144.476) (-1142.457) -- 0:00:05 906000 -- [-1144.136] (-1146.987) (-1143.773) (-1143.824) * (-1142.749) [-1143.984] (-1144.723) (-1143.720) -- 0:00:05 906500 -- [-1144.314] (-1143.358) (-1145.996) (-1148.033) * (-1142.783) (-1143.957) (-1145.157) [-1143.514] -- 0:00:05 907000 -- (-1143.106) (-1147.201) (-1143.643) [-1151.488] * (-1142.578) [-1143.162] (-1143.458) (-1145.293) -- 0:00:05 907500 -- (-1150.902) [-1145.540] (-1147.603) (-1144.589) * (-1144.103) (-1145.210) [-1143.402] (-1144.613) -- 0:00:05 908000 -- (-1146.603) [-1147.413] (-1148.121) (-1145.231) * (-1148.063) (-1145.259) (-1143.431) [-1143.930] -- 0:00:05 908500 -- (-1149.044) (-1148.448) (-1142.599) [-1143.486] * (-1147.568) (-1143.163) [-1144.431] (-1147.345) -- 0:00:05 909000 -- (-1151.278) (-1147.719) [-1144.267] (-1146.602) * (-1142.962) (-1144.465) [-1144.082] (-1147.255) -- 0:00:05 909500 -- (-1153.894) (-1146.661) (-1144.686) [-1144.706] * (-1145.480) [-1144.741] (-1145.931) (-1143.161) -- 0:00:05 910000 -- [-1144.851] (-1143.883) (-1145.416) (-1144.087) * (-1148.308) (-1146.142) [-1144.728] (-1143.700) -- 0:00:05 Average standard deviation of split frequencies: 0.004383 910500 -- [-1143.655] (-1143.866) (-1146.600) (-1142.519) * (-1143.881) (-1143.492) (-1143.724) [-1142.603] -- 0:00:05 911000 -- (-1147.414) [-1145.901] (-1146.311) (-1142.645) * (-1143.143) [-1146.373] (-1143.803) (-1144.463) -- 0:00:05 911500 -- [-1144.390] (-1143.603) (-1144.474) (-1152.025) * (-1142.545) [-1144.124] (-1143.494) (-1144.575) -- 0:00:05 912000 -- [-1144.774] (-1149.278) (-1142.808) (-1156.143) * (-1143.308) [-1145.619] (-1143.790) (-1144.800) -- 0:00:05 912500 -- (-1143.498) [-1144.493] (-1147.227) (-1148.014) * (-1147.139) (-1145.038) (-1143.589) [-1145.672] -- 0:00:05 913000 -- (-1143.560) (-1144.299) [-1144.117] (-1143.636) * (-1142.836) [-1146.425] (-1143.082) (-1146.477) -- 0:00:05 913500 -- (-1150.867) (-1145.806) [-1145.348] (-1142.600) * [-1143.619] (-1146.506) (-1144.439) (-1144.946) -- 0:00:05 914000 -- [-1144.256] (-1146.534) (-1143.719) (-1143.241) * (-1143.505) (-1146.830) (-1147.299) [-1143.942] -- 0:00:05 914500 -- [-1145.443] (-1142.983) (-1147.591) (-1143.562) * [-1146.918] (-1142.797) (-1143.733) (-1145.582) -- 0:00:05 915000 -- [-1144.304] (-1143.112) (-1145.386) (-1144.911) * (-1143.640) (-1147.151) (-1144.747) [-1143.117] -- 0:00:05 Average standard deviation of split frequencies: 0.004563 915500 -- (-1142.869) (-1143.562) [-1147.464] (-1147.619) * (-1143.640) (-1146.756) [-1144.463] (-1145.778) -- 0:00:05 916000 -- (-1142.938) (-1143.077) (-1145.010) [-1145.810] * (-1144.608) (-1143.913) (-1146.449) [-1147.767] -- 0:00:05 916500 -- [-1146.142] (-1147.103) (-1146.063) (-1145.188) * (-1143.276) (-1143.799) (-1144.357) [-1144.612] -- 0:00:05 917000 -- [-1144.294] (-1144.508) (-1146.740) (-1144.344) * (-1144.701) (-1145.103) [-1144.454] (-1144.055) -- 0:00:05 917500 -- [-1142.625] (-1145.302) (-1145.951) (-1143.514) * (-1144.069) (-1145.556) (-1143.931) [-1144.005] -- 0:00:05 918000 -- [-1144.201] (-1143.877) (-1143.445) (-1145.983) * (-1143.502) [-1143.448] (-1150.353) (-1142.436) -- 0:00:05 918500 -- [-1143.782] (-1148.134) (-1144.792) (-1143.416) * (-1143.340) (-1143.890) (-1148.278) [-1142.933] -- 0:00:05 919000 -- (-1149.580) [-1144.744] (-1144.577) (-1144.592) * (-1145.158) [-1143.634] (-1147.998) (-1145.468) -- 0:00:05 919500 -- (-1143.469) (-1144.188) (-1143.045) [-1145.923] * (-1145.340) [-1147.497] (-1146.634) (-1147.051) -- 0:00:04 920000 -- (-1145.391) (-1145.053) [-1143.352] (-1143.637) * (-1146.424) [-1148.320] (-1149.622) (-1143.581) -- 0:00:04 Average standard deviation of split frequencies: 0.004574 920500 -- (-1142.667) (-1145.377) (-1143.262) [-1145.846] * [-1143.025] (-1147.855) (-1144.784) (-1142.568) -- 0:00:04 921000 -- [-1144.623] (-1143.561) (-1144.132) (-1147.601) * [-1144.023] (-1145.644) (-1144.883) (-1143.384) -- 0:00:04 921500 -- [-1144.633] (-1143.703) (-1149.161) (-1144.434) * (-1144.085) [-1144.489] (-1144.230) (-1144.401) -- 0:00:04 922000 -- [-1143.385] (-1142.697) (-1147.086) (-1145.895) * (-1144.411) [-1148.937] (-1145.545) (-1144.840) -- 0:00:04 922500 -- (-1144.190) [-1142.920] (-1149.811) (-1143.728) * [-1143.519] (-1143.783) (-1143.168) (-1144.745) -- 0:00:04 923000 -- (-1145.076) (-1143.915) [-1144.766] (-1149.380) * (-1142.918) (-1143.681) [-1143.705] (-1145.395) -- 0:00:04 923500 -- (-1143.964) (-1142.748) (-1145.400) [-1144.074] * (-1144.974) (-1146.601) (-1142.679) [-1143.001] -- 0:00:04 924000 -- (-1143.838) (-1145.077) [-1142.727] (-1144.232) * (-1144.549) (-1145.219) (-1145.276) [-1143.883] -- 0:00:04 924500 -- (-1145.560) [-1142.746] (-1147.265) (-1144.792) * (-1145.971) (-1143.878) (-1143.749) [-1146.030] -- 0:00:04 925000 -- [-1144.295] (-1145.732) (-1147.651) (-1144.331) * (-1143.257) (-1145.461) [-1148.209] (-1148.603) -- 0:00:04 Average standard deviation of split frequencies: 0.004751 925500 -- (-1145.989) [-1148.809] (-1144.488) (-1145.305) * (-1144.262) [-1143.071] (-1149.107) (-1143.054) -- 0:00:04 926000 -- (-1146.573) (-1149.037) (-1145.308) [-1142.764] * [-1145.832] (-1143.424) (-1146.965) (-1144.766) -- 0:00:04 926500 -- (-1146.651) (-1145.656) (-1144.240) [-1143.003] * (-1144.931) (-1146.789) [-1143.433] (-1145.464) -- 0:00:04 927000 -- (-1145.378) (-1145.132) (-1144.275) [-1146.357] * (-1144.011) (-1144.995) [-1146.817] (-1145.373) -- 0:00:04 927500 -- (-1143.920) [-1142.468] (-1146.104) (-1147.006) * (-1145.388) (-1145.094) (-1150.540) [-1143.829] -- 0:00:04 928000 -- [-1143.625] (-1143.790) (-1148.680) (-1147.801) * (-1144.138) [-1145.707] (-1145.923) (-1144.583) -- 0:00:04 928500 -- (-1143.328) [-1142.898] (-1145.468) (-1146.399) * [-1145.189] (-1144.006) (-1142.979) (-1144.624) -- 0:00:04 929000 -- (-1145.489) [-1144.164] (-1143.020) (-1145.155) * (-1147.830) (-1144.917) [-1145.763] (-1147.178) -- 0:00:04 929500 -- (-1145.330) [-1143.072] (-1143.048) (-1148.052) * (-1144.291) [-1146.005] (-1146.285) (-1145.085) -- 0:00:04 930000 -- (-1147.797) [-1144.350] (-1143.800) (-1145.444) * (-1144.572) (-1144.358) (-1145.108) [-1144.802] -- 0:00:04 Average standard deviation of split frequencies: 0.004863 930500 -- (-1144.639) (-1144.146) (-1142.927) [-1147.636] * [-1143.892] (-1144.912) (-1144.779) (-1144.598) -- 0:00:04 931000 -- (-1147.596) (-1144.469) [-1144.173] (-1148.834) * (-1145.020) (-1146.136) [-1143.892] (-1142.684) -- 0:00:04 931500 -- [-1148.721] (-1143.948) (-1144.877) (-1144.486) * (-1144.835) (-1144.495) [-1145.038] (-1147.328) -- 0:00:04 932000 -- (-1146.066) [-1143.725] (-1144.181) (-1145.876) * (-1145.737) [-1144.688] (-1143.891) (-1146.873) -- 0:00:04 932500 -- (-1143.999) (-1145.922) (-1144.202) [-1142.880] * (-1144.948) [-1144.931] (-1143.193) (-1145.512) -- 0:00:04 933000 -- [-1143.780] (-1144.387) (-1147.271) (-1143.185) * (-1145.397) [-1143.505] (-1142.621) (-1147.108) -- 0:00:04 933500 -- [-1144.395] (-1144.067) (-1146.844) (-1145.759) * (-1143.431) [-1147.210] (-1145.986) (-1145.273) -- 0:00:04 934000 -- (-1146.185) (-1143.493) [-1145.468] (-1143.977) * (-1146.807) [-1144.662] (-1147.935) (-1143.949) -- 0:00:04 934500 -- (-1145.915) (-1143.966) [-1143.169] (-1146.942) * (-1143.811) (-1143.974) (-1146.264) [-1146.972] -- 0:00:04 935000 -- [-1149.022] (-1147.134) (-1143.693) (-1144.993) * (-1145.192) [-1144.352] (-1145.867) (-1147.163) -- 0:00:04 Average standard deviation of split frequencies: 0.004868 935500 -- [-1145.346] (-1143.862) (-1144.954) (-1144.824) * (-1145.453) (-1143.188) [-1148.798] (-1145.272) -- 0:00:03 936000 -- (-1144.486) (-1148.701) [-1143.512] (-1144.669) * (-1146.313) [-1143.650] (-1142.771) (-1145.468) -- 0:00:03 936500 -- (-1146.370) [-1145.970] (-1145.299) (-1146.645) * (-1144.824) (-1144.178) [-1142.682] (-1147.203) -- 0:00:03 937000 -- (-1143.239) (-1144.195) (-1146.002) [-1145.237] * [-1145.287] (-1144.891) (-1147.403) (-1154.269) -- 0:00:03 937500 -- (-1146.226) (-1147.429) (-1144.257) [-1145.663] * (-1146.817) [-1144.168] (-1144.889) (-1143.964) -- 0:00:03 938000 -- (-1149.582) (-1145.127) [-1143.354] (-1146.620) * (-1144.693) (-1144.567) [-1147.473] (-1143.586) -- 0:00:03 938500 -- (-1144.623) (-1142.689) [-1145.272] (-1145.926) * [-1150.072] (-1143.750) (-1146.254) (-1143.506) -- 0:00:03 939000 -- (-1148.343) (-1147.856) (-1143.842) [-1144.616] * (-1145.583) (-1146.377) [-1143.872] (-1145.740) -- 0:00:03 939500 -- (-1148.770) (-1144.132) (-1147.285) [-1143.966] * (-1146.982) (-1144.416) (-1149.078) [-1142.935] -- 0:00:03 940000 -- (-1146.966) [-1143.010] (-1144.201) (-1142.771) * (-1150.125) (-1144.698) (-1146.151) [-1143.588] -- 0:00:03 Average standard deviation of split frequencies: 0.004544 940500 -- (-1145.676) [-1145.538] (-1147.043) (-1144.129) * (-1144.768) (-1144.296) [-1142.584] (-1144.119) -- 0:00:03 941000 -- (-1143.261) (-1146.462) [-1145.036] (-1148.511) * (-1146.004) [-1144.901] (-1142.587) (-1147.688) -- 0:00:03 941500 -- (-1143.325) [-1145.011] (-1143.761) (-1146.595) * [-1144.445] (-1145.652) (-1142.477) (-1150.459) -- 0:00:03 942000 -- (-1143.541) (-1144.741) [-1142.956] (-1145.717) * (-1145.166) (-1145.510) [-1142.651] (-1146.520) -- 0:00:03 942500 -- [-1144.223] (-1143.169) (-1144.461) (-1144.264) * [-1143.827] (-1143.495) (-1145.780) (-1148.686) -- 0:00:03 943000 -- [-1142.907] (-1143.688) (-1143.948) (-1146.080) * [-1143.739] (-1143.646) (-1145.798) (-1148.020) -- 0:00:03 943500 -- (-1144.556) (-1154.244) [-1147.467] (-1146.206) * (-1144.524) (-1143.997) [-1146.002] (-1144.361) -- 0:00:03 944000 -- (-1142.693) [-1143.108] (-1147.565) (-1145.642) * (-1147.143) [-1143.400] (-1144.175) (-1144.146) -- 0:00:03 944500 -- (-1143.891) (-1144.897) (-1146.841) [-1146.075] * (-1144.556) [-1143.428] (-1142.811) (-1150.433) -- 0:00:03 945000 -- (-1143.500) (-1146.573) [-1145.038] (-1145.536) * (-1146.499) [-1143.355] (-1150.097) (-1143.235) -- 0:00:03 Average standard deviation of split frequencies: 0.004551 945500 -- (-1145.817) [-1148.769] (-1146.633) (-1144.235) * (-1144.851) (-1145.117) (-1146.119) [-1143.109] -- 0:00:03 946000 -- (-1144.495) (-1153.691) [-1145.386] (-1146.638) * (-1143.288) [-1143.144] (-1142.835) (-1144.692) -- 0:00:03 946500 -- (-1145.502) [-1148.185] (-1145.816) (-1143.063) * [-1144.320] (-1143.423) (-1147.078) (-1142.965) -- 0:00:03 947000 -- (-1145.788) (-1143.414) [-1146.410] (-1144.929) * [-1145.106] (-1145.005) (-1149.346) (-1142.982) -- 0:00:03 947500 -- (-1143.885) [-1144.181] (-1145.424) (-1147.355) * (-1144.488) (-1143.586) (-1150.428) [-1143.675] -- 0:00:03 948000 -- (-1144.180) (-1146.738) (-1148.474) [-1144.447] * (-1144.593) (-1143.343) (-1145.014) [-1143.158] -- 0:00:03 948500 -- [-1145.505] (-1143.887) (-1144.981) (-1145.532) * (-1144.925) (-1144.200) (-1143.942) [-1142.531] -- 0:00:03 949000 -- (-1144.161) [-1143.819] (-1144.897) (-1143.765) * [-1144.040] (-1149.063) (-1144.399) (-1142.485) -- 0:00:03 949500 -- [-1145.606] (-1145.240) (-1145.593) (-1145.060) * (-1143.705) (-1143.482) (-1146.110) [-1143.793] -- 0:00:03 950000 -- (-1147.741) (-1147.413) (-1142.395) [-1143.447] * (-1143.874) (-1143.284) [-1144.369] (-1144.965) -- 0:00:03 Average standard deviation of split frequencies: 0.004628 950500 -- (-1148.450) (-1147.855) [-1144.743] (-1143.357) * [-1142.939] (-1144.404) (-1143.640) (-1144.754) -- 0:00:03 951000 -- (-1147.807) (-1147.635) [-1145.653] (-1143.895) * (-1144.554) (-1143.216) [-1148.355] (-1146.511) -- 0:00:03 951500 -- (-1145.913) (-1143.247) [-1143.316] (-1145.181) * [-1144.626] (-1144.830) (-1144.246) (-1146.852) -- 0:00:03 952000 -- (-1145.152) (-1143.203) [-1144.217] (-1144.398) * (-1144.078) (-1145.948) (-1145.488) [-1144.307] -- 0:00:02 952500 -- (-1144.586) (-1146.535) [-1143.758] (-1144.168) * (-1144.501) (-1144.151) (-1144.667) [-1144.780] -- 0:00:02 953000 -- [-1142.734] (-1147.256) (-1144.644) (-1143.344) * (-1144.038) (-1145.852) (-1150.160) [-1144.180] -- 0:00:02 953500 -- (-1142.829) (-1144.933) (-1143.511) [-1143.705] * [-1143.719] (-1145.931) (-1144.147) (-1144.800) -- 0:00:02 954000 -- (-1145.136) (-1148.312) [-1142.942] (-1142.848) * [-1144.293] (-1148.767) (-1144.096) (-1143.038) -- 0:00:02 954500 -- [-1143.013] (-1142.373) (-1144.833) (-1146.278) * (-1143.396) [-1146.662] (-1142.734) (-1143.459) -- 0:00:02 955000 -- [-1143.759] (-1145.974) (-1144.609) (-1143.990) * (-1144.957) (-1143.587) (-1146.468) [-1142.623] -- 0:00:02 Average standard deviation of split frequencies: 0.004471 955500 -- (-1145.422) (-1147.006) (-1147.878) [-1143.651] * [-1148.185] (-1144.070) (-1144.836) (-1142.638) -- 0:00:02 956000 -- (-1145.144) (-1143.953) (-1147.870) [-1145.915] * (-1144.529) (-1144.341) (-1144.419) [-1143.843] -- 0:00:02 956500 -- (-1143.138) (-1142.898) (-1146.814) [-1146.126] * (-1142.615) (-1144.077) [-1143.587] (-1143.545) -- 0:00:02 957000 -- (-1150.811) (-1146.389) [-1144.612] (-1145.494) * [-1145.257] (-1144.692) (-1143.979) (-1143.503) -- 0:00:02 957500 -- (-1149.668) (-1143.247) [-1145.417] (-1145.994) * [-1144.872] (-1148.603) (-1147.465) (-1143.414) -- 0:00:02 958000 -- (-1146.548) (-1143.017) [-1143.561] (-1145.828) * [-1142.992] (-1145.735) (-1147.373) (-1147.013) -- 0:00:02 958500 -- [-1144.130] (-1145.266) (-1143.135) (-1143.804) * (-1143.171) (-1146.110) [-1149.121] (-1145.649) -- 0:00:02 959000 -- (-1145.281) [-1145.997] (-1143.315) (-1143.287) * (-1144.393) (-1145.121) (-1142.715) [-1144.842] -- 0:00:02 959500 -- (-1142.821) (-1143.245) (-1143.053) [-1143.636] * (-1144.099) (-1146.267) (-1143.763) [-1146.439] -- 0:00:02 960000 -- (-1144.540) (-1144.035) (-1144.774) [-1144.280] * (-1144.608) (-1144.704) [-1145.176] (-1144.384) -- 0:00:02 Average standard deviation of split frequencies: 0.004482 960500 -- [-1144.382] (-1144.688) (-1142.733) (-1149.237) * (-1143.337) [-1144.580] (-1146.019) (-1145.677) -- 0:00:02 961000 -- (-1147.289) [-1144.693] (-1145.403) (-1146.224) * (-1142.992) [-1143.770] (-1146.728) (-1143.492) -- 0:00:02 961500 -- (-1144.021) [-1144.694] (-1146.881) (-1146.609) * [-1144.345] (-1145.974) (-1144.456) (-1144.009) -- 0:00:02 962000 -- (-1144.420) [-1145.906] (-1147.257) (-1143.376) * (-1143.599) (-1145.007) (-1146.701) [-1144.098] -- 0:00:02 962500 -- (-1144.680) (-1144.846) [-1144.705] (-1144.531) * (-1144.120) [-1144.659] (-1142.708) (-1143.337) -- 0:00:02 963000 -- [-1144.237] (-1145.707) (-1145.032) (-1146.613) * (-1145.157) (-1144.679) (-1142.746) [-1142.868] -- 0:00:02 963500 -- (-1142.884) (-1143.452) [-1143.788] (-1144.099) * (-1147.661) [-1144.364] (-1143.309) (-1142.872) -- 0:00:02 964000 -- [-1144.461] (-1145.072) (-1144.563) (-1144.777) * (-1145.354) (-1144.365) (-1145.856) [-1147.231] -- 0:00:02 964500 -- (-1144.504) (-1143.331) (-1144.553) [-1146.389] * (-1145.867) [-1143.123] (-1143.712) (-1144.250) -- 0:00:02 965000 -- [-1144.421] (-1142.794) (-1143.543) (-1145.546) * (-1149.947) [-1142.958] (-1145.153) (-1153.106) -- 0:00:02 Average standard deviation of split frequencies: 0.004490 965500 -- [-1143.764] (-1142.573) (-1145.641) (-1146.833) * (-1144.794) (-1144.508) (-1143.306) [-1149.050] -- 0:00:02 966000 -- (-1147.714) (-1144.101) (-1145.348) [-1145.314] * (-1145.437) [-1144.961] (-1148.334) (-1147.107) -- 0:00:02 966500 -- (-1145.788) (-1143.565) (-1144.332) [-1145.639] * (-1144.155) [-1143.876] (-1144.314) (-1144.742) -- 0:00:02 967000 -- (-1146.193) (-1143.336) [-1144.631] (-1146.186) * (-1143.256) (-1147.482) [-1143.748] (-1150.334) -- 0:00:02 967500 -- [-1147.057] (-1146.568) (-1144.419) (-1149.085) * (-1143.406) (-1144.122) [-1144.172] (-1143.427) -- 0:00:02 968000 -- (-1144.727) [-1145.156] (-1142.539) (-1145.569) * (-1145.997) (-1143.104) [-1144.002] (-1144.681) -- 0:00:01 968500 -- [-1142.361] (-1146.516) (-1142.522) (-1144.155) * [-1146.199] (-1145.594) (-1146.179) (-1144.555) -- 0:00:01 969000 -- (-1145.497) (-1149.109) (-1143.412) [-1145.551] * (-1153.149) (-1143.889) (-1145.333) [-1143.036] -- 0:00:01 969500 -- [-1144.973] (-1145.022) (-1142.648) (-1143.435) * (-1149.231) (-1145.249) [-1144.577] (-1144.051) -- 0:00:01 970000 -- (-1146.415) (-1143.296) [-1146.354] (-1149.421) * (-1142.878) [-1143.662] (-1146.158) (-1143.572) -- 0:00:01 Average standard deviation of split frequencies: 0.004177 970500 -- (-1144.449) (-1143.094) [-1142.875] (-1148.011) * (-1144.709) [-1143.325] (-1145.504) (-1143.222) -- 0:00:01 971000 -- [-1143.227] (-1145.367) (-1145.312) (-1143.687) * [-1142.604] (-1145.556) (-1142.880) (-1143.138) -- 0:00:01 971500 -- [-1144.574] (-1143.230) (-1146.142) (-1143.399) * (-1144.211) [-1144.636] (-1144.808) (-1144.187) -- 0:00:01 972000 -- [-1142.709] (-1143.660) (-1142.581) (-1143.353) * (-1145.906) (-1144.108) (-1148.166) [-1144.620] -- 0:00:01 972500 -- (-1146.041) (-1149.144) (-1145.408) [-1146.588] * (-1144.743) (-1145.773) [-1143.678] (-1142.935) -- 0:00:01 973000 -- (-1146.005) (-1149.023) (-1144.223) [-1145.962] * (-1145.960) [-1145.782] (-1145.129) (-1142.857) -- 0:00:01 973500 -- (-1146.618) [-1145.785] (-1143.447) (-1146.157) * (-1147.732) [-1144.827] (-1146.365) (-1145.043) -- 0:00:01 974000 -- (-1143.037) (-1152.925) [-1144.122] (-1145.294) * (-1147.687) (-1149.686) (-1148.309) [-1142.553] -- 0:00:01 974500 -- (-1144.801) (-1144.882) [-1143.828] (-1145.254) * (-1144.498) (-1146.087) (-1146.490) [-1142.695] -- 0:00:01 975000 -- (-1143.781) (-1147.758) (-1143.970) [-1144.438] * [-1145.435] (-1145.470) (-1143.903) (-1144.081) -- 0:00:01 Average standard deviation of split frequencies: 0.004508 975500 -- (-1146.494) [-1147.687] (-1144.511) (-1143.910) * (-1150.946) (-1146.157) [-1145.130] (-1145.082) -- 0:00:01 976000 -- (-1144.160) [-1146.444] (-1143.297) (-1144.865) * [-1145.039] (-1145.948) (-1146.174) (-1143.025) -- 0:00:01 976500 -- (-1143.798) (-1144.177) (-1143.274) [-1146.883] * [-1147.121] (-1148.845) (-1144.519) (-1144.714) -- 0:00:01 977000 -- [-1148.159] (-1144.182) (-1143.621) (-1145.594) * [-1147.071] (-1145.432) (-1145.331) (-1144.193) -- 0:00:01 977500 -- (-1146.955) [-1145.975] (-1144.460) (-1146.933) * [-1143.587] (-1146.377) (-1143.654) (-1144.178) -- 0:00:01 978000 -- (-1147.341) (-1145.539) [-1143.860] (-1142.988) * (-1143.394) [-1144.688] (-1143.794) (-1143.910) -- 0:00:01 978500 -- (-1145.537) (-1148.600) [-1143.096] (-1144.742) * (-1145.890) (-1145.299) [-1145.507] (-1143.976) -- 0:00:01 979000 -- (-1146.428) (-1143.607) (-1144.084) [-1148.889] * (-1145.331) (-1143.155) [-1143.761] (-1146.486) -- 0:00:01 979500 -- (-1143.742) [-1143.734] (-1146.303) (-1145.480) * [-1144.642] (-1142.802) (-1143.587) (-1147.565) -- 0:00:01 980000 -- [-1145.580] (-1145.275) (-1145.003) (-1142.877) * (-1148.626) [-1142.890] (-1143.475) (-1146.786) -- 0:00:01 Average standard deviation of split frequencies: 0.004679 980500 -- (-1142.369) (-1143.576) [-1144.811] (-1146.406) * (-1147.327) (-1145.543) [-1143.690] (-1150.374) -- 0:00:01 981000 -- (-1144.013) (-1143.939) (-1144.563) [-1143.913] * [-1145.523] (-1145.478) (-1143.629) (-1143.921) -- 0:00:01 981500 -- [-1145.311] (-1145.197) (-1144.636) (-1150.442) * [-1146.203] (-1145.796) (-1152.413) (-1148.939) -- 0:00:01 982000 -- (-1152.773) (-1144.068) [-1144.236] (-1146.756) * (-1146.560) (-1143.237) [-1145.350] (-1145.334) -- 0:00:01 982500 -- [-1143.839] (-1147.161) (-1143.509) (-1145.073) * (-1145.024) [-1144.163] (-1143.162) (-1145.594) -- 0:00:01 983000 -- [-1145.888] (-1145.552) (-1145.008) (-1143.962) * (-1143.486) (-1146.936) [-1147.161] (-1143.970) -- 0:00:01 983500 -- [-1144.226] (-1143.788) (-1146.909) (-1147.286) * (-1143.386) (-1143.498) [-1147.726] (-1143.228) -- 0:00:01 984000 -- (-1144.146) (-1144.159) [-1144.288] (-1143.566) * [-1145.691] (-1143.656) (-1144.478) (-1144.833) -- 0:00:00 984500 -- [-1148.261] (-1144.234) (-1145.089) (-1143.579) * [-1148.242] (-1144.459) (-1148.431) (-1144.155) -- 0:00:00 985000 -- (-1143.752) (-1142.714) (-1145.090) [-1142.742] * (-1146.056) [-1143.782] (-1147.523) (-1144.586) -- 0:00:00 Average standard deviation of split frequencies: 0.004940 985500 -- (-1144.097) [-1144.325] (-1143.502) (-1143.216) * [-1146.708] (-1143.742) (-1143.979) (-1145.555) -- 0:00:00 986000 -- (-1144.906) [-1149.059] (-1143.156) (-1143.425) * (-1146.489) [-1143.950] (-1143.406) (-1145.455) -- 0:00:00 986500 -- (-1143.627) [-1145.476] (-1143.319) (-1143.742) * (-1143.623) (-1148.630) (-1143.553) [-1146.779] -- 0:00:00 987000 -- (-1145.664) (-1145.318) [-1150.044] (-1144.552) * (-1146.371) [-1143.355] (-1142.708) (-1144.503) -- 0:00:00 987500 -- (-1145.925) [-1144.253] (-1145.719) (-1148.420) * (-1143.868) [-1143.220] (-1142.808) (-1144.764) -- 0:00:00 988000 -- [-1143.330] (-1143.867) (-1143.014) (-1147.341) * (-1143.486) (-1142.568) (-1144.285) [-1144.706] -- 0:00:00 988500 -- (-1143.376) (-1144.526) [-1145.026] (-1145.178) * (-1144.645) (-1143.735) (-1143.117) [-1143.303] -- 0:00:00 989000 -- (-1143.865) (-1149.322) (-1145.255) [-1144.479] * (-1144.723) [-1144.020] (-1144.744) (-1145.151) -- 0:00:00 989500 -- (-1144.680) (-1150.479) (-1145.835) [-1145.157] * (-1143.393) (-1144.686) (-1147.623) [-1145.187] -- 0:00:00 990000 -- (-1149.715) (-1144.964) (-1145.184) [-1148.202] * (-1147.860) (-1147.037) (-1149.526) [-1143.195] -- 0:00:00 Average standard deviation of split frequencies: 0.005044 990500 -- [-1145.330] (-1147.588) (-1143.966) (-1148.021) * [-1143.214] (-1144.371) (-1146.372) (-1145.580) -- 0:00:00 991000 -- (-1143.346) (-1147.463) (-1143.995) [-1143.807] * (-1143.906) [-1146.309] (-1147.010) (-1147.128) -- 0:00:00 991500 -- [-1146.884] (-1143.756) (-1143.607) (-1150.523) * (-1145.298) (-1142.662) [-1143.267] (-1144.236) -- 0:00:00 992000 -- [-1145.871] (-1147.663) (-1142.678) (-1146.470) * (-1143.983) (-1145.025) [-1143.931] (-1146.438) -- 0:00:00 992500 -- (-1155.262) (-1143.266) [-1142.678] (-1144.070) * (-1143.819) (-1146.390) [-1146.389] (-1147.945) -- 0:00:00 993000 -- (-1147.772) [-1145.547] (-1144.354) (-1148.495) * (-1143.277) (-1145.882) (-1144.929) [-1143.474] -- 0:00:00 993500 -- (-1149.310) (-1143.720) [-1143.965] (-1145.528) * [-1145.704] (-1148.757) (-1145.692) (-1147.164) -- 0:00:00 994000 -- (-1145.796) (-1143.183) [-1142.967] (-1144.651) * (-1143.503) [-1145.941] (-1143.321) (-1143.332) -- 0:00:00 994500 -- (-1145.190) (-1143.455) (-1146.452) [-1147.652] * (-1142.843) (-1146.417) [-1145.260] (-1144.338) -- 0:00:00 995000 -- [-1146.792] (-1146.813) (-1149.711) (-1144.765) * [-1144.512] (-1144.417) (-1145.617) (-1150.854) -- 0:00:00 Average standard deviation of split frequencies: 0.005080 995500 -- (-1145.759) [-1147.965] (-1144.800) (-1143.658) * (-1147.999) (-1143.009) [-1148.372] (-1143.964) -- 0:00:00 996000 -- (-1147.675) [-1144.002] (-1145.799) (-1143.109) * (-1144.132) (-1143.200) [-1144.472] (-1147.710) -- 0:00:00 996500 -- (-1146.947) (-1143.030) (-1144.899) [-1143.537] * [-1146.693] (-1145.980) (-1144.200) (-1150.304) -- 0:00:00 997000 -- (-1147.981) (-1142.813) [-1144.899] (-1143.998) * (-1146.144) (-1145.326) (-1145.874) [-1144.477] -- 0:00:00 997500 -- (-1143.813) (-1145.272) (-1142.903) [-1143.315] * (-1147.187) [-1145.176] (-1145.980) (-1142.976) -- 0:00:00 998000 -- (-1144.973) (-1144.547) (-1145.260) [-1145.262] * (-1144.049) (-1147.007) [-1142.786] (-1146.692) -- 0:00:00 998500 -- (-1144.297) (-1143.738) (-1149.886) [-1144.261] * [-1143.096] (-1146.520) (-1149.466) (-1149.260) -- 0:00:00 999000 -- (-1143.329) (-1144.775) (-1146.068) [-1145.945] * (-1142.996) (-1148.317) [-1143.314] (-1144.428) -- 0:00:00 999500 -- (-1147.066) (-1147.306) [-1143.288] (-1146.065) * [-1143.748] (-1145.966) (-1145.167) (-1142.907) -- 0:00:00 1000000 -- (-1146.697) (-1143.042) [-1143.793] (-1145.827) * (-1143.387) [-1143.981] (-1144.282) (-1146.582) -- 0:00:00 Average standard deviation of split frequencies: 0.004994 Analysis completed in 1 mins 2 seconds Analysis used 60.64 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1142.19 Likelihood of best state for "cold" chain of run 2 was -1142.19 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.2 % ( 76 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.8 % ( 27 %) Dirichlet(Pi{all}) 28.3 % ( 26 %) Slider(Pi{all}) 78.9 % ( 57 %) Multiplier(Alpha{1,2}) 77.8 % ( 52 %) Multiplier(Alpha{3}) 18.8 % ( 19 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 66 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 17 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.5 % ( 25 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 74.5 % ( 74 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.5 % ( 16 %) Dirichlet(Pi{all}) 28.1 % ( 29 %) Slider(Pi{all}) 78.4 % ( 52 %) Multiplier(Alpha{1,2}) 77.4 % ( 57 %) Multiplier(Alpha{3}) 19.0 % ( 20 %) Slider(Pinvar{all}) 98.7 % ( 97 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 64 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 30 %) Multiplier(V{all}) 97.5 % ( 95 %) Nodeslider(V{all}) 30.4 % ( 28 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166812 0.82 0.67 3 | 166664 165836 0.83 4 | 167678 167066 165944 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166412 0.82 0.67 3 | 166073 166905 0.84 4 | 166704 167123 166783 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1143.84 | 2 | | 11 | | 2 2 | | 2 1 1 2 2 2 | | 2 1 2 2 2 1 2 1 1 | | 1 1 122 2 1 22 1 1 2| | 2 2 2 2 2 112*11 21 1 1 | | 1 111 12 21 * 1 2 2 21 1 1 | | 2 2 2 12 1 1122 2 2 1 1 2 2 2 | |1 1 1 1 21 1 2 2 1 22 2 1 1| | 21 2 1 21 2 | |2 2 211 2 2 | | 1 1 1 2 | | 1 1 | | 2 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1145.65 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1144.01 -1146.72 2 -1143.93 -1147.03 -------------------------------------- TOTAL -1143.97 -1146.89 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899047 0.089970 0.342036 1.487773 0.862575 1148.66 1211.04 1.000 r(A<->C){all} 0.169640 0.020983 0.000014 0.459405 0.130400 214.95 247.93 1.000 r(A<->G){all} 0.156218 0.018326 0.000016 0.430837 0.119282 160.32 181.81 1.003 r(A<->T){all} 0.174947 0.022846 0.000115 0.496691 0.131980 208.15 223.75 1.000 r(C<->G){all} 0.163106 0.020089 0.000043 0.456254 0.121585 273.14 334.84 1.003 r(C<->T){all} 0.168777 0.020902 0.000188 0.463971 0.130177 192.49 200.85 1.001 r(G<->T){all} 0.167312 0.021542 0.000022 0.467902 0.125369 227.26 259.21 1.005 pi(A){all} 0.180566 0.000175 0.155033 0.206581 0.180140 1208.54 1246.34 1.000 pi(C){all} 0.316993 0.000276 0.285401 0.348775 0.316892 997.52 1202.43 1.002 pi(G){all} 0.315091 0.000248 0.286222 0.346614 0.315002 1188.27 1210.29 1.005 pi(T){all} 0.187351 0.000182 0.160792 0.213141 0.187520 1188.27 1244.70 1.000 alpha{1,2} 0.438962 0.240900 0.000151 1.461049 0.264462 1056.98 1121.78 1.000 alpha{3} 0.452460 0.217270 0.000145 1.386458 0.303426 1004.93 1148.21 1.000 pinvar{all} 0.998146 0.000005 0.994159 1.000000 0.998866 1189.84 1345.42 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .****. 8 -- ...**. 9 -- ..*..* 10 -- .*.*.. 11 -- .***.* 12 -- .*..*. 13 -- ..*.*. 14 -- .*...* 15 -- .*.*** 16 -- ...*.* 17 -- ..**** 18 -- ..**.. 19 -- .**.** 20 -- ....** 21 -- .**... ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 448 0.149234 0.008480 0.143238 0.155230 2 8 445 0.148235 0.003298 0.145903 0.150566 2 9 444 0.147901 0.001884 0.146569 0.149234 2 10 442 0.147235 0.003769 0.144570 0.149900 2 11 435 0.144903 0.001413 0.143904 0.145903 2 12 433 0.144237 0.007066 0.139241 0.149234 2 13 432 0.143904 0.011306 0.135909 0.151899 2 14 428 0.142572 0.002827 0.140573 0.144570 2 15 428 0.142572 0.002827 0.140573 0.144570 2 16 425 0.141572 0.002355 0.139907 0.143238 2 17 425 0.141572 0.012719 0.132578 0.150566 2 18 420 0.139907 0.004711 0.136576 0.143238 2 19 413 0.137575 0.008951 0.131246 0.143904 2 20 406 0.135243 0.001884 0.133911 0.136576 2 21 405 0.134910 0.001413 0.133911 0.135909 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.101997 0.010328 0.000100 0.315779 0.068936 1.000 2 length{all}[2] 0.096473 0.008938 0.000012 0.281066 0.068831 1.000 2 length{all}[3] 0.099537 0.009899 0.000038 0.306423 0.068133 1.000 2 length{all}[4] 0.095947 0.008964 0.000006 0.281369 0.068345 1.000 2 length{all}[5] 0.101830 0.011123 0.000067 0.310629 0.070166 1.000 2 length{all}[6] 0.103247 0.010875 0.000069 0.308197 0.071353 1.000 2 length{all}[7] 0.089658 0.009056 0.000075 0.316547 0.056711 0.998 2 length{all}[8] 0.099426 0.008961 0.000130 0.287789 0.069466 0.998 2 length{all}[9] 0.108567 0.014284 0.000330 0.314688 0.075636 0.999 2 length{all}[10] 0.101126 0.008657 0.000677 0.298607 0.077710 0.999 2 length{all}[11] 0.101865 0.009549 0.000084 0.297438 0.077132 0.999 2 length{all}[12] 0.105741 0.010444 0.000532 0.292127 0.076400 1.003 2 length{all}[13] 0.099783 0.009694 0.000177 0.291110 0.068019 0.998 2 length{all}[14] 0.097343 0.009125 0.000595 0.289266 0.066830 1.002 2 length{all}[15] 0.104887 0.012133 0.000043 0.354933 0.068097 0.999 2 length{all}[16] 0.100736 0.010614 0.001289 0.290237 0.067711 1.003 2 length{all}[17] 0.111794 0.012128 0.000278 0.307996 0.073771 0.998 2 length{all}[18] 0.099482 0.010236 0.000004 0.309796 0.069929 0.999 2 length{all}[19] 0.106154 0.011699 0.000493 0.322460 0.076380 0.998 2 length{all}[20] 0.100426 0.009555 0.000726 0.291612 0.071883 1.004 2 length{all}[21] 0.095042 0.009042 0.000414 0.294183 0.059839 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.004994 Maximum standard deviation of split frequencies = 0.012719 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.004 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /---------------------------------------------------------------------- C1 (1) | |--------------------------------------------------------------------- C2 (2) | |--------------------------------------------------------------------- C3 (3) + |--------------------------------------------------------------------- C4 (4) | |----------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 846 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 55 patterns at 282 / 282 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 55 patterns at 282 / 282 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 53680 bytes for conP 4840 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.024225 0.048804 0.048072 0.031655 0.010055 0.097612 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1167.404211 Iterating by ming2 Initial: fx= 1167.404211 x= 0.02423 0.04880 0.04807 0.03166 0.01005 0.09761 0.30000 1.30000 1 h-m-p 0.0000 0.0000 679.3363 ++ 1150.770182 m 0.0000 13 | 1/8 2 h-m-p 0.0005 0.0070 47.2138 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 620.5427 ++ 1131.140703 m 0.0001 44 | 2/8 4 h-m-p 0.0008 0.0095 35.9415 -----------.. | 2/8 5 h-m-p 0.0000 0.0000 555.8485 ++ 1122.876509 m 0.0000 75 | 3/8 6 h-m-p 0.0005 0.0132 26.7088 -----------.. | 3/8 7 h-m-p 0.0000 0.0001 481.2940 ++ 1109.130071 m 0.0001 106 | 4/8 8 h-m-p 0.0012 0.0195 18.9062 -----------.. | 4/8 9 h-m-p 0.0000 0.0000 393.5807 ++ 1108.721095 m 0.0000 137 | 5/8 10 h-m-p 0.0001 0.0294 12.5894 ---------.. | 5/8 11 h-m-p 0.0000 0.0002 277.0228 +++ 1095.006970 m 0.0002 167 | 6/8 12 h-m-p 1.6000 8.0000 0.0000 ++ 1095.006970 m 8.0000 178 | 6/8 13 h-m-p 0.1294 8.0000 0.0004 ----Y 1095.006970 0 0.0001 195 | 6/8 14 h-m-p 0.0160 8.0000 0.0000 +++++ 1095.006970 m 8.0000 211 | 6/8 15 h-m-p 0.0160 8.0000 0.1872 +++++ 1095.006959 m 8.0000 227 | 6/8 16 h-m-p 0.0023 0.0117 180.6703 ------------.. | 6/8 17 h-m-p 0.0160 8.0000 0.0000 Y 1095.006959 0 0.0040 261 | 6/8 18 h-m-p 0.0160 8.0000 0.0000 --C 1095.006959 0 0.0003 276 Out.. lnL = -1095.006959 277 lfun, 277 eigenQcodon, 1662 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.082398 0.040067 0.037811 0.098018 0.052915 0.040139 1.030949 0.768931 0.562572 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 7.222820 np = 9 lnL0 = -1192.409185 Iterating by ming2 Initial: fx= 1192.409185 x= 0.08240 0.04007 0.03781 0.09802 0.05292 0.04014 1.03095 0.76893 0.56257 1 h-m-p 0.0000 0.0001 672.0518 ++ 1129.947798 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0001 253.9314 ++ 1126.818279 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 2400.7356 ++ 1126.716398 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 20950.6771 ++ 1112.110488 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0000 5917.6462 ++ 1097.628898 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 2988.9265 ++ 1095.007003 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0005 ++ 1095.007003 m 8.0000 86 | 6/9 8 h-m-p 0.1408 4.9572 0.0283 -----------N 1095.007003 0 0.0000 112 | 6/9 9 h-m-p 0.0002 0.0812 11.1403 +++++ 1095.006981 m 0.0812 130 | 7/9 10 h-m-p 1.6000 8.0000 0.0000 C 1095.006981 0 0.4000 142 | 7/9 11 h-m-p 0.0160 8.0000 0.0000 Y 1095.006981 0 0.0160 156 | 7/9 12 h-m-p 0.0160 8.0000 0.0002 ---N 1095.006981 0 0.0001 173 Out.. lnL = -1095.006981 174 lfun, 522 eigenQcodon, 2088 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.085021 0.105365 0.099389 0.043526 0.087028 0.042213 1.007227 1.062227 0.487537 0.337717 2.678816 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.627668 np = 11 lnL0 = -1211.005360 Iterating by ming2 Initial: fx= 1211.005360 x= 0.08502 0.10537 0.09939 0.04353 0.08703 0.04221 1.00723 1.06223 0.48754 0.33772 2.67882 1 h-m-p 0.0000 0.0002 557.0041 +++ 1150.897151 m 0.0002 17 | 1/11 2 h-m-p 0.0000 0.0001 188.5885 ++ 1148.996415 m 0.0001 31 | 2/11 3 h-m-p 0.0000 0.0000 11108.8508 ++ 1104.575858 m 0.0000 45 | 3/11 4 h-m-p 0.0000 0.0000 676.2781 ++ 1102.903886 m 0.0000 59 | 4/11 5 h-m-p 0.0000 0.0001 1174.6298 ++ 1101.932699 m 0.0001 73 | 5/11 6 h-m-p 0.0015 0.0662 12.6717 -----------.. | 5/11 7 h-m-p 0.0000 0.0000 385.5354 ++ 1096.485889 m 0.0000 110 | 6/11 8 h-m-p 0.0038 1.9164 2.6626 ------------.. | 6/11 9 h-m-p 0.0000 0.0000 278.4826 ++ 1095.006988 m 0.0000 148 | 7/11 10 h-m-p 0.0160 8.0000 0.0000 +++++ 1095.006988 m 8.0000 165 | 7/11 11 h-m-p 0.0160 8.0000 0.0290 +++++ 1095.006985 m 8.0000 186 | 7/11 12 h-m-p 0.2253 6.7037 1.0297 +++ 1095.006978 m 6.7037 205 | 7/11 13 h-m-p -0.0000 -0.0000 0.3855 h-m-p: -0.00000000e+00 -0.00000000e+00 3.85530519e-01 1095.006978 .. | 7/11 14 h-m-p 0.0160 8.0000 0.0000 ------------- | 7/11 15 h-m-p 0.0160 8.0000 0.0000 ------------- Out.. lnL = -1095.006978 275 lfun, 1100 eigenQcodon, 4950 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1095.014493 S = -1095.002195 -0.004707 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:03 did 20 / 55 patterns 0:03 did 30 / 55 patterns 0:03 did 40 / 55 patterns 0:03 did 50 / 55 patterns 0:03 did 55 / 55 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.073191 0.050662 0.071475 0.099190 0.092207 0.099712 0.608302 1.097643 1.322177 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 10.622807 np = 9 lnL0 = -1226.137584 Iterating by ming2 Initial: fx= 1226.137584 x= 0.07319 0.05066 0.07147 0.09919 0.09221 0.09971 0.60830 1.09764 1.32218 1 h-m-p 0.0000 0.0002 634.1155 +++ 1145.973087 m 0.0002 24 | 1/9 2 h-m-p 0.0019 0.0137 58.5653 ++ 1118.227606 m 0.0137 45 | 2/9 3 h-m-p 0.0000 0.0000 5186.3159 ++ 1116.847613 m 0.0000 65 | 3/9 4 h-m-p 0.0000 0.0000 109158.6578 ++ 1108.246697 m 0.0000 84 | 4/9 5 h-m-p 0.0001 0.0007 56.6025 ++ 1106.215895 m 0.0007 102 | 5/9 6 h-m-p 0.0000 0.0000 143.2950 ++ 1105.089288 m 0.0000 119 | 6/9 7 h-m-p 0.0001 0.0132 20.2613 ++++ 1103.263923 m 0.0132 137 | 7/9 8 h-m-p 0.0060 0.0302 1.1667 ++ 1095.007008 m 0.0302 152 | 8/9 9 h-m-p 1.6000 8.0000 0.0000 Y 1095.007008 0 1.6000 166 | 8/9 10 h-m-p 0.0160 8.0000 3.5425 ------Y 1095.007008 0 0.0000 185 | 8/9 11 h-m-p 0.0160 8.0000 3.5426 --------Y 1095.007008 0 0.0000 206 | 8/9 12 h-m-p 0.3333 8.0000 0.0000 Y 1095.007008 0 0.3333 219 | 8/9 13 h-m-p 0.5000 8.0000 0.0000 -----N 1095.007008 0 0.0001 237 Out.. lnL = -1095.007008 238 lfun, 2618 eigenQcodon, 14280 P(t) Time used: 0:07 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.057059 0.036173 0.058541 0.070815 0.108493 0.037560 0.000100 0.900000 0.363669 1.427428 2.607586 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 14.053402 np = 11 lnL0 = -1181.263528 Iterating by ming2 Initial: fx= 1181.263528 x= 0.05706 0.03617 0.05854 0.07081 0.10849 0.03756 0.00011 0.90000 0.36367 1.42743 2.60759 1 h-m-p 0.0000 0.0000 500.1616 ++ 1180.910951 m 0.0000 27 | 1/11 2 h-m-p 0.0000 0.0001 975.5434 ++ 1133.541381 m 0.0001 52 | 2/11 3 h-m-p 0.0000 0.0000 1550.4787 ++ 1131.891053 m 0.0000 76 | 3/11 4 h-m-p 0.0001 0.0069 54.0635 ++++ 1114.248945 m 0.0069 101 | 4/11 5 h-m-p 0.0002 0.0008 41.9319 ++ 1113.459533 m 0.0008 123 | 5/11 6 h-m-p 0.0000 0.0002 727.8231 ++ 1097.924450 m 0.0002 144 | 6/11 7 h-m-p 0.0000 0.0001 2847.6455 ++ 1096.548226 m 0.0001 164 | 7/11 8 h-m-p 0.0003 0.0015 426.3161 ++ 1095.676525 m 0.0015 183 | 7/11 9 h-m-p 0.0000 0.0000 1776.7498 h-m-p: 0.00000000e+00 0.00000000e+00 1.77674981e+03 1095.676525 .. | 7/11 10 h-m-p 0.0000 0.0000 280.5468 ++ 1095.007008 m 0.0000 216 | 8/11 11 h-m-p 1.6000 8.0000 0.0000 ++ 1095.007008 m 8.0000 234 | 7/11 12 h-m-p 0.0001 0.0677 19.2104 +++++ 1095.006967 m 0.0677 254 | 8/11 13 h-m-p 0.2001 1.0004 0.8313 ++ 1095.006965 m 1.0004 272 QuantileBeta(0.15, 0.00494, 1.01172) = 3.971924e-162 2000 rounds | 8/11 14 h-m-p -0.0000 -0.0000 0.9752 h-m-p: -0.00000000e+00 -0.00000000e+00 9.75228770e-01 1095.006965 .. QuantileBeta(0.15, 0.00494, 1.01172) = 3.971924e-162 2000 rounds | 8/11 15 h-m-p 0.0160 8.0000 0.0000 --------C 1095.006965 0 0.0000 311 Out.. lnL = -1095.006965 312 lfun, 3744 eigenQcodon, 20592 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1095.010274 S = -1095.001282 -0.003943 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:12 did 20 / 55 patterns 0:12 did 30 / 55 patterns 0:13 did 40 / 55 patterns 0:13 did 50 / 55 patterns 0:13 did 55 / 55 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=282 NC_011896_1_WP_010907869_1_703_MLBR_RS03335 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV NC_002677_1_NP_301545_1_417_folD VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV ************************************************** NC_011896_1_WP_010907869_1_703_MLBR_RS03335 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL NC_002677_1_NP_301545_1_417_folD RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL ************************************************** NC_011896_1_WP_010907869_1_703_MLBR_RS03335 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR NC_002677_1_NP_301545_1_417_folD PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR ************************************************** NC_011896_1_WP_010907869_1_703_MLBR_RS03335 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL NC_002677_1_NP_301545_1_417_folD RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL ************************************************** NC_011896_1_WP_010907869_1_703_MLBR_RS03335 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE NC_002677_1_NP_301545_1_417_folD TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE ************************************************** NC_011896_1_WP_010907869_1_703_MLBR_RS03335 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ NC_002677_1_NP_301545_1_417_folD VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ ********************************
>NC_011896_1_WP_010907869_1_703_MLBR_RS03335 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >NC_002677_1_NP_301545_1_417_folD GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG >NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 GTGGGTGCAATCACGCTGGACGGCAAGGCCACCCGAGACGAGATCCTGAT CGACCTCAAGCAACGCGTGGCCGCATTAACCGAATCCGGTCGCACGCCCG GACTGGGTACCATCCTGGTCGGTGACGACCCCGGATCACATGCCTATGTT CGTGGCAAGCACGCCGACTGTGCGAAGGTGGGCATCACATCGATTCGCCG CGACTTGCCCGTCGACATCACAACGGCCGTGCTGCATGACACCATCGAGG AACTGAATGCCAACCCCGACTGCACCGGCTATATCGTGCAGTTGCCGTTA CCCAAGTACCTGGACGAGAACACGGCGCTGGAGCGTGTCGACCCGGCCAA GGATGCCGACGGCCTGCACCCGACGAACCTCGGCCGGCTAGTGCTGTCCA CCCCGGCGCCGCTGCCGTGTACCGCGCGTGGCATTTTGCACCTGCTACGG CGTTACGGCGTCGAGATCGCCGGAACACACGTCGTCATCATCGGGCGCGG TGTTACGGTTGGTCGCCCGTTGGGGCTGCTGCTGACACGCCGTTCCGAGA ACGCCACGGTGACTTTGTGCCACACAGGAACGCGCAATCTGGCAGCGCTA ACCAAGCAGGCTGACATCATTGTAGCCGCCGTCGGTGTTCCACATCTGCT GACCGCGGATATGGTGCGTCCCGGAGCTGTGGTGGTCGACGTCGGTGTCA GCCGGGTCGAGACTAGGCTCGTCGGCGACGTGCATCCGGATGTCTGGGAA GTCGCCGGTCACGTCTCACCGAATCCTGGTGGCGTTGGTCCGCTTACCCG GGTGTTTCTGCTGACCAACGTTGTCGAATTGGCCGAGGGACGGCAG
>NC_011896_1_WP_010907869_1_703_MLBR_RS03335 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >NC_002677_1_NP_301545_1_417_folD VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ >NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 VGAITLDGKATRDEILIDLKQRVAALTESGRTPGLGTILVGDDPGSHAYV RGKHADCAKVGITSIRRDLPVDITTAVLHDTIEELNANPDCTGYIVQLPL PKYLDENTALERVDPAKDADGLHPTNLGRLVLSTPAPLPCTARGILHLLR RYGVEIAGTHVVIIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRNLAAL TKQADIIVAAVGVPHLLTADMVRPGAVVVDVGVSRVETRLVGDVHPDVWE VAGHVSPNPGGVGPLTRVFLLTNVVELAEGRQ
#NEXUS [ID: 0415189034] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907869_1_703_MLBR_RS03335 NC_002677_1_NP_301545_1_417_folD NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 ; end; begin trees; translate 1 NC_011896_1_WP_010907869_1_703_MLBR_RS03335, 2 NC_002677_1_NP_301545_1_417_folD, 3 NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435, 4 NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380, 5 NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675, 6 NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06893631,2:0.06883129,3:0.0681331,4:0.06834518,5:0.07016601,6:0.0713533); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06893631,2:0.06883129,3:0.0681331,4:0.06834518,5:0.07016601,6:0.0713533); end;
Estimated marginal likelihoods for runs sampled in files "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1144.01 -1146.72 2 -1143.93 -1147.03 -------------------------------------- TOTAL -1143.97 -1146.89 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/folD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899047 0.089970 0.342036 1.487773 0.862575 1148.66 1211.04 1.000 r(A<->C){all} 0.169640 0.020983 0.000014 0.459405 0.130400 214.95 247.93 1.000 r(A<->G){all} 0.156218 0.018326 0.000016 0.430837 0.119282 160.32 181.81 1.003 r(A<->T){all} 0.174947 0.022846 0.000115 0.496691 0.131980 208.15 223.75 1.000 r(C<->G){all} 0.163106 0.020089 0.000043 0.456254 0.121585 273.14 334.84 1.003 r(C<->T){all} 0.168777 0.020902 0.000188 0.463971 0.130177 192.49 200.85 1.001 r(G<->T){all} 0.167312 0.021542 0.000022 0.467902 0.125369 227.26 259.21 1.005 pi(A){all} 0.180566 0.000175 0.155033 0.206581 0.180140 1208.54 1246.34 1.000 pi(C){all} 0.316993 0.000276 0.285401 0.348775 0.316892 997.52 1202.43 1.002 pi(G){all} 0.315091 0.000248 0.286222 0.346614 0.315002 1188.27 1210.29 1.005 pi(T){all} 0.187351 0.000182 0.160792 0.213141 0.187520 1188.27 1244.70 1.000 alpha{1,2} 0.438962 0.240900 0.000151 1.461049 0.264462 1056.98 1121.78 1.000 alpha{3} 0.452460 0.217270 0.000145 1.386458 0.303426 1004.93 1148.21 1.000 pinvar{all} 0.998146 0.000005 0.994159 1.000000 0.998866 1189.84 1345.42 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/folD/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 282 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 2 2 2 2 2 2 TTC 0 0 0 0 0 0 | TCC 3 3 3 3 3 3 | TAC 2 2 2 2 2 2 | TGC 2 2 2 2 2 2 Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 6 6 6 6 6 6 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 4 4 4 4 4 4 | Arg CGT 6 6 6 6 6 6 CTC 3 3 3 3 3 3 | CCC 6 6 6 6 6 6 | CAC 6 6 6 6 6 6 | CGC 8 8 8 8 8 8 CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1 CTG 20 20 20 20 20 20 | CCG 10 10 10 10 10 10 | CAG 3 3 3 3 3 3 | CGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0 ATC 12 12 12 12 12 12 | ACC 11 11 11 11 11 11 | AAC 5 5 5 5 5 5 | AGC 1 1 1 1 1 1 ATA 0 0 0 0 0 0 | ACA 5 5 5 5 5 5 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0 Met ATG 1 1 1 1 1 1 | ACG 8 8 8 8 8 8 | AAG 7 7 7 7 7 7 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 6 6 6 6 6 6 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 11 11 11 11 11 11 GTC 16 16 16 16 16 16 | GCC 14 14 14 14 14 14 | GAC 16 16 16 16 16 16 | GGC 10 10 10 10 10 10 GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 4 4 4 4 4 4 | GGA 6 6 6 6 6 6 GTG 12 12 12 12 12 12 | GCG 6 6 6 6 6 6 | GAG 8 8 8 8 8 8 | GGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907869_1_703_MLBR_RS03335 position 1: T:0.08511 C:0.28014 A:0.20922 G:0.42553 position 2: T:0.30851 C:0.26596 A:0.22695 G:0.19858 position 3: T:0.16667 C:0.40780 A:0.10284 G:0.32270 Average T:0.18676 C:0.31797 A:0.17967 G:0.31560 #2: NC_002677_1_NP_301545_1_417_folD position 1: T:0.08511 C:0.28014 A:0.20922 G:0.42553 position 2: T:0.30851 C:0.26596 A:0.22695 G:0.19858 position 3: T:0.16667 C:0.40780 A:0.10284 G:0.32270 Average T:0.18676 C:0.31797 A:0.17967 G:0.31560 #3: NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435 position 1: T:0.08511 C:0.28014 A:0.20922 G:0.42553 position 2: T:0.30851 C:0.26596 A:0.22695 G:0.19858 position 3: T:0.16667 C:0.40780 A:0.10284 G:0.32270 Average T:0.18676 C:0.31797 A:0.17967 G:0.31560 #4: NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380 position 1: T:0.08511 C:0.28014 A:0.20922 G:0.42553 position 2: T:0.30851 C:0.26596 A:0.22695 G:0.19858 position 3: T:0.16667 C:0.40780 A:0.10284 G:0.32270 Average T:0.18676 C:0.31797 A:0.17967 G:0.31560 #5: NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675 position 1: T:0.08511 C:0.28014 A:0.20922 G:0.42553 position 2: T:0.30851 C:0.26596 A:0.22695 G:0.19858 position 3: T:0.16667 C:0.40780 A:0.10284 G:0.32270 Average T:0.18676 C:0.31797 A:0.17967 G:0.31560 #6: NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750 position 1: T:0.08511 C:0.28014 A:0.20922 G:0.42553 position 2: T:0.30851 C:0.26596 A:0.22695 G:0.19858 position 3: T:0.16667 C:0.40780 A:0.10284 G:0.32270 Average T:0.18676 C:0.31797 A:0.17967 G:0.31560 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 12 TTC 0 | TCC 18 | TAC 12 | TGC 12 Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 36 | TCG 6 | TAG 0 | Trp W TGG 6 ------------------------------------------------------------------------------ Leu L CTT 6 | Pro P CCT 6 | His H CAT 24 | Arg R CGT 36 CTC 18 | CCC 36 | CAC 36 | CGC 48 CTA 18 | CCA 6 | Gln Q CAA 6 | CGA 6 CTG 120 | CCG 60 | CAG 18 | CGG 30 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 12 | Asn N AAT 18 | Ser S AGT 0 ATC 72 | ACC 66 | AAC 30 | AGC 6 ATA 0 | ACA 30 | Lys K AAA 0 | Arg R AGA 0 Met M ATG 6 | ACG 48 | AAG 42 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 36 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 66 GTC 96 | GCC 84 | GAC 96 | GGC 60 GTA 6 | GCA 18 | Glu E GAA 24 | GGA 36 GTG 72 | GCG 36 | GAG 48 | GGG 12 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.08511 C:0.28014 A:0.20922 G:0.42553 position 2: T:0.30851 C:0.26596 A:0.22695 G:0.19858 position 3: T:0.16667 C:0.40780 A:0.10284 G:0.32270 Average T:0.18676 C:0.31797 A:0.17967 G:0.31560 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1095.006959 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.030949 2.607586 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907869_1_703_MLBR_RS03335: 0.000004, NC_002677_1_NP_301545_1_417_folD: 0.000004, NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435: 0.000004, NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380: 0.000004, NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675: 0.000004, NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 1.03095 omega (dN/dS) = 2.60759 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 632.8 213.2 2.6076 0.0000 0.0000 0.0 0.0 7..2 0.000 632.8 213.2 2.6076 0.0000 0.0000 0.0 0.0 7..3 0.000 632.8 213.2 2.6076 0.0000 0.0000 0.0 0.0 7..4 0.000 632.8 213.2 2.6076 0.0000 0.0000 0.0 0.0 7..5 0.000 632.8 213.2 2.6076 0.0000 0.0000 0.0 0.0 7..6 0.000 632.8 213.2 2.6076 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1095.006981 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.007227 0.817195 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907869_1_703_MLBR_RS03335: 0.000004, NC_002677_1_NP_301545_1_417_folD: 0.000004, NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435: 0.000004, NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380: 0.000004, NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675: 0.000004, NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 1.00723 MLEs of dN/dS (w) for site classes (K=2) p: 0.81719 0.18281 w: 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 633.0 213.0 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 633.0 213.0 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 633.0 213.0 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 633.0 213.0 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 633.0 213.0 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 633.0 213.0 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 check convergence.. lnL(ntime: 6 np: 11): -1095.006978 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.608302 0.000141 0.983464 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907869_1_703_MLBR_RS03335: 0.000004, NC_002677_1_NP_301545_1_417_folD: 0.000004, NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435: 0.000004, NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380: 0.000004, NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675: 0.000004, NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.60830 MLEs of dN/dS (w) for site classes (K=3) p: 0.00014 0.98346 0.01639 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 636.8 209.2 0.9999 0.0000 0.0000 0.0 0.0 7..2 0.000 636.8 209.2 0.9999 0.0000 0.0000 0.0 0.0 7..3 0.000 636.8 209.2 0.9999 0.0000 0.0000 0.0 0.0 7..4 0.000 636.8 209.2 0.9999 0.0000 0.0000 0.0 0.0 7..5 0.000 636.8 209.2 0.9999 0.0000 0.0000 0.0 0.0 7..6 0.000 636.8 209.2 0.9999 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907869_1_703_MLBR_RS03335) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1095.007008 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.373518 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907869_1_703_MLBR_RS03335: 0.000004, NC_002677_1_NP_301545_1_417_folD: 0.000004, NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435: 0.000004, NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380: 0.000004, NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675: 0.000004, NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.37352 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 645.2 200.8 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 645.2 200.8 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 645.2 200.8 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 645.2 200.8 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 645.2 200.8 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 645.2 200.8 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:07 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1095.006965 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.011716 2.067830 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907869_1_703_MLBR_RS03335: 0.000004, NC_002677_1_NP_301545_1_417_folD: 0.000004, NZ_LVXE01000001_1_WP_010907869_1_89_A3216_RS00435: 0.000004, NZ_LYPH01000001_1_WP_010907869_1_77_A8144_RS00380: 0.000004, NZ_CP029543_1_WP_010907869_1_721_DIJ64_RS03675: 0.000004, NZ_AP014567_1_WP_010907869_1_736_JK2ML_RS03750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 0.00500 q = 1.01172 (p1 = 0.99999) w = 2.06783 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 2.06783 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 645.2 200.8 2.0678 0.0000 0.0000 0.0 0.0 7..2 0.000 645.2 200.8 2.0678 0.0000 0.0000 0.0 0.0 7..3 0.000 645.2 200.8 2.0678 0.0000 0.0000 0.0 0.0 7..4 0.000 645.2 200.8 2.0678 0.0000 0.0000 0.0 0.0 7..5 0.000 645.2 200.8 2.0678 0.0000 0.0000 0.0 0.0 7..6 0.000 645.2 200.8 2.0678 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907869_1_703_MLBR_RS03335) Pr(w>1) post mean +- SE for w 1 V 1.000** 2.068 2 G 1.000** 2.068 3 A 1.000** 2.068 4 I 1.000** 2.068 5 T 1.000** 2.068 6 L 1.000** 2.068 7 D 1.000** 2.068 8 G 1.000** 2.068 9 K 1.000** 2.068 10 A 1.000** 2.068 11 T 1.000** 2.068 12 R 1.000** 2.068 13 D 1.000** 2.068 14 E 1.000** 2.068 15 I 1.000** 2.068 16 L 1.000** 2.068 17 I 1.000** 2.068 18 D 1.000** 2.068 19 L 1.000** 2.068 20 K 1.000** 2.068 21 Q 1.000** 2.068 22 R 1.000** 2.068 23 V 1.000** 2.068 24 A 1.000** 2.068 25 A 1.000** 2.068 26 L 1.000** 2.068 27 T 1.000** 2.068 28 E 1.000** 2.068 29 S 1.000** 2.068 30 G 1.000** 2.068 31 R 1.000** 2.068 32 T 1.000** 2.068 33 P 1.000** 2.068 34 G 1.000** 2.068 35 L 1.000** 2.068 36 G 1.000** 2.068 37 T 1.000** 2.068 38 I 1.000** 2.068 39 L 1.000** 2.068 40 V 1.000** 2.068 41 G 1.000** 2.068 42 D 1.000** 2.068 43 D 1.000** 2.068 44 P 1.000** 2.068 45 G 1.000** 2.068 46 S 1.000** 2.068 47 H 1.000** 2.068 48 A 1.000** 2.068 49 Y 1.000** 2.068 50 V 1.000** 2.068 51 R 1.000** 2.068 52 G 1.000** 2.068 53 K 1.000** 2.068 54 H 1.000** 2.068 55 A 1.000** 2.068 56 D 1.000** 2.068 57 C 1.000** 2.068 58 A 1.000** 2.068 59 K 1.000** 2.068 60 V 1.000** 2.068 61 G 1.000** 2.068 62 I 1.000** 2.068 63 T 1.000** 2.068 64 S 1.000** 2.068 65 I 1.000** 2.068 66 R 1.000** 2.068 67 R 1.000** 2.068 68 D 1.000** 2.068 69 L 1.000** 2.068 70 P 1.000** 2.068 71 V 1.000** 2.068 72 D 1.000** 2.068 73 I 1.000** 2.068 74 T 1.000** 2.068 75 T 1.000** 2.068 76 A 1.000** 2.068 77 V 1.000** 2.068 78 L 1.000** 2.068 79 H 1.000** 2.068 80 D 1.000** 2.068 81 T 1.000** 2.068 82 I 1.000** 2.068 83 E 1.000** 2.068 84 E 1.000** 2.068 85 L 1.000** 2.068 86 N 1.000** 2.068 87 A 1.000** 2.068 88 N 1.000** 2.068 89 P 1.000** 2.068 90 D 1.000** 2.068 91 C 1.000** 2.068 92 T 1.000** 2.068 93 G 1.000** 2.068 94 Y 1.000** 2.068 95 I 1.000** 2.068 96 V 1.000** 2.068 97 Q 1.000** 2.068 98 L 1.000** 2.068 99 P 1.000** 2.068 100 L 1.000** 2.068 101 P 1.000** 2.068 102 K 1.000** 2.068 103 Y 1.000** 2.068 104 L 1.000** 2.068 105 D 1.000** 2.068 106 E 1.000** 2.068 107 N 1.000** 2.068 108 T 1.000** 2.068 109 A 1.000** 2.068 110 L 1.000** 2.068 111 E 1.000** 2.068 112 R 1.000** 2.068 113 V 1.000** 2.068 114 D 1.000** 2.068 115 P 1.000** 2.068 116 A 1.000** 2.068 117 K 1.000** 2.068 118 D 1.000** 2.068 119 A 1.000** 2.068 120 D 1.000** 2.068 121 G 1.000** 2.068 122 L 1.000** 2.068 123 H 1.000** 2.068 124 P 1.000** 2.068 125 T 1.000** 2.068 126 N 1.000** 2.068 127 L 1.000** 2.068 128 G 1.000** 2.068 129 R 1.000** 2.068 130 L 1.000** 2.068 131 V 1.000** 2.068 132 L 1.000** 2.068 133 S 1.000** 2.068 134 T 1.000** 2.068 135 P 1.000** 2.068 136 A 1.000** 2.068 137 P 1.000** 2.068 138 L 1.000** 2.068 139 P 1.000** 2.068 140 C 1.000** 2.068 141 T 1.000** 2.068 142 A 1.000** 2.068 143 R 1.000** 2.068 144 G 1.000** 2.068 145 I 1.000** 2.068 146 L 1.000** 2.068 147 H 1.000** 2.068 148 L 1.000** 2.068 149 L 1.000** 2.068 150 R 1.000** 2.068 151 R 1.000** 2.068 152 Y 1.000** 2.068 153 G 1.000** 2.068 154 V 1.000** 2.068 155 E 1.000** 2.068 156 I 1.000** 2.068 157 A 1.000** 2.068 158 G 1.000** 2.068 159 T 1.000** 2.068 160 H 1.000** 2.068 161 V 1.000** 2.068 162 V 1.000** 2.068 163 I 1.000** 2.068 164 I 1.000** 2.068 165 G 1.000** 2.068 166 R 1.000** 2.068 167 G 1.000** 2.068 168 V 1.000** 2.068 169 T 1.000** 2.068 170 V 1.000** 2.068 171 G 1.000** 2.068 172 R 1.000** 2.068 173 P 1.000** 2.068 174 L 1.000** 2.068 175 G 1.000** 2.068 176 L 1.000** 2.068 177 L 1.000** 2.068 178 L 1.000** 2.068 179 T 1.000** 2.068 180 R 1.000** 2.068 181 R 1.000** 2.068 182 S 1.000** 2.068 183 E 1.000** 2.068 184 N 1.000** 2.068 185 A 1.000** 2.068 186 T 1.000** 2.068 187 V 1.000** 2.068 188 T 1.000** 2.068 189 L 1.000** 2.068 190 C 1.000** 2.068 191 H 1.000** 2.068 192 T 1.000** 2.068 193 G 1.000** 2.068 194 T 1.000** 2.068 195 R 1.000** 2.068 196 N 1.000** 2.068 197 L 1.000** 2.068 198 A 1.000** 2.068 199 A 1.000** 2.068 200 L 1.000** 2.068 201 T 1.000** 2.068 202 K 1.000** 2.068 203 Q 1.000** 2.068 204 A 1.000** 2.068 205 D 1.000** 2.068 206 I 1.000** 2.068 207 I 1.000** 2.068 208 V 1.000** 2.068 209 A 1.000** 2.068 210 A 1.000** 2.068 211 V 1.000** 2.068 212 G 1.000** 2.068 213 V 1.000** 2.068 214 P 1.000** 2.068 215 H 1.000** 2.068 216 L 1.000** 2.068 217 L 1.000** 2.068 218 T 1.000** 2.068 219 A 1.000** 2.068 220 D 1.000** 2.068 221 M 1.000** 2.068 222 V 1.000** 2.068 223 R 1.000** 2.068 224 P 1.000** 2.068 225 G 1.000** 2.068 226 A 1.000** 2.068 227 V 1.000** 2.068 228 V 1.000** 2.068 229 V 1.000** 2.068 230 D 1.000** 2.068 231 V 1.000** 2.068 232 G 1.000** 2.068 233 V 1.000** 2.068 234 S 1.000** 2.068 235 R 1.000** 2.068 236 V 1.000** 2.068 237 E 1.000** 2.068 238 T 1.000** 2.068 239 R 1.000** 2.068 240 L 1.000** 2.068 241 V 1.000** 2.068 242 G 1.000** 2.068 243 D 1.000** 2.068 244 V 1.000** 2.068 245 H 1.000** 2.068 246 P 1.000** 2.068 247 D 1.000** 2.068 248 V 1.000** 2.068 249 W 1.000** 2.068 250 E 1.000** 2.068 251 V 1.000** 2.068 252 A 1.000** 2.068 253 G 1.000** 2.068 254 H 1.000** 2.068 255 V 1.000** 2.068 256 S 1.000** 2.068 257 P 1.000** 2.068 258 N 1.000** 2.068 259 P 1.000** 2.068 260 G 1.000** 2.068 261 G 1.000** 2.068 262 V 1.000** 2.068 263 G 1.000** 2.068 264 P 1.000** 2.068 265 L 1.000** 2.068 266 T 1.000** 2.068 267 R 1.000** 2.068 268 V 1.000** 2.068 269 F 1.000** 2.068 270 L 1.000** 2.068 271 L 1.000** 2.068 272 T 1.000** 2.068 273 N 1.000** 2.068 274 V 1.000** 2.068 275 V 1.000** 2.068 276 E 1.000** 2.068 277 L 1.000** 2.068 278 A 1.000** 2.068 279 E 1.000** 2.068 280 G 1.000** 2.068 281 R 1.000** 2.068 282 Q 1.000** 2.068 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907869_1_703_MLBR_RS03335) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.099 Time used: 0:13
Model 1: NearlyNeutral -1095.006981 Model 2: PositiveSelection -1095.006978 Model 0: one-ratio -1095.006959 Model 7: beta -1095.007008 Model 8: beta&w>1 -1095.006965 Model 0 vs 1 4.399999988891068E-5 Model 2 vs 1 6.000000212225132E-6 Model 8 vs 7 8.600000001024455E-5