--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:15:01 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/folP/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1153.42 -1157.69 2 -1153.40 -1156.71 -------------------------------------- TOTAL -1153.41 -1157.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896026 0.094207 0.338453 1.478087 0.859785 1303.77 1387.33 1.000 r(A<->C){all} 0.161656 0.017686 0.000049 0.422531 0.130231 176.34 214.88 1.002 r(A<->G){all} 0.160169 0.019602 0.000085 0.451797 0.122339 192.11 247.83 1.001 r(A<->T){all} 0.182843 0.022294 0.000138 0.484219 0.149126 216.92 235.54 1.004 r(C<->G){all} 0.166066 0.019052 0.000084 0.443760 0.128517 235.06 264.17 1.000 r(C<->T){all} 0.167495 0.018780 0.000012 0.447214 0.133750 246.50 281.39 1.001 r(G<->T){all} 0.161772 0.019263 0.000028 0.440192 0.123410 86.29 142.48 1.001 pi(A){all} 0.169461 0.000171 0.144092 0.195315 0.169428 1289.05 1348.36 1.000 pi(C){all} 0.247407 0.000216 0.218621 0.275997 0.247302 1237.07 1251.88 1.000 pi(G){all} 0.352822 0.000270 0.319259 0.383655 0.352768 1196.58 1225.65 1.001 pi(T){all} 0.230310 0.000201 0.202588 0.257286 0.230074 1249.71 1375.36 1.000 alpha{1,2} 0.423408 0.237398 0.000213 1.373515 0.248138 1102.48 1265.27 1.000 alpha{3} 0.473635 0.270507 0.000288 1.501013 0.299038 1257.08 1277.42 1.001 pinvar{all} 0.998239 0.000005 0.994316 0.999999 0.998906 1186.96 1272.74 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1108.132658 Model 2: PositiveSelection -1108.132585 Model 0: one-ratio -1108.132707 Model 7: beta -1108.132585 Model 8: beta&w>1 -1108.132697 Model 0 vs 1 9.799999997994746E-5 Model 2 vs 1 1.459999998587591E-4 Model 8 vs 7 2.2399999988920172E-4
>C1 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C2 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C3 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C4 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C5 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C6 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=284 C1 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C2 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C3 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C4 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C5 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C6 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ************************************************** C1 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C2 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C3 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C4 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C5 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C6 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ************************************************** C1 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C2 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C3 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C4 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C5 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C6 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV ************************************************** C1 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C2 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C3 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C4 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C5 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C6 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ************************************************** C1 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C2 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C3 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C4 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C5 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C6 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW ************************************************** C1 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C2 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C3 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C4 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C5 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C6 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG ********************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 284 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 284 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8520] Library Relaxation: Multi_proc [96] Relaxation Summary: [8520]--->[8520] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.487 Mb, Max= 30.828 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C2 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C3 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C4 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C5 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG C6 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ************************************************** C1 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C2 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C3 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C4 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C5 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG C6 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ************************************************** C1 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C2 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C3 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C4 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C5 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV C6 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV ************************************************** C1 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C2 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C3 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C4 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C5 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV C6 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ************************************************** C1 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C2 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C3 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C4 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C5 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW C6 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW ************************************************** C1 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C2 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C3 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C4 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C5 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG C6 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG ********************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA C2 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA C3 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA C4 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA C5 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA C6 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA ************************************************** C1 TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC C2 TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC C3 TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC C4 TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC C5 TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC C6 TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ************************************************** C1 ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC C2 ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC C3 ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC C4 ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC C5 ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC C6 ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC ************************************************** C1 GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC C2 GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC C3 GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC C4 GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC C5 GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC C6 GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC ************************************************** C1 TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA C2 TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA C3 TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA C4 TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA C5 TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA C6 TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA ************************************************** C1 GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC C2 GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC C3 GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC C4 GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC C5 GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC C6 GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC ************************************************** C1 GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC C2 GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC C3 GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC C4 GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC C5 GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC C6 GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC ************************************************** C1 TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC C2 TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC C3 TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC C4 TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC C5 TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC C6 TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC ************************************************** C1 TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG C2 TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG C3 TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG C4 TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG C5 TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG C6 TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG ************************************************** C1 GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC C2 GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC C3 GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC C4 GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC C5 GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC C6 GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC ************************************************** C1 AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA C2 AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA C3 AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA C4 AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA C5 AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA C6 AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA ************************************************** C1 AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG C2 AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG C3 AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG C4 AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG C5 AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG C6 AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG ************************************************** C1 GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG C2 GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG C3 GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG C4 GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG C5 GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG C6 GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG ************************************************** C1 TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG C2 TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG C3 TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG C4 TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG C5 TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG C6 TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG ************************************************** C1 AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG C2 AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG C3 AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG C4 AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG C5 AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG C6 AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG ************************************************** C1 GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT C2 GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT C3 GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT C4 GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT C5 GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT C6 GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT ************************************************** C1 CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG C2 CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG C3 CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG C4 CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG C5 CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG C6 CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG ************************************************** C1 GC C2 GC C3 GC C4 GC C5 GC C6 GC ** >C1 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >C2 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >C3 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >C4 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >C5 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >C6 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >C1 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C2 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C3 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C4 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C5 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >C6 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 852 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579788819 Setting output file names to "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 344812946 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0952736372 Seed = 1593694331 Swapseed = 1579788819 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1906.816837 -- -24.965149 Chain 2 -- -1906.816547 -- -24.965149 Chain 3 -- -1906.816547 -- -24.965149 Chain 4 -- -1906.816726 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1906.816837 -- -24.965149 Chain 2 -- -1906.816726 -- -24.965149 Chain 3 -- -1906.816547 -- -24.965149 Chain 4 -- -1906.816547 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1906.817] (-1906.817) (-1906.817) (-1906.817) * [-1906.817] (-1906.817) (-1906.817) (-1906.817) 500 -- (-1181.945) (-1170.587) (-1179.598) [-1166.303] * (-1193.184) (-1177.660) (-1168.405) [-1159.945] -- 0:00:00 1000 -- (-1166.477) [-1165.092] (-1161.075) (-1157.864) * (-1164.975) (-1170.780) (-1169.623) [-1162.178] -- 0:00:00 1500 -- (-1163.449) [-1162.401] (-1167.064) (-1165.096) * [-1161.385] (-1159.568) (-1156.167) (-1170.665) -- 0:00:00 2000 -- (-1157.081) [-1158.317] (-1163.123) (-1161.029) * [-1165.377] (-1165.426) (-1172.158) (-1163.791) -- 0:00:00 2500 -- (-1162.999) (-1169.562) (-1159.470) [-1161.111] * (-1171.816) (-1168.015) [-1158.503] (-1159.105) -- 0:00:00 3000 -- (-1164.723) (-1167.611) (-1162.010) [-1168.444] * [-1161.423] (-1171.494) (-1164.827) (-1164.639) -- 0:00:00 3500 -- (-1162.700) (-1165.880) (-1163.300) [-1164.629] * [-1160.485] (-1166.263) (-1161.709) (-1172.197) -- 0:00:00 4000 -- [-1159.558] (-1165.300) (-1160.929) (-1161.535) * (-1161.750) [-1167.672] (-1161.292) (-1167.816) -- 0:00:00 4500 -- [-1158.172] (-1159.490) (-1164.952) (-1164.119) * [-1157.785] (-1161.266) (-1166.475) (-1165.265) -- 0:00:00 5000 -- (-1169.732) (-1163.820) [-1161.329] (-1160.142) * (-1160.966) (-1158.343) [-1156.925] (-1162.943) -- 0:00:00 Average standard deviation of split frequencies: 0.092852 5500 -- (-1164.547) (-1171.304) (-1159.265) [-1163.240] * (-1165.421) [-1160.187] (-1166.313) (-1168.056) -- 0:00:00 6000 -- [-1159.051] (-1164.753) (-1161.655) (-1169.924) * (-1164.550) (-1163.680) (-1170.266) [-1162.122] -- 0:02:45 6500 -- (-1163.062) (-1162.723) (-1166.091) [-1162.048] * [-1164.900] (-1164.232) (-1166.707) (-1171.689) -- 0:02:32 7000 -- (-1159.606) [-1159.502] (-1171.208) (-1163.774) * (-1167.023) (-1160.509) (-1171.814) [-1158.686] -- 0:02:21 7500 -- (-1162.895) (-1164.433) [-1168.422] (-1162.254) * (-1164.393) (-1160.787) (-1164.253) [-1158.414] -- 0:02:12 8000 -- (-1164.532) (-1160.119) (-1168.133) [-1158.569] * (-1164.651) (-1173.043) [-1154.443] (-1160.202) -- 0:02:04 8500 -- (-1162.553) (-1164.134) (-1156.468) [-1166.388] * (-1162.334) (-1163.068) (-1157.475) [-1158.897] -- 0:01:56 9000 -- (-1171.133) (-1166.278) [-1162.220] (-1159.885) * (-1167.549) (-1163.128) (-1157.484) [-1162.026] -- 0:01:50 9500 -- (-1182.258) (-1164.691) [-1159.919] (-1163.669) * (-1161.433) (-1171.657) (-1155.154) [-1165.162] -- 0:01:44 10000 -- [-1159.952] (-1160.199) (-1175.047) (-1169.267) * [-1163.903] (-1166.672) (-1153.497) (-1162.167) -- 0:01:39 Average standard deviation of split frequencies: 0.075130 10500 -- (-1165.237) (-1166.842) [-1161.702] (-1165.785) * (-1166.690) (-1165.373) (-1157.953) [-1164.720] -- 0:01:34 11000 -- [-1163.798] (-1163.569) (-1158.440) (-1167.858) * (-1159.611) (-1165.361) [-1154.641] (-1163.257) -- 0:01:29 11500 -- (-1156.881) (-1166.848) (-1158.402) [-1159.414] * [-1161.157] (-1163.814) (-1156.151) (-1160.931) -- 0:01:25 12000 -- (-1166.805) (-1161.095) [-1158.844] (-1159.811) * (-1173.990) [-1160.531] (-1153.410) (-1157.679) -- 0:01:22 12500 -- (-1180.719) (-1161.508) (-1156.684) [-1163.288] * (-1160.985) (-1160.685) (-1155.745) [-1165.267] -- 0:01:19 13000 -- (-1166.247) (-1165.538) [-1166.586] (-1160.190) * (-1166.469) [-1162.071] (-1154.850) (-1165.496) -- 0:01:15 13500 -- (-1166.848) [-1161.302] (-1174.654) (-1163.233) * (-1164.872) [-1160.807] (-1154.682) (-1174.159) -- 0:01:13 14000 -- [-1158.663] (-1161.847) (-1162.548) (-1168.565) * [-1162.480] (-1170.044) (-1154.772) (-1160.595) -- 0:01:10 14500 -- (-1161.977) [-1162.009] (-1160.905) (-1166.034) * (-1161.597) [-1170.813] (-1154.390) (-1166.425) -- 0:01:07 15000 -- (-1166.978) [-1164.978] (-1160.955) (-1169.227) * [-1159.354] (-1162.848) (-1153.768) (-1165.057) -- 0:01:05 Average standard deviation of split frequencies: 0.057452 15500 -- [-1168.348] (-1163.417) (-1163.228) (-1163.057) * (-1166.670) (-1169.554) (-1153.417) [-1156.458] -- 0:01:03 16000 -- (-1167.130) (-1163.300) [-1167.378] (-1162.589) * (-1162.354) [-1163.592] (-1154.540) (-1162.493) -- 0:01:01 16500 -- (-1162.016) (-1157.345) (-1168.672) [-1160.151] * (-1160.918) (-1173.001) [-1153.385] (-1163.062) -- 0:00:59 17000 -- (-1165.489) [-1161.110] (-1162.341) (-1164.944) * (-1162.132) [-1163.886] (-1152.378) (-1167.123) -- 0:00:57 17500 -- (-1167.336) (-1161.108) (-1164.215) [-1157.994] * (-1162.249) (-1165.157) (-1152.324) [-1159.497] -- 0:00:56 18000 -- (-1172.363) (-1159.527) [-1165.535] (-1163.433) * (-1165.283) (-1162.453) [-1154.419] (-1162.462) -- 0:00:54 18500 -- [-1162.559] (-1167.369) (-1162.430) (-1166.930) * (-1163.687) [-1162.201] (-1154.974) (-1165.510) -- 0:00:53 19000 -- (-1164.602) [-1159.541] (-1169.303) (-1164.456) * (-1163.947) (-1161.396) (-1154.974) [-1158.341] -- 0:00:51 19500 -- (-1160.603) [-1159.474] (-1160.073) (-1159.577) * (-1159.125) [-1162.145] (-1154.631) (-1165.103) -- 0:01:40 20000 -- (-1161.679) (-1162.874) [-1161.297] (-1167.822) * (-1160.753) (-1162.856) [-1152.447] (-1167.623) -- 0:01:38 Average standard deviation of split frequencies: 0.049645 20500 -- (-1165.235) [-1162.118] (-1156.821) (-1166.784) * (-1169.620) (-1162.145) [-1153.509] (-1168.763) -- 0:01:35 21000 -- (-1160.017) (-1159.891) (-1167.231) [-1159.084] * (-1162.450) [-1159.791] (-1157.241) (-1161.109) -- 0:01:33 21500 -- [-1160.222] (-1161.360) (-1157.671) (-1160.083) * [-1165.259] (-1167.208) (-1154.464) (-1167.858) -- 0:01:31 22000 -- (-1161.975) (-1158.554) (-1159.550) [-1164.787] * (-1168.824) (-1165.510) [-1154.391] (-1164.985) -- 0:01:28 22500 -- (-1164.983) (-1172.196) [-1158.117] (-1173.791) * (-1169.125) (-1158.851) [-1154.550] (-1165.845) -- 0:01:26 23000 -- (-1158.410) (-1160.008) [-1160.195] (-1162.571) * (-1171.952) (-1165.871) (-1153.345) [-1159.242] -- 0:01:24 23500 -- [-1159.819] (-1167.450) (-1164.315) (-1165.337) * [-1164.560] (-1168.591) (-1154.110) (-1170.463) -- 0:01:23 24000 -- (-1166.606) (-1166.710) [-1156.734] (-1167.018) * (-1169.871) (-1160.295) (-1155.141) [-1162.450] -- 0:01:21 24500 -- [-1159.497] (-1161.002) (-1160.009) (-1161.149) * (-1160.910) [-1158.062] (-1156.552) (-1161.848) -- 0:01:19 25000 -- (-1170.674) (-1158.819) (-1165.677) [-1162.566] * (-1170.966) (-1168.239) (-1153.741) [-1161.558] -- 0:01:18 Average standard deviation of split frequencies: 0.044032 25500 -- (-1161.645) (-1170.097) (-1159.894) [-1161.966] * (-1167.025) [-1163.281] (-1154.779) (-1161.958) -- 0:01:16 26000 -- (-1160.248) (-1162.981) (-1165.900) [-1167.934] * (-1163.049) (-1171.430) (-1157.174) [-1158.747] -- 0:01:14 26500 -- (-1159.787) (-1160.231) (-1164.244) [-1162.798] * (-1171.481) [-1161.025] (-1158.116) (-1153.201) -- 0:01:13 27000 -- (-1166.662) (-1167.113) [-1164.635] (-1164.256) * (-1159.222) (-1161.917) (-1156.742) [-1153.203] -- 0:01:12 27500 -- (-1163.396) (-1162.609) (-1160.232) [-1157.627] * [-1164.205] (-1166.434) (-1156.623) (-1154.994) -- 0:01:10 28000 -- (-1163.827) [-1159.626] (-1170.836) (-1161.175) * [-1165.870] (-1166.046) (-1155.509) (-1156.294) -- 0:01:09 28500 -- (-1163.850) (-1167.496) [-1164.644] (-1163.509) * [-1161.857] (-1159.323) (-1161.608) (-1153.629) -- 0:01:08 29000 -- [-1162.660] (-1160.077) (-1160.731) (-1162.044) * (-1162.348) (-1163.320) (-1152.884) [-1158.700] -- 0:01:06 29500 -- [-1162.402] (-1168.091) (-1165.872) (-1164.821) * (-1160.133) (-1167.569) (-1154.712) [-1155.723] -- 0:01:05 30000 -- (-1172.052) (-1162.989) [-1168.180] (-1162.907) * (-1168.033) (-1162.903) [-1153.660] (-1152.996) -- 0:01:04 Average standard deviation of split frequencies: 0.047513 30500 -- (-1163.784) (-1171.261) [-1159.893] (-1159.482) * (-1168.366) (-1167.846) (-1154.013) [-1154.177] -- 0:01:03 31000 -- (-1169.266) (-1162.817) (-1166.034) [-1163.616] * [-1161.479] (-1167.419) (-1153.575) (-1153.097) -- 0:01:02 31500 -- (-1169.264) (-1165.943) (-1162.957) [-1165.119] * (-1159.621) [-1161.800] (-1153.707) (-1155.030) -- 0:01:01 32000 -- (-1165.616) (-1164.220) (-1159.155) [-1161.089] * (-1166.484) (-1163.624) (-1155.345) [-1157.005] -- 0:01:00 32500 -- (-1162.612) (-1165.347) [-1161.760] (-1160.001) * [-1160.262] (-1160.639) (-1155.039) (-1156.164) -- 0:00:59 33000 -- [-1164.886] (-1163.961) (-1160.471) (-1162.513) * [-1160.129] (-1161.250) (-1153.004) (-1156.181) -- 0:00:58 33500 -- (-1164.117) (-1160.695) (-1162.067) [-1162.707] * (-1161.877) (-1163.861) [-1152.960] (-1154.991) -- 0:00:57 34000 -- (-1169.592) (-1166.744) (-1160.161) [-1167.869] * [-1165.305] (-1162.819) (-1153.106) (-1156.507) -- 0:01:25 34500 -- [-1159.075] (-1159.880) (-1159.327) (-1162.107) * [-1165.461] (-1156.878) (-1154.393) (-1153.693) -- 0:01:23 35000 -- (-1163.394) [-1160.024] (-1161.197) (-1160.637) * [-1165.623] (-1157.999) (-1155.031) (-1154.401) -- 0:01:22 Average standard deviation of split frequencies: 0.038689 35500 -- [-1166.901] (-1167.736) (-1160.013) (-1163.117) * [-1163.134] (-1171.084) (-1157.393) (-1153.078) -- 0:01:21 36000 -- (-1159.772) [-1160.904] (-1161.840) (-1163.234) * [-1166.405] (-1166.731) (-1157.228) (-1156.496) -- 0:01:20 36500 -- (-1168.208) [-1158.296] (-1168.514) (-1161.743) * [-1157.395] (-1161.548) (-1160.540) (-1156.858) -- 0:01:19 37000 -- (-1166.713) [-1161.218] (-1160.684) (-1177.014) * [-1166.791] (-1166.380) (-1157.333) (-1154.672) -- 0:01:18 37500 -- [-1163.600] (-1163.471) (-1169.400) (-1159.487) * (-1163.620) (-1157.305) (-1155.079) [-1153.801] -- 0:01:17 38000 -- [-1166.395] (-1163.552) (-1163.882) (-1164.289) * (-1166.619) (-1165.226) (-1154.035) [-1153.831] -- 0:01:15 38500 -- [-1161.400] (-1168.309) (-1161.396) (-1158.756) * (-1161.082) (-1159.954) (-1156.740) [-1155.052] -- 0:01:14 39000 -- [-1164.806] (-1164.223) (-1162.254) (-1163.689) * (-1165.134) (-1154.387) [-1155.252] (-1157.125) -- 0:01:13 39500 -- (-1165.567) (-1166.716) [-1159.405] (-1174.980) * (-1167.066) (-1154.529) [-1153.289] (-1160.550) -- 0:01:12 40000 -- [-1162.764] (-1163.684) (-1167.278) (-1170.334) * (-1166.327) (-1156.897) [-1153.745] (-1156.641) -- 0:01:12 Average standard deviation of split frequencies: 0.039192 40500 -- [-1160.953] (-1164.988) (-1164.594) (-1172.223) * (-1169.877) (-1155.290) [-1153.747] (-1159.685) -- 0:01:11 41000 -- [-1164.716] (-1164.396) (-1163.024) (-1163.852) * (-1171.211) [-1153.733] (-1154.007) (-1158.850) -- 0:01:10 41500 -- (-1163.106) (-1170.168) [-1168.517] (-1160.959) * (-1163.351) (-1153.662) (-1154.985) [-1153.643] -- 0:01:09 42000 -- (-1164.229) (-1163.839) [-1166.426] (-1161.894) * (-1166.196) (-1154.466) [-1153.532] (-1153.671) -- 0:01:08 42500 -- [-1161.434] (-1172.754) (-1160.474) (-1163.165) * [-1160.516] (-1157.660) (-1156.228) (-1156.461) -- 0:01:07 43000 -- (-1173.969) [-1155.300] (-1163.609) (-1161.088) * (-1159.953) (-1154.870) [-1153.964] (-1153.014) -- 0:01:06 43500 -- (-1168.844) (-1156.282) [-1161.241] (-1166.488) * [-1165.977] (-1162.165) (-1155.783) (-1155.207) -- 0:01:05 44000 -- [-1164.557] (-1157.425) (-1162.684) (-1169.076) * [-1165.443] (-1152.826) (-1154.617) (-1154.399) -- 0:01:05 44500 -- (-1172.321) (-1159.682) [-1159.710] (-1163.303) * [-1156.854] (-1154.934) (-1153.656) (-1154.523) -- 0:01:04 45000 -- (-1160.158) (-1155.442) (-1157.219) [-1162.913] * (-1172.125) (-1153.916) (-1156.195) [-1156.422] -- 0:01:03 Average standard deviation of split frequencies: 0.033073 45500 -- (-1167.284) (-1156.353) [-1157.025] (-1165.210) * [-1166.680] (-1154.116) (-1152.174) (-1152.483) -- 0:01:02 46000 -- (-1156.803) (-1155.342) [-1162.384] (-1161.942) * (-1168.646) (-1153.806) [-1152.352] (-1152.175) -- 0:01:02 46500 -- (-1157.709) (-1155.647) (-1162.746) [-1156.116] * (-1160.639) [-1153.597] (-1153.629) (-1153.958) -- 0:01:01 47000 -- (-1159.610) (-1155.405) [-1164.535] (-1155.178) * (-1167.239) (-1153.428) (-1155.305) [-1154.883] -- 0:01:21 47500 -- (-1162.011) [-1155.395] (-1174.614) (-1156.848) * [-1165.808] (-1153.365) (-1157.228) (-1152.777) -- 0:01:20 48000 -- (-1168.975) [-1152.868] (-1161.588) (-1152.492) * [-1164.913] (-1156.793) (-1152.819) (-1152.784) -- 0:01:19 48500 -- (-1159.433) (-1153.601) [-1167.396] (-1152.664) * (-1164.942) (-1155.012) (-1152.880) [-1153.042] -- 0:01:18 49000 -- (-1170.327) (-1153.654) [-1168.598] (-1152.479) * (-1159.961) (-1153.130) (-1152.177) [-1152.689] -- 0:01:17 49500 -- (-1161.546) (-1154.384) [-1164.049] (-1153.709) * (-1164.307) (-1154.312) (-1153.265) [-1152.528] -- 0:01:16 50000 -- [-1162.200] (-1155.078) (-1165.807) (-1153.405) * (-1162.687) [-1153.384] (-1153.095) (-1152.913) -- 0:01:16 Average standard deviation of split frequencies: 0.030339 50500 -- (-1172.458) (-1153.790) [-1166.688] (-1153.464) * (-1157.554) (-1153.712) [-1153.206] (-1152.474) -- 0:01:15 51000 -- (-1159.563) (-1156.792) [-1161.744] (-1153.299) * (-1163.541) [-1154.149] (-1154.400) (-1154.498) -- 0:01:14 51500 -- (-1167.470) [-1153.059] (-1169.724) (-1161.628) * (-1160.793) [-1156.014] (-1152.789) (-1152.454) -- 0:01:13 52000 -- (-1163.320) [-1152.578] (-1155.207) (-1166.415) * (-1167.817) (-1152.992) [-1153.311] (-1152.724) -- 0:01:12 52500 -- [-1162.697] (-1152.180) (-1157.077) (-1155.948) * (-1163.974) [-1152.996] (-1154.934) (-1152.911) -- 0:01:12 53000 -- (-1162.077) (-1153.347) [-1154.233] (-1156.016) * (-1164.872) [-1152.949] (-1153.517) (-1153.141) -- 0:01:11 53500 -- (-1168.363) (-1153.347) (-1152.738) [-1156.158] * (-1166.025) (-1153.166) (-1152.745) [-1151.800] -- 0:01:10 54000 -- (-1166.294) (-1152.474) [-1156.519] (-1158.345) * (-1159.623) (-1153.317) (-1152.745) [-1151.915] -- 0:01:10 54500 -- (-1162.060) (-1155.008) (-1156.075) [-1153.498] * (-1160.718) (-1153.354) [-1153.103] (-1153.026) -- 0:01:09 55000 -- (-1175.095) (-1153.202) [-1153.123] (-1155.078) * [-1161.454] (-1155.954) (-1154.132) (-1154.774) -- 0:01:08 Average standard deviation of split frequencies: 0.034054 55500 -- (-1172.760) (-1153.675) [-1152.111] (-1160.200) * [-1159.825] (-1156.687) (-1153.100) (-1154.265) -- 0:01:08 56000 -- (-1166.467) (-1154.958) [-1152.804] (-1158.121) * [-1160.671] (-1157.022) (-1153.394) (-1156.797) -- 0:01:07 56500 -- (-1160.339) (-1161.227) [-1153.992] (-1153.603) * (-1160.138) [-1160.325] (-1152.426) (-1157.798) -- 0:01:06 57000 -- [-1164.326] (-1153.507) (-1153.271) (-1153.645) * (-1163.084) [-1154.017] (-1152.257) (-1155.212) -- 0:01:06 57500 -- [-1162.267] (-1154.371) (-1158.206) (-1155.214) * (-1172.707) (-1155.336) [-1153.123] (-1152.780) -- 0:01:05 58000 -- (-1171.941) (-1156.080) [-1156.361] (-1157.149) * (-1162.551) (-1157.595) (-1155.710) [-1152.399] -- 0:01:04 58500 -- (-1163.690) [-1156.352] (-1156.650) (-1156.228) * (-1162.124) [-1156.416] (-1155.288) (-1153.902) -- 0:01:04 59000 -- (-1165.581) (-1154.378) (-1153.330) [-1153.833] * [-1152.877] (-1154.382) (-1156.191) (-1152.816) -- 0:01:03 59500 -- (-1158.992) [-1152.846] (-1153.878) (-1158.009) * [-1155.812] (-1155.029) (-1154.846) (-1153.169) -- 0:01:03 60000 -- [-1161.246] (-1156.862) (-1156.956) (-1154.241) * (-1153.830) (-1155.613) (-1156.390) [-1153.206] -- 0:01:02 Average standard deviation of split frequencies: 0.029972 60500 -- (-1164.882) (-1154.344) (-1153.874) [-1158.782] * [-1155.831] (-1153.212) (-1160.092) (-1155.723) -- 0:01:02 61000 -- (-1169.039) (-1153.225) [-1154.578] (-1153.510) * [-1153.742] (-1154.736) (-1158.173) (-1154.297) -- 0:01:01 61500 -- (-1163.162) (-1153.316) [-1153.295] (-1155.611) * (-1153.122) (-1152.150) [-1157.262] (-1153.318) -- 0:01:16 62000 -- (-1164.769) (-1156.366) (-1153.049) [-1156.518] * [-1154.224] (-1152.728) (-1153.822) (-1153.590) -- 0:01:15 62500 -- [-1160.631] (-1157.303) (-1153.807) (-1153.320) * [-1153.568] (-1153.278) (-1155.494) (-1154.778) -- 0:01:15 63000 -- [-1166.066] (-1157.057) (-1155.879) (-1156.407) * (-1153.576) (-1154.502) [-1152.522] (-1154.820) -- 0:01:14 63500 -- [-1158.122] (-1155.048) (-1153.547) (-1159.457) * [-1154.039] (-1154.569) (-1157.098) (-1155.201) -- 0:01:13 64000 -- (-1161.296) (-1155.150) (-1154.725) [-1154.945] * [-1155.534] (-1154.734) (-1158.834) (-1153.701) -- 0:01:13 64500 -- (-1161.697) [-1155.997] (-1154.139) (-1153.329) * (-1154.943) (-1162.201) (-1155.639) [-1152.940] -- 0:01:12 65000 -- [-1160.859] (-1153.183) (-1153.891) (-1153.114) * [-1153.355] (-1153.018) (-1160.002) (-1154.071) -- 0:01:11 Average standard deviation of split frequencies: 0.026396 65500 -- (-1170.721) (-1154.469) (-1153.603) [-1153.576] * (-1155.358) (-1153.589) (-1158.105) [-1154.357] -- 0:01:11 66000 -- [-1159.238] (-1153.007) (-1154.637) (-1153.395) * (-1153.966) (-1154.235) (-1158.063) [-1153.410] -- 0:01:10 66500 -- (-1165.239) (-1154.378) [-1154.355] (-1153.257) * [-1154.587] (-1153.683) (-1155.189) (-1156.791) -- 0:01:10 67000 -- (-1160.978) (-1153.559) (-1155.420) [-1152.903] * (-1152.887) (-1155.356) (-1154.802) [-1154.127] -- 0:01:09 67500 -- (-1164.942) (-1154.031) [-1154.572] (-1153.089) * (-1153.009) [-1155.734] (-1154.226) (-1154.863) -- 0:01:09 68000 -- (-1171.680) (-1152.315) [-1153.810] (-1153.556) * (-1153.510) (-1158.048) (-1156.976) [-1159.217] -- 0:01:08 68500 -- (-1171.248) (-1153.664) [-1152.267] (-1154.084) * (-1153.251) (-1157.264) [-1153.711] (-1157.664) -- 0:01:07 69000 -- (-1169.626) (-1156.337) (-1156.147) [-1157.506] * (-1152.451) (-1154.573) [-1153.839] (-1159.043) -- 0:01:07 69500 -- (-1175.067) (-1154.823) [-1155.764] (-1153.815) * [-1159.041] (-1154.698) (-1156.649) (-1155.797) -- 0:01:06 70000 -- (-1162.727) (-1155.664) (-1156.768) [-1157.121] * [-1154.167] (-1155.938) (-1155.795) (-1155.546) -- 0:01:06 Average standard deviation of split frequencies: 0.020619 70500 -- [-1157.634] (-1153.684) (-1157.023) (-1156.729) * (-1156.479) (-1154.028) (-1154.070) [-1154.291] -- 0:01:05 71000 -- (-1154.010) (-1153.147) (-1155.325) [-1154.346] * [-1153.758] (-1154.088) (-1157.055) (-1158.696) -- 0:01:05 71500 -- (-1156.276) (-1155.737) [-1152.940] (-1157.450) * (-1153.054) (-1153.428) [-1153.731] (-1156.363) -- 0:01:04 72000 -- [-1155.916] (-1156.107) (-1153.754) (-1152.996) * (-1156.240) (-1155.489) (-1154.301) [-1155.826] -- 0:01:04 72500 -- [-1152.419] (-1154.976) (-1153.377) (-1153.454) * [-1159.628] (-1155.773) (-1153.939) (-1152.854) -- 0:01:03 73000 -- (-1153.779) (-1153.740) (-1153.008) [-1152.479] * (-1159.269) (-1158.209) [-1156.691] (-1158.964) -- 0:01:03 73500 -- [-1155.421] (-1153.398) (-1161.159) (-1152.461) * [-1159.824] (-1154.352) (-1155.774) (-1154.141) -- 0:01:03 74000 -- (-1154.564) (-1154.052) (-1155.522) [-1154.034] * (-1155.953) (-1153.534) (-1155.339) [-1154.023] -- 0:01:02 74500 -- [-1156.362] (-1154.462) (-1155.446) (-1153.620) * (-1156.779) [-1154.554] (-1153.472) (-1158.317) -- 0:01:02 75000 -- (-1156.323) (-1158.237) [-1153.556] (-1153.603) * (-1157.799) (-1155.831) [-1154.268] (-1154.350) -- 0:01:01 Average standard deviation of split frequencies: 0.023462 75500 -- [-1154.378] (-1160.703) (-1153.872) (-1154.583) * (-1154.249) (-1156.933) [-1155.133] (-1157.552) -- 0:01:01 76000 -- (-1154.046) (-1155.315) (-1159.643) [-1153.617] * (-1154.570) (-1152.936) [-1154.523] (-1156.358) -- 0:01:00 76500 -- [-1157.494] (-1155.156) (-1154.997) (-1153.563) * (-1155.482) (-1153.014) [-1152.296] (-1152.365) -- 0:01:00 77000 -- (-1154.399) (-1155.710) [-1153.858] (-1153.563) * (-1154.084) (-1152.983) (-1153.371) [-1152.331] -- 0:00:59 77500 -- (-1152.068) (-1154.106) [-1154.457] (-1154.801) * (-1158.720) (-1156.816) [-1156.316] (-1153.010) -- 0:00:59 78000 -- [-1153.486] (-1153.266) (-1153.729) (-1153.751) * (-1157.891) (-1155.859) (-1157.636) [-1154.428] -- 0:01:10 78500 -- (-1154.392) [-1152.426] (-1156.195) (-1153.158) * [-1153.429] (-1152.378) (-1153.167) (-1155.927) -- 0:01:10 79000 -- [-1152.022] (-1152.766) (-1153.448) (-1155.224) * [-1152.899] (-1152.867) (-1153.872) (-1154.709) -- 0:01:09 79500 -- (-1153.688) (-1153.064) (-1154.421) [-1152.725] * (-1155.566) [-1152.054] (-1153.015) (-1153.198) -- 0:01:09 80000 -- (-1153.767) [-1154.592] (-1157.206) (-1153.889) * (-1155.573) [-1154.379] (-1152.547) (-1153.769) -- 0:01:09 Average standard deviation of split frequencies: 0.021427 80500 -- (-1153.808) [-1153.624] (-1155.300) (-1153.889) * (-1156.626) [-1152.706] (-1154.439) (-1156.411) -- 0:01:08 81000 -- (-1153.772) [-1153.338] (-1153.250) (-1152.392) * (-1159.858) (-1153.018) [-1154.992] (-1153.306) -- 0:01:08 81500 -- [-1156.182] (-1153.427) (-1154.657) (-1152.103) * (-1156.084) [-1152.961] (-1156.959) (-1155.448) -- 0:01:07 82000 -- (-1154.552) [-1153.867] (-1154.641) (-1152.103) * (-1156.821) [-1154.377] (-1155.125) (-1158.514) -- 0:01:07 82500 -- (-1152.782) (-1153.414) (-1154.704) [-1152.944] * (-1156.459) (-1154.842) (-1155.264) [-1152.360] -- 0:01:06 83000 -- (-1152.449) (-1157.154) (-1159.222) [-1152.326] * (-1155.207) [-1154.668] (-1157.246) (-1153.609) -- 0:01:06 83500 -- [-1152.039] (-1156.248) (-1155.112) (-1153.470) * (-1153.266) (-1153.681) (-1153.688) [-1153.535] -- 0:01:05 84000 -- [-1153.344] (-1157.246) (-1154.491) (-1152.168) * (-1154.167) (-1154.863) [-1154.348] (-1152.624) -- 0:01:05 84500 -- (-1153.633) (-1155.109) [-1156.000] (-1155.599) * (-1158.725) [-1158.204] (-1153.822) (-1153.027) -- 0:01:05 85000 -- [-1154.102] (-1153.948) (-1159.596) (-1154.132) * (-1154.399) (-1152.726) (-1157.276) [-1153.120] -- 0:01:04 Average standard deviation of split frequencies: 0.020734 85500 -- [-1153.669] (-1159.054) (-1158.452) (-1152.608) * [-1153.906] (-1154.633) (-1154.799) (-1153.038) -- 0:01:04 86000 -- (-1153.822) (-1152.805) (-1155.983) [-1154.491] * (-1153.550) (-1156.551) [-1152.583] (-1152.750) -- 0:01:03 86500 -- (-1156.696) (-1153.918) (-1154.766) [-1154.901] * (-1152.579) (-1156.482) (-1153.108) [-1152.759] -- 0:01:03 87000 -- (-1159.531) [-1153.721] (-1155.623) (-1157.575) * (-1157.646) (-1158.915) (-1154.525) [-1152.582] -- 0:01:02 87500 -- [-1156.796] (-1154.264) (-1157.307) (-1155.347) * (-1152.109) (-1155.757) (-1154.234) [-1153.546] -- 0:01:02 88000 -- (-1155.675) (-1155.010) (-1154.427) [-1154.415] * (-1152.918) [-1152.702] (-1153.763) (-1153.017) -- 0:01:02 88500 -- [-1154.404] (-1154.681) (-1155.946) (-1152.064) * [-1153.327] (-1154.662) (-1152.732) (-1154.574) -- 0:01:01 89000 -- (-1156.325) (-1155.321) (-1154.425) [-1152.972] * (-1154.907) (-1153.251) (-1155.535) [-1152.626] -- 0:01:01 89500 -- [-1154.235] (-1156.815) (-1153.276) (-1153.426) * [-1156.292] (-1160.642) (-1154.588) (-1154.157) -- 0:01:01 90000 -- (-1154.265) [-1152.849] (-1154.284) (-1153.411) * (-1153.341) (-1154.058) (-1155.363) [-1153.734] -- 0:01:00 Average standard deviation of split frequencies: 0.019559 90500 -- (-1154.231) [-1154.632] (-1155.552) (-1153.862) * (-1156.352) (-1155.111) [-1158.067] (-1154.010) -- 0:01:00 91000 -- [-1153.355] (-1154.339) (-1153.245) (-1152.575) * (-1158.679) (-1155.372) (-1156.021) [-1152.648] -- 0:00:59 91500 -- (-1155.230) [-1157.660] (-1156.292) (-1152.575) * [-1154.641] (-1153.807) (-1156.526) (-1152.465) -- 0:00:59 92000 -- (-1152.293) [-1156.796] (-1154.997) (-1154.391) * (-1154.684) (-1152.987) (-1157.299) [-1154.775] -- 0:00:59 92500 -- (-1152.277) (-1162.118) [-1156.636] (-1154.934) * (-1154.627) [-1157.809] (-1158.751) (-1152.897) -- 0:00:58 93000 -- [-1152.303] (-1154.023) (-1156.053) (-1153.655) * (-1157.110) [-1152.932] (-1153.752) (-1154.429) -- 0:00:58 93500 -- [-1152.295] (-1154.919) (-1156.371) (-1153.214) * (-1153.518) [-1153.484] (-1157.299) (-1152.469) -- 0:00:58 94000 -- [-1152.297] (-1156.945) (-1156.793) (-1153.154) * [-1154.318] (-1154.632) (-1153.355) (-1152.717) -- 0:01:07 94500 -- (-1153.869) (-1156.018) [-1158.922] (-1155.114) * (-1158.115) (-1156.484) [-1153.949] (-1152.717) -- 0:01:07 95000 -- [-1154.906] (-1153.749) (-1159.212) (-1154.826) * (-1157.395) (-1153.193) (-1152.524) [-1157.408] -- 0:01:06 Average standard deviation of split frequencies: 0.021045 95500 -- (-1152.868) (-1153.504) (-1159.543) [-1154.988] * (-1155.625) (-1154.435) [-1152.929] (-1152.915) -- 0:01:06 96000 -- (-1153.360) (-1155.354) [-1153.993] (-1153.553) * (-1155.955) (-1155.211) [-1154.692] (-1153.914) -- 0:01:05 96500 -- (-1152.736) [-1155.896] (-1154.511) (-1153.380) * [-1155.368] (-1161.823) (-1154.463) (-1153.142) -- 0:01:05 97000 -- (-1153.872) [-1153.282] (-1154.573) (-1153.390) * [-1155.185] (-1155.345) (-1154.376) (-1153.235) -- 0:01:05 97500 -- (-1158.917) (-1153.644) (-1154.658) [-1154.005] * (-1152.418) (-1155.917) (-1153.081) [-1154.133] -- 0:01:04 98000 -- (-1152.965) (-1151.951) [-1153.120] (-1155.872) * (-1155.674) (-1158.583) [-1153.579] (-1153.590) -- 0:01:04 98500 -- (-1157.522) (-1151.956) [-1153.307] (-1152.738) * (-1154.337) [-1154.665] (-1153.855) (-1153.424) -- 0:01:04 99000 -- (-1158.268) (-1159.347) [-1154.536] (-1154.321) * (-1153.422) (-1156.104) [-1153.611] (-1151.945) -- 0:01:03 99500 -- (-1155.522) (-1152.593) [-1154.749] (-1158.090) * (-1154.033) (-1160.610) [-1156.118] (-1154.359) -- 0:01:03 100000 -- (-1157.179) [-1153.379] (-1154.265) (-1154.566) * (-1154.192) [-1154.114] (-1155.971) (-1152.983) -- 0:01:02 Average standard deviation of split frequencies: 0.023648 100500 -- [-1156.105] (-1153.954) (-1152.649) (-1154.813) * (-1155.157) [-1152.780] (-1155.915) (-1152.704) -- 0:01:02 101000 -- (-1154.082) (-1154.093) [-1152.125] (-1158.744) * (-1153.025) (-1152.422) (-1155.757) [-1152.654] -- 0:01:02 101500 -- (-1153.970) (-1153.774) (-1153.288) [-1153.634] * (-1152.717) (-1155.096) [-1154.816] (-1151.878) -- 0:01:01 102000 -- (-1153.437) [-1153.740] (-1155.799) (-1156.785) * [-1152.949] (-1156.001) (-1157.616) (-1153.143) -- 0:01:01 102500 -- (-1157.876) [-1153.319] (-1152.887) (-1152.246) * (-1153.785) [-1152.555] (-1156.707) (-1152.856) -- 0:01:01 103000 -- [-1160.622] (-1152.504) (-1157.289) (-1152.551) * [-1155.705] (-1154.139) (-1155.560) (-1152.718) -- 0:01:00 103500 -- (-1152.948) [-1152.713] (-1157.641) (-1152.618) * (-1158.426) (-1154.738) [-1155.342] (-1154.066) -- 0:01:00 104000 -- (-1153.095) (-1152.317) [-1155.412] (-1152.053) * (-1153.124) (-1154.489) [-1156.255] (-1157.494) -- 0:01:00 104500 -- (-1152.545) [-1152.864] (-1158.582) (-1152.246) * (-1153.054) [-1156.522] (-1156.359) (-1154.571) -- 0:00:59 105000 -- (-1153.828) (-1156.710) [-1156.624] (-1153.436) * [-1152.495] (-1156.138) (-1153.212) (-1155.494) -- 0:00:59 Average standard deviation of split frequencies: 0.025201 105500 -- (-1155.057) (-1156.965) (-1153.731) [-1152.922] * (-1153.659) (-1154.719) (-1153.315) [-1153.371] -- 0:00:59 106000 -- (-1152.938) (-1156.854) [-1153.292] (-1156.478) * (-1153.850) (-1152.741) [-1152.032] (-1154.738) -- 0:00:59 106500 -- [-1152.034] (-1157.311) (-1154.692) (-1159.890) * (-1153.611) (-1154.158) (-1152.025) [-1153.476] -- 0:00:58 107000 -- (-1152.321) (-1156.568) [-1153.448] (-1155.469) * (-1154.278) (-1154.761) [-1153.055] (-1152.665) -- 0:00:58 107500 -- (-1155.058) (-1156.025) [-1152.335] (-1154.032) * (-1157.414) (-1160.805) [-1153.513] (-1154.025) -- 0:00:58 108000 -- (-1154.269) [-1156.810] (-1152.654) (-1154.357) * (-1156.034) [-1157.212] (-1153.384) (-1153.825) -- 0:00:57 108500 -- (-1155.350) (-1155.414) (-1154.245) [-1154.996] * (-1153.364) [-1154.744] (-1153.387) (-1154.191) -- 0:00:57 109000 -- (-1154.110) (-1156.622) (-1152.830) [-1154.254] * (-1153.364) (-1152.913) [-1153.401] (-1156.517) -- 0:00:57 109500 -- (-1154.221) [-1154.372] (-1154.038) (-1154.582) * (-1152.797) [-1153.773] (-1155.323) (-1153.446) -- 0:00:56 110000 -- (-1153.074) [-1154.368] (-1156.832) (-1154.041) * [-1153.614] (-1153.913) (-1160.278) (-1153.987) -- 0:00:56 Average standard deviation of split frequencies: 0.026167 110500 -- [-1155.491] (-1152.301) (-1155.820) (-1153.979) * (-1152.713) (-1155.378) [-1154.406] (-1154.184) -- 0:01:04 111000 -- (-1155.695) (-1154.011) (-1157.552) [-1153.437] * [-1156.714] (-1154.422) (-1155.067) (-1153.681) -- 0:01:04 111500 -- [-1153.899] (-1156.236) (-1159.526) (-1153.721) * [-1155.204] (-1154.791) (-1153.206) (-1152.992) -- 0:01:03 112000 -- [-1155.369] (-1154.317) (-1157.983) (-1153.326) * (-1152.688) (-1153.476) (-1152.668) [-1152.343] -- 0:01:03 112500 -- (-1152.362) (-1158.967) [-1156.650] (-1152.620) * [-1152.491] (-1153.476) (-1154.413) (-1154.612) -- 0:01:03 113000 -- (-1154.158) (-1154.758) [-1157.529] (-1153.601) * (-1155.657) (-1157.673) (-1153.500) [-1154.804] -- 0:01:02 113500 -- [-1154.546] (-1153.255) (-1156.438) (-1152.779) * [-1154.488] (-1154.314) (-1156.205) (-1154.031) -- 0:01:02 114000 -- (-1152.569) [-1153.070] (-1154.333) (-1152.043) * (-1153.487) [-1153.729] (-1155.723) (-1156.731) -- 0:01:02 114500 -- (-1154.939) (-1152.689) [-1152.319] (-1152.614) * [-1152.697] (-1155.893) (-1155.553) (-1155.258) -- 0:01:01 115000 -- (-1152.867) (-1152.633) [-1153.537] (-1155.797) * (-1152.836) (-1154.760) (-1155.608) [-1153.326] -- 0:01:01 Average standard deviation of split frequencies: 0.022351 115500 -- (-1154.927) (-1152.978) [-1152.865] (-1157.910) * (-1152.728) (-1157.392) [-1156.725] (-1152.223) -- 0:01:01 116000 -- (-1153.366) [-1158.734] (-1155.363) (-1155.420) * (-1158.776) [-1156.180] (-1155.336) (-1156.762) -- 0:01:00 116500 -- [-1153.228] (-1156.131) (-1160.329) (-1153.992) * (-1154.168) [-1153.935] (-1154.562) (-1151.994) -- 0:01:00 117000 -- (-1154.242) (-1155.987) (-1153.789) [-1153.618] * [-1155.731] (-1152.416) (-1153.196) (-1152.150) -- 0:01:00 117500 -- (-1154.825) [-1155.742] (-1154.260) (-1154.577) * (-1152.278) (-1152.089) [-1153.526] (-1155.691) -- 0:01:00 118000 -- (-1153.864) (-1153.855) [-1153.875] (-1154.399) * [-1153.637] (-1153.275) (-1161.767) (-1156.231) -- 0:00:59 118500 -- (-1154.674) (-1155.661) [-1153.311] (-1153.301) * (-1153.017) (-1153.357) [-1155.955] (-1154.815) -- 0:00:59 119000 -- (-1153.924) (-1154.690) [-1154.248] (-1153.259) * (-1152.495) (-1155.335) [-1153.396] (-1155.786) -- 0:00:59 119500 -- [-1153.162] (-1156.269) (-1153.256) (-1154.298) * (-1152.103) (-1154.660) (-1156.014) [-1152.964] -- 0:00:58 120000 -- (-1156.340) [-1154.591] (-1156.276) (-1157.663) * [-1152.568] (-1154.687) (-1153.223) (-1156.485) -- 0:00:58 Average standard deviation of split frequencies: 0.024026 120500 -- (-1154.802) (-1155.727) (-1152.520) [-1153.390] * (-1152.574) (-1154.106) (-1156.074) [-1156.173] -- 0:00:58 121000 -- (-1153.981) (-1156.537) [-1154.481] (-1154.446) * [-1152.557] (-1153.214) (-1155.162) (-1157.116) -- 0:00:58 121500 -- (-1158.288) [-1159.770] (-1155.863) (-1155.955) * [-1153.079] (-1154.100) (-1155.024) (-1152.209) -- 0:00:57 122000 -- (-1154.155) [-1154.201] (-1153.050) (-1154.858) * [-1156.887] (-1154.454) (-1155.581) (-1153.923) -- 0:00:57 122500 -- (-1156.108) [-1153.044] (-1153.460) (-1155.884) * (-1154.406) (-1154.448) [-1154.277] (-1154.811) -- 0:00:57 123000 -- (-1157.036) [-1163.303] (-1153.234) (-1152.917) * [-1153.954] (-1152.972) (-1153.439) (-1153.387) -- 0:00:57 123500 -- (-1157.153) [-1156.441] (-1153.450) (-1156.483) * (-1153.861) [-1156.722] (-1152.179) (-1153.389) -- 0:00:56 124000 -- (-1158.182) [-1153.597] (-1152.891) (-1157.365) * (-1155.204) (-1154.058) (-1153.183) [-1154.355] -- 0:00:56 124500 -- [-1157.500] (-1152.596) (-1156.606) (-1157.126) * (-1154.453) (-1152.444) [-1154.535] (-1153.434) -- 0:00:56 125000 -- [-1152.270] (-1152.234) (-1154.521) (-1154.057) * (-1153.335) [-1153.824] (-1154.988) (-1154.470) -- 0:00:56 Average standard deviation of split frequencies: 0.023757 125500 -- (-1154.271) [-1153.421] (-1152.725) (-1155.013) * (-1156.105) (-1155.315) [-1153.844] (-1155.739) -- 0:00:55 126000 -- (-1154.877) [-1153.180] (-1153.132) (-1154.437) * (-1154.383) (-1154.968) [-1153.479] (-1155.709) -- 0:00:55 126500 -- (-1153.618) [-1152.418] (-1152.920) (-1152.807) * (-1156.389) (-1154.211) [-1156.748] (-1156.448) -- 0:01:02 127000 -- [-1153.573] (-1153.783) (-1152.032) (-1153.652) * [-1155.088] (-1154.016) (-1159.229) (-1154.940) -- 0:01:01 127500 -- (-1152.593) (-1152.357) [-1154.291] (-1152.748) * (-1157.130) (-1155.160) (-1152.063) [-1156.005] -- 0:01:01 128000 -- (-1152.854) [-1153.371] (-1155.182) (-1155.459) * (-1156.382) (-1155.559) (-1153.801) [-1155.540] -- 0:01:01 128500 -- (-1153.408) (-1154.521) [-1152.163] (-1158.800) * [-1153.153] (-1155.953) (-1152.990) (-1160.527) -- 0:01:01 129000 -- [-1153.378] (-1158.196) (-1153.508) (-1152.991) * (-1153.947) (-1158.683) [-1152.698] (-1154.076) -- 0:01:00 129500 -- [-1152.128] (-1154.922) (-1153.885) (-1159.162) * (-1153.417) (-1153.922) (-1154.062) [-1155.446] -- 0:01:00 130000 -- [-1153.463] (-1152.325) (-1154.839) (-1160.445) * (-1152.062) (-1153.191) (-1155.799) [-1152.059] -- 0:01:00 Average standard deviation of split frequencies: 0.021466 130500 -- (-1154.007) [-1153.149] (-1153.245) (-1155.593) * (-1152.035) [-1154.933] (-1153.267) (-1154.346) -- 0:00:59 131000 -- (-1154.754) [-1152.928] (-1152.813) (-1154.459) * (-1154.193) (-1155.457) [-1155.609] (-1155.672) -- 0:00:59 131500 -- (-1152.407) (-1157.098) [-1154.808] (-1155.729) * (-1154.588) (-1156.872) (-1158.414) [-1156.139] -- 0:00:59 132000 -- (-1159.870) (-1153.740) (-1156.572) [-1154.637] * (-1159.386) (-1152.352) [-1158.166] (-1152.183) -- 0:00:59 132500 -- (-1161.729) [-1154.757] (-1152.748) (-1154.700) * [-1153.125] (-1152.709) (-1152.789) (-1153.130) -- 0:00:58 133000 -- (-1154.769) [-1152.638] (-1152.280) (-1152.362) * (-1153.183) (-1152.836) [-1153.725] (-1153.609) -- 0:00:58 133500 -- [-1154.232] (-1154.552) (-1156.377) (-1154.830) * [-1152.658] (-1152.621) (-1155.709) (-1154.644) -- 0:00:58 134000 -- (-1153.592) [-1153.458] (-1156.019) (-1157.622) * (-1152.301) (-1154.935) [-1152.653] (-1155.698) -- 0:00:58 134500 -- (-1156.139) [-1153.951] (-1156.985) (-1157.527) * (-1154.390) (-1157.817) [-1158.934] (-1153.215) -- 0:00:57 135000 -- (-1156.212) (-1153.551) (-1158.351) [-1153.871] * (-1153.483) (-1159.940) (-1155.447) [-1157.346] -- 0:00:57 Average standard deviation of split frequencies: 0.020971 135500 -- (-1155.719) (-1152.863) [-1152.713] (-1154.404) * (-1153.788) [-1154.883] (-1155.911) (-1154.932) -- 0:00:57 136000 -- (-1153.432) (-1159.382) (-1156.463) [-1153.007] * [-1157.479] (-1154.849) (-1154.604) (-1152.880) -- 0:00:57 136500 -- [-1158.285] (-1159.878) (-1159.835) (-1152.993) * (-1156.904) (-1154.832) [-1152.706] (-1152.878) -- 0:00:56 137000 -- [-1153.557] (-1153.480) (-1156.134) (-1155.431) * (-1153.823) [-1152.916] (-1154.189) (-1155.973) -- 0:00:56 137500 -- (-1155.212) (-1155.727) (-1161.129) [-1154.518] * [-1154.070] (-1154.335) (-1152.286) (-1154.276) -- 0:00:56 138000 -- [-1155.270] (-1159.257) (-1155.189) (-1155.685) * (-1154.419) [-1152.644] (-1153.809) (-1154.750) -- 0:00:56 138500 -- (-1152.835) (-1157.825) [-1154.456] (-1153.904) * (-1153.753) [-1154.500] (-1154.831) (-1155.124) -- 0:00:55 139000 -- [-1152.966] (-1151.977) (-1154.348) (-1153.548) * (-1152.855) (-1153.899) (-1153.432) [-1152.615] -- 0:00:55 139500 -- (-1152.739) [-1153.477] (-1157.986) (-1153.697) * [-1154.765] (-1152.922) (-1155.354) (-1154.313) -- 0:00:55 140000 -- [-1152.736] (-1152.889) (-1154.274) (-1154.515) * [-1154.611] (-1154.059) (-1157.331) (-1154.157) -- 0:00:55 Average standard deviation of split frequencies: 0.021863 140500 -- (-1155.455) [-1152.709] (-1156.284) (-1153.074) * (-1154.552) (-1153.712) (-1155.598) [-1156.908] -- 0:00:55 141000 -- (-1156.118) [-1152.083] (-1155.742) (-1152.779) * (-1155.214) (-1154.281) [-1154.360] (-1154.152) -- 0:00:54 141500 -- (-1158.369) (-1155.100) [-1155.803] (-1159.389) * [-1155.144] (-1152.417) (-1155.085) (-1153.695) -- 0:00:54 142000 -- (-1154.435) (-1153.969) (-1153.830) [-1156.307] * (-1153.877) [-1152.652] (-1152.953) (-1155.581) -- 0:00:54 142500 -- (-1154.765) (-1152.953) (-1153.148) [-1154.187] * (-1154.076) (-1153.002) (-1152.422) [-1155.362] -- 0:00:54 143000 -- [-1155.398] (-1154.377) (-1152.804) (-1155.137) * (-1153.380) [-1153.320] (-1153.721) (-1152.355) -- 0:00:59 143500 -- (-1152.562) (-1155.866) (-1152.369) [-1153.461] * (-1156.258) (-1154.171) [-1155.684] (-1151.921) -- 0:00:59 144000 -- (-1159.086) (-1155.037) [-1152.659] (-1153.631) * (-1156.659) (-1152.258) [-1152.434] (-1151.947) -- 0:00:59 144500 -- (-1158.091) (-1157.273) (-1152.450) [-1153.171] * [-1155.216] (-1156.233) (-1152.933) (-1151.947) -- 0:00:59 145000 -- (-1154.682) (-1155.824) [-1153.383] (-1153.252) * (-1153.525) (-1153.477) [-1154.468] (-1152.515) -- 0:00:58 Average standard deviation of split frequencies: 0.022140 145500 -- (-1154.808) [-1154.856] (-1151.900) (-1155.191) * (-1153.242) (-1152.892) [-1152.938] (-1152.074) -- 0:00:58 146000 -- (-1153.207) (-1154.114) (-1154.319) [-1153.070] * (-1154.651) (-1155.748) (-1153.001) [-1152.049] -- 0:00:58 146500 -- (-1153.570) (-1156.337) [-1151.851] (-1153.031) * (-1155.176) (-1155.827) [-1154.407] (-1152.376) -- 0:00:58 147000 -- (-1153.091) (-1155.020) [-1153.907] (-1155.184) * (-1155.759) [-1157.534] (-1152.720) (-1154.747) -- 0:00:58 147500 -- [-1154.545] (-1155.155) (-1153.387) (-1154.715) * (-1157.432) (-1153.912) (-1153.281) [-1156.654] -- 0:00:57 148000 -- (-1154.482) (-1153.261) (-1153.877) [-1152.850] * (-1154.482) (-1153.709) (-1153.069) [-1157.761] -- 0:00:57 148500 -- (-1160.504) (-1155.062) [-1154.097] (-1152.915) * (-1156.232) (-1153.011) (-1154.699) [-1154.059] -- 0:00:57 149000 -- (-1153.921) (-1153.478) (-1155.019) [-1152.653] * (-1156.095) (-1152.625) (-1156.299) [-1154.438] -- 0:00:57 149500 -- [-1155.143] (-1153.236) (-1153.940) (-1155.216) * (-1153.461) (-1153.993) (-1154.292) [-1154.268] -- 0:00:56 150000 -- (-1153.310) [-1153.422] (-1153.465) (-1158.263) * (-1151.820) [-1153.391] (-1153.015) (-1153.726) -- 0:00:56 Average standard deviation of split frequencies: 0.021604 150500 -- (-1153.349) [-1152.789] (-1156.929) (-1155.910) * [-1152.327] (-1153.127) (-1153.165) (-1155.634) -- 0:00:56 151000 -- (-1155.700) [-1153.472] (-1152.224) (-1153.579) * [-1152.486] (-1153.027) (-1152.766) (-1154.186) -- 0:00:56 151500 -- [-1153.088] (-1153.816) (-1155.276) (-1154.817) * (-1152.423) [-1152.271] (-1152.791) (-1152.729) -- 0:00:56 152000 -- (-1154.182) (-1154.239) (-1156.129) [-1154.786] * (-1153.173) [-1154.442] (-1158.600) (-1154.931) -- 0:00:55 152500 -- (-1152.951) [-1152.881] (-1154.452) (-1157.508) * (-1154.887) (-1154.249) [-1153.156] (-1153.067) -- 0:00:55 153000 -- (-1157.663) (-1152.709) [-1154.304] (-1154.385) * (-1158.456) (-1154.608) [-1153.418] (-1152.143) -- 0:00:55 153500 -- [-1152.764] (-1153.226) (-1153.713) (-1153.662) * (-1154.251) (-1153.539) [-1153.419] (-1159.003) -- 0:00:55 154000 -- (-1153.049) (-1153.065) (-1153.370) [-1153.737] * (-1153.642) (-1154.948) [-1154.052] (-1162.366) -- 0:00:54 154500 -- [-1153.733] (-1153.228) (-1156.259) (-1154.371) * (-1156.235) (-1154.733) (-1157.387) [-1156.651] -- 0:00:54 155000 -- (-1152.234) (-1156.434) (-1153.955) [-1159.215] * (-1154.299) [-1155.714] (-1154.810) (-1154.124) -- 0:00:54 Average standard deviation of split frequencies: 0.021977 155500 -- [-1152.666] (-1158.237) (-1155.982) (-1157.403) * [-1153.991] (-1158.841) (-1155.849) (-1154.124) -- 0:00:54 156000 -- (-1153.342) (-1160.732) [-1155.372] (-1155.913) * (-1156.337) (-1155.626) (-1153.773) [-1153.075] -- 0:00:54 156500 -- (-1152.371) [-1155.481] (-1153.787) (-1157.005) * (-1155.064) (-1154.664) (-1153.585) [-1152.659] -- 0:00:53 157000 -- (-1153.100) (-1156.298) [-1154.177] (-1154.450) * (-1156.176) [-1155.880] (-1153.982) (-1153.144) -- 0:00:53 157500 -- (-1152.718) [-1157.500] (-1156.847) (-1153.125) * (-1155.064) (-1152.412) (-1153.212) [-1154.902] -- 0:00:53 158000 -- (-1153.597) (-1156.642) (-1156.046) [-1153.550] * [-1154.261] (-1152.237) (-1153.062) (-1152.733) -- 0:00:53 158500 -- (-1154.765) (-1154.420) (-1153.176) [-1154.951] * [-1154.492] (-1153.388) (-1155.465) (-1152.284) -- 0:00:53 159000 -- (-1152.592) (-1153.301) [-1152.271] (-1157.044) * (-1154.623) (-1155.572) (-1153.836) [-1153.717] -- 0:00:58 159500 -- (-1152.576) (-1153.589) [-1152.251] (-1153.140) * [-1154.756] (-1154.144) (-1152.307) (-1157.671) -- 0:00:57 160000 -- [-1153.061] (-1158.830) (-1153.816) (-1154.849) * (-1158.845) (-1158.909) [-1151.945] (-1157.560) -- 0:00:57 Average standard deviation of split frequencies: 0.021872 160500 -- (-1153.705) [-1154.563] (-1153.611) (-1154.728) * (-1163.885) (-1155.918) [-1152.138] (-1155.368) -- 0:00:57 161000 -- (-1154.432) [-1156.152] (-1154.668) (-1154.342) * (-1157.722) (-1153.078) [-1151.923] (-1152.796) -- 0:00:57 161500 -- (-1155.436) [-1153.841] (-1154.005) (-1153.871) * (-1153.742) (-1153.248) [-1152.127] (-1154.635) -- 0:00:57 162000 -- [-1154.335] (-1154.043) (-1155.442) (-1156.970) * [-1152.556] (-1155.698) (-1153.641) (-1152.685) -- 0:00:56 162500 -- [-1155.395] (-1154.416) (-1153.257) (-1156.258) * (-1153.046) (-1153.255) (-1152.530) [-1152.722] -- 0:00:56 163000 -- (-1153.588) (-1156.016) [-1153.198] (-1153.082) * (-1155.283) (-1153.827) [-1152.265] (-1154.888) -- 0:00:56 163500 -- [-1153.303] (-1157.047) (-1155.350) (-1153.562) * [-1156.296] (-1156.699) (-1153.131) (-1153.393) -- 0:00:56 164000 -- (-1160.029) [-1155.744] (-1154.462) (-1153.731) * (-1156.403) (-1155.123) [-1153.554] (-1152.286) -- 0:00:56 164500 -- [-1157.581] (-1155.942) (-1153.649) (-1155.315) * (-1161.051) (-1154.969) [-1152.024] (-1156.704) -- 0:00:55 165000 -- (-1154.211) (-1153.994) [-1152.241] (-1152.293) * (-1156.590) (-1154.026) [-1153.095] (-1152.256) -- 0:00:55 Average standard deviation of split frequencies: 0.019620 165500 -- (-1154.283) (-1153.175) [-1152.826] (-1153.769) * (-1153.153) [-1153.461] (-1158.054) (-1155.858) -- 0:00:55 166000 -- (-1156.318) [-1153.183] (-1155.218) (-1153.852) * [-1154.173] (-1154.286) (-1156.517) (-1152.466) -- 0:00:55 166500 -- (-1155.286) (-1155.771) [-1154.289] (-1152.628) * (-1153.242) [-1151.991] (-1158.460) (-1153.217) -- 0:00:55 167000 -- [-1156.121] (-1155.046) (-1153.349) (-1154.598) * (-1153.668) [-1152.754] (-1154.693) (-1155.599) -- 0:00:54 167500 -- [-1153.602] (-1157.838) (-1154.081) (-1152.661) * (-1153.296) [-1152.228] (-1154.711) (-1155.737) -- 0:00:54 168000 -- [-1153.821] (-1154.442) (-1157.027) (-1152.404) * (-1156.860) [-1152.498] (-1152.920) (-1154.875) -- 0:00:54 168500 -- [-1157.349] (-1153.055) (-1154.653) (-1153.842) * (-1156.868) [-1152.923] (-1159.777) (-1154.635) -- 0:00:54 169000 -- (-1155.354) [-1154.418] (-1154.594) (-1155.061) * (-1153.387) [-1154.116] (-1155.099) (-1154.054) -- 0:00:54 169500 -- [-1154.185] (-1153.584) (-1152.974) (-1156.167) * (-1153.180) (-1155.471) (-1154.226) [-1157.222] -- 0:00:53 170000 -- (-1153.520) (-1155.367) [-1152.968] (-1152.530) * [-1153.386] (-1156.706) (-1154.027) (-1155.146) -- 0:00:53 Average standard deviation of split frequencies: 0.017494 170500 -- (-1155.334) (-1154.917) [-1153.320] (-1155.477) * [-1153.232] (-1152.934) (-1153.040) (-1156.495) -- 0:00:53 171000 -- (-1155.439) (-1152.545) [-1152.491] (-1153.374) * (-1153.623) [-1152.985] (-1157.033) (-1157.072) -- 0:00:53 171500 -- (-1157.445) (-1156.470) (-1152.258) [-1155.930] * [-1153.014] (-1154.065) (-1153.999) (-1154.104) -- 0:00:53 172000 -- (-1157.337) [-1157.498] (-1152.272) (-1157.414) * (-1155.752) (-1153.251) [-1154.279] (-1152.921) -- 0:00:52 172500 -- (-1157.307) (-1154.922) [-1152.657] (-1158.849) * (-1155.711) [-1151.921] (-1153.379) (-1153.281) -- 0:00:52 173000 -- (-1157.097) (-1154.566) (-1152.964) [-1153.151] * (-1154.295) (-1154.313) (-1155.491) [-1155.697] -- 0:00:52 173500 -- (-1155.369) (-1157.326) (-1152.940) [-1155.434] * [-1154.208] (-1155.078) (-1154.738) (-1155.206) -- 0:00:52 174000 -- [-1157.489] (-1154.960) (-1154.468) (-1154.155) * (-1158.766) [-1152.297] (-1152.267) (-1154.084) -- 0:00:52 174500 -- (-1153.919) (-1153.387) [-1152.255] (-1152.958) * (-1156.980) (-1154.664) [-1152.690] (-1153.545) -- 0:00:52 175000 -- (-1154.047) (-1153.448) (-1153.426) [-1153.729] * (-1153.550) (-1155.044) (-1152.637) [-1153.204] -- 0:00:51 Average standard deviation of split frequencies: 0.016679 175500 -- (-1154.490) (-1154.111) [-1153.412] (-1153.062) * (-1156.503) (-1153.668) [-1153.449] (-1152.608) -- 0:00:56 176000 -- (-1153.960) (-1152.889) (-1153.589) [-1152.382] * (-1155.637) [-1154.471] (-1153.052) (-1156.551) -- 0:00:56 176500 -- (-1152.938) [-1152.797] (-1154.972) (-1153.036) * (-1155.736) (-1155.408) (-1153.879) [-1152.967] -- 0:00:55 177000 -- [-1153.592] (-1153.945) (-1152.091) (-1153.404) * [-1153.479] (-1156.312) (-1154.630) (-1153.124) -- 0:00:55 177500 -- (-1153.120) (-1153.571) (-1152.305) [-1152.703] * (-1158.095) [-1154.193] (-1153.683) (-1153.102) -- 0:00:55 178000 -- (-1153.958) (-1153.371) (-1153.608) [-1152.189] * (-1153.236) (-1153.118) (-1154.152) [-1153.845] -- 0:00:55 178500 -- (-1157.718) (-1153.188) (-1151.981) [-1152.493] * [-1153.961] (-1153.944) (-1152.989) (-1152.561) -- 0:00:55 179000 -- [-1154.801] (-1159.813) (-1152.728) (-1153.138) * [-1153.789] (-1160.415) (-1152.475) (-1154.021) -- 0:00:55 179500 -- (-1156.495) (-1153.379) [-1155.843] (-1154.327) * [-1153.274] (-1154.479) (-1154.179) (-1159.576) -- 0:00:54 180000 -- (-1155.548) [-1156.157] (-1155.115) (-1152.984) * (-1154.981) [-1152.515] (-1154.536) (-1157.983) -- 0:00:54 Average standard deviation of split frequencies: 0.017790 180500 -- [-1153.740] (-1157.903) (-1155.344) (-1154.485) * (-1155.573) (-1153.554) [-1153.594] (-1154.452) -- 0:00:54 181000 -- [-1153.688] (-1157.605) (-1155.264) (-1153.594) * (-1156.235) (-1154.899) [-1153.652] (-1153.586) -- 0:00:54 181500 -- [-1155.385] (-1156.170) (-1152.650) (-1153.111) * (-1154.317) (-1153.966) [-1154.189] (-1152.693) -- 0:00:54 182000 -- (-1156.054) [-1152.504] (-1153.957) (-1153.165) * (-1154.371) [-1154.391] (-1154.245) (-1153.607) -- 0:00:53 182500 -- (-1159.878) (-1152.745) (-1155.425) [-1155.080] * (-1152.864) (-1155.507) [-1153.642] (-1152.751) -- 0:00:53 183000 -- (-1158.608) (-1155.428) (-1153.455) [-1156.014] * (-1153.023) (-1154.104) (-1153.324) [-1155.424] -- 0:00:53 183500 -- (-1159.568) (-1152.963) [-1152.743] (-1155.365) * [-1152.550] (-1160.628) (-1153.028) (-1152.644) -- 0:00:53 184000 -- [-1158.101] (-1153.276) (-1154.149) (-1157.297) * (-1152.396) (-1160.972) [-1152.790] (-1153.409) -- 0:00:53 184500 -- [-1157.089] (-1153.329) (-1155.690) (-1152.333) * (-1153.685) (-1158.841) [-1153.821] (-1153.802) -- 0:00:53 185000 -- [-1157.151] (-1153.460) (-1157.620) (-1152.199) * (-1155.668) [-1152.665] (-1153.699) (-1155.481) -- 0:00:52 Average standard deviation of split frequencies: 0.017280 185500 -- (-1154.315) [-1154.320] (-1154.368) (-1153.281) * [-1155.443] (-1155.984) (-1154.154) (-1153.875) -- 0:00:52 186000 -- (-1154.308) [-1153.442] (-1157.219) (-1155.717) * [-1154.232] (-1155.383) (-1154.056) (-1152.947) -- 0:00:52 186500 -- (-1153.154) (-1153.146) (-1155.095) [-1153.484] * (-1156.707) (-1152.680) (-1152.760) [-1152.970] -- 0:00:52 187000 -- (-1154.723) (-1152.734) [-1156.410] (-1156.077) * (-1155.946) (-1151.855) [-1152.830] (-1158.706) -- 0:00:52 187500 -- (-1154.468) (-1153.670) (-1153.431) [-1155.044] * [-1157.504] (-1153.522) (-1154.374) (-1153.401) -- 0:00:52 188000 -- (-1159.630) [-1153.196] (-1157.886) (-1154.421) * (-1153.679) (-1151.962) [-1155.945] (-1153.674) -- 0:00:51 188500 -- (-1155.286) [-1152.255] (-1152.922) (-1152.592) * [-1154.541] (-1152.405) (-1152.832) (-1154.370) -- 0:00:51 189000 -- (-1153.717) (-1153.576) (-1152.228) [-1152.861] * (-1158.959) (-1153.232) (-1153.328) [-1155.845] -- 0:00:51 189500 -- (-1153.583) (-1155.363) (-1154.290) [-1153.222] * (-1154.126) (-1154.756) [-1154.375] (-1163.218) -- 0:00:51 190000 -- (-1155.158) (-1155.288) (-1154.926) [-1153.351] * (-1155.148) [-1152.497] (-1153.272) (-1157.114) -- 0:00:51 Average standard deviation of split frequencies: 0.016633 190500 -- (-1153.097) [-1154.336] (-1153.098) (-1154.537) * (-1156.879) [-1152.542] (-1153.265) (-1155.975) -- 0:00:50 191000 -- (-1153.316) (-1154.320) (-1154.087) [-1153.428] * [-1155.648] (-1155.127) (-1154.128) (-1156.327) -- 0:00:55 191500 -- (-1152.271) [-1152.992] (-1152.056) (-1152.238) * [-1154.254] (-1154.144) (-1153.047) (-1154.232) -- 0:00:54 192000 -- [-1153.236] (-1157.374) (-1152.969) (-1153.259) * [-1154.131] (-1155.626) (-1153.892) (-1152.698) -- 0:00:54 192500 -- (-1156.285) (-1156.737) [-1152.438] (-1153.527) * (-1152.910) [-1154.074] (-1154.503) (-1153.632) -- 0:00:54 193000 -- (-1157.644) (-1156.506) [-1152.665] (-1152.436) * (-1153.082) [-1153.691] (-1152.097) (-1157.235) -- 0:00:54 193500 -- (-1158.783) (-1155.899) [-1154.056] (-1157.646) * [-1155.821] (-1155.473) (-1154.145) (-1154.308) -- 0:00:54 194000 -- (-1161.107) [-1154.113] (-1153.065) (-1154.956) * (-1153.638) [-1152.629] (-1154.384) (-1153.889) -- 0:00:54 194500 -- (-1152.798) (-1154.192) [-1153.887] (-1154.476) * (-1153.474) (-1152.345) (-1155.376) [-1156.441] -- 0:00:53 195000 -- (-1156.801) (-1153.302) [-1152.379] (-1152.828) * [-1153.318] (-1152.415) (-1156.863) (-1154.870) -- 0:00:53 Average standard deviation of split frequencies: 0.016263 195500 -- (-1155.314) [-1153.684] (-1155.609) (-1152.814) * (-1157.087) (-1154.720) (-1156.940) [-1153.880] -- 0:00:53 196000 -- (-1153.967) (-1153.168) (-1152.042) [-1152.679] * (-1157.057) [-1152.392] (-1152.798) (-1152.922) -- 0:00:53 196500 -- (-1154.972) (-1153.083) (-1153.859) [-1152.856] * (-1154.805) (-1152.621) [-1162.076] (-1152.707) -- 0:00:53 197000 -- [-1154.972] (-1152.676) (-1152.913) (-1153.854) * (-1157.221) (-1154.727) (-1156.441) [-1153.211] -- 0:00:52 197500 -- (-1154.101) [-1152.188] (-1152.273) (-1155.415) * (-1153.473) (-1152.919) (-1156.289) [-1152.588] -- 0:00:52 198000 -- (-1154.919) (-1153.836) (-1152.892) [-1152.379] * (-1154.431) [-1153.726] (-1152.274) (-1152.170) -- 0:00:52 198500 -- (-1155.449) (-1154.114) (-1152.577) [-1153.123] * (-1152.898) [-1153.617] (-1152.549) (-1152.571) -- 0:00:52 199000 -- [-1152.679] (-1152.711) (-1156.253) (-1159.719) * (-1155.511) (-1154.313) [-1152.889] (-1153.590) -- 0:00:52 199500 -- (-1153.660) [-1152.779] (-1157.225) (-1154.035) * (-1154.182) [-1153.606] (-1153.142) (-1158.049) -- 0:00:52 200000 -- (-1157.004) [-1152.468] (-1156.843) (-1161.214) * (-1152.834) [-1155.257] (-1152.804) (-1157.147) -- 0:00:51 Average standard deviation of split frequencies: 0.015152 200500 -- [-1153.539] (-1152.749) (-1152.963) (-1153.248) * [-1152.792] (-1154.036) (-1154.231) (-1160.135) -- 0:00:51 201000 -- (-1152.726) (-1152.442) (-1153.466) [-1153.040] * (-1154.462) (-1156.107) [-1154.849] (-1158.201) -- 0:00:51 201500 -- (-1151.991) (-1155.107) (-1153.869) [-1152.525] * (-1159.342) [-1153.656] (-1154.784) (-1154.291) -- 0:00:51 202000 -- (-1153.630) (-1157.810) [-1155.595] (-1153.826) * [-1154.487] (-1155.996) (-1152.408) (-1153.437) -- 0:00:51 202500 -- [-1155.201] (-1154.800) (-1152.094) (-1152.985) * [-1153.240] (-1152.660) (-1152.534) (-1160.572) -- 0:00:51 203000 -- (-1154.199) [-1154.339] (-1152.790) (-1152.794) * (-1153.252) (-1158.222) (-1152.119) [-1153.753] -- 0:00:51 203500 -- (-1152.711) (-1152.977) [-1152.789] (-1155.248) * (-1159.609) (-1154.410) [-1153.976] (-1152.561) -- 0:00:50 204000 -- [-1154.109] (-1152.985) (-1155.199) (-1156.284) * (-1156.626) [-1154.162] (-1157.105) (-1152.797) -- 0:00:50 204500 -- (-1155.745) (-1155.332) (-1155.497) [-1155.555] * (-1158.667) (-1154.187) [-1153.216] (-1157.921) -- 0:00:50 205000 -- (-1153.973) (-1157.842) (-1155.557) [-1158.830] * (-1154.751) [-1152.117] (-1153.261) (-1154.410) -- 0:00:50 Average standard deviation of split frequencies: 0.015692 205500 -- (-1154.029) (-1154.933) (-1156.407) [-1158.180] * [-1155.234] (-1153.345) (-1153.273) (-1155.960) -- 0:00:50 206000 -- [-1152.942] (-1156.731) (-1152.928) (-1152.115) * [-1154.825] (-1155.297) (-1152.949) (-1156.198) -- 0:00:50 206500 -- (-1152.606) [-1160.181] (-1152.600) (-1157.577) * (-1152.964) (-1154.523) [-1152.458] (-1153.017) -- 0:00:53 207000 -- (-1153.274) (-1155.434) (-1152.630) [-1160.000] * (-1151.985) [-1154.853] (-1152.945) (-1154.645) -- 0:00:53 207500 -- (-1156.005) (-1155.840) [-1152.630] (-1152.760) * (-1151.881) (-1154.161) (-1153.369) [-1157.041] -- 0:00:53 208000 -- (-1153.065) (-1157.288) [-1152.633] (-1153.958) * [-1152.783] (-1154.126) (-1154.274) (-1152.714) -- 0:00:53 208500 -- (-1153.295) (-1159.629) (-1154.120) [-1155.181] * [-1154.197] (-1153.689) (-1153.242) (-1154.452) -- 0:00:53 209000 -- [-1154.785] (-1160.340) (-1156.341) (-1158.637) * (-1155.667) [-1155.130] (-1153.169) (-1153.128) -- 0:00:52 209500 -- (-1154.573) [-1155.718] (-1155.022) (-1157.744) * (-1153.158) (-1155.629) [-1153.226] (-1154.269) -- 0:00:52 210000 -- (-1153.092) (-1153.776) [-1153.363] (-1155.847) * (-1154.751) (-1154.039) [-1154.904] (-1154.474) -- 0:00:52 Average standard deviation of split frequencies: 0.016303 210500 -- (-1158.480) (-1155.962) (-1152.942) [-1153.893] * (-1152.200) [-1157.925] (-1153.807) (-1152.959) -- 0:00:52 211000 -- (-1153.930) [-1153.052] (-1152.354) (-1157.214) * (-1154.157) (-1153.586) (-1152.264) [-1153.723] -- 0:00:52 211500 -- (-1152.820) [-1154.183] (-1153.844) (-1157.380) * (-1155.149) [-1153.163] (-1152.923) (-1153.187) -- 0:00:52 212000 -- (-1152.945) [-1154.328] (-1154.916) (-1154.192) * [-1154.320] (-1153.234) (-1152.923) (-1154.066) -- 0:00:52 212500 -- (-1152.555) (-1154.387) (-1157.632) [-1152.715] * [-1153.850] (-1153.024) (-1152.409) (-1160.387) -- 0:00:51 213000 -- (-1152.422) (-1155.260) [-1156.082] (-1153.673) * [-1151.924] (-1152.598) (-1153.514) (-1154.948) -- 0:00:51 213500 -- (-1152.749) (-1156.355) (-1154.522) [-1152.806] * (-1153.252) [-1153.933] (-1153.209) (-1154.433) -- 0:00:51 214000 -- (-1157.487) [-1152.388] (-1152.810) (-1153.782) * (-1152.891) (-1155.290) (-1152.928) [-1152.273] -- 0:00:51 214500 -- [-1152.410] (-1155.403) (-1154.023) (-1152.908) * [-1152.847] (-1156.516) (-1152.505) (-1154.971) -- 0:00:51 215000 -- (-1152.630) (-1154.103) [-1155.788] (-1153.175) * [-1153.402] (-1155.881) (-1152.378) (-1154.526) -- 0:00:51 Average standard deviation of split frequencies: 0.018083 215500 -- [-1152.321] (-1155.587) (-1152.433) (-1156.080) * (-1155.046) (-1153.274) (-1152.120) [-1153.973] -- 0:00:50 216000 -- [-1155.198] (-1154.818) (-1152.840) (-1157.491) * (-1157.311) (-1153.601) [-1152.475] (-1155.086) -- 0:00:50 216500 -- [-1152.115] (-1155.471) (-1152.477) (-1156.262) * (-1153.118) [-1157.795] (-1153.285) (-1154.786) -- 0:00:50 217000 -- (-1155.625) [-1156.025] (-1153.962) (-1154.002) * [-1154.081] (-1156.064) (-1158.327) (-1156.027) -- 0:00:50 217500 -- (-1155.939) [-1154.846] (-1153.562) (-1153.911) * (-1155.555) (-1154.295) [-1156.194] (-1153.070) -- 0:00:50 218000 -- (-1153.879) (-1153.886) [-1152.343] (-1152.657) * (-1158.244) (-1153.635) [-1153.774] (-1154.720) -- 0:00:50 218500 -- (-1153.865) (-1153.764) [-1153.375] (-1152.633) * (-1155.854) (-1155.611) [-1153.120] (-1154.079) -- 0:00:50 219000 -- (-1154.280) [-1153.503] (-1152.824) (-1155.232) * (-1154.793) (-1152.651) [-1153.573] (-1152.397) -- 0:00:49 219500 -- (-1155.038) (-1152.513) (-1152.324) [-1152.460] * (-1154.583) (-1153.093) (-1153.941) [-1152.254] -- 0:00:49 220000 -- (-1157.913) [-1152.897] (-1152.156) (-1152.699) * [-1155.266] (-1156.522) (-1156.856) (-1152.746) -- 0:00:49 Average standard deviation of split frequencies: 0.018777 220500 -- (-1157.853) (-1153.175) [-1153.959] (-1158.174) * [-1154.740] (-1154.637) (-1154.581) (-1154.422) -- 0:00:49 221000 -- [-1154.629] (-1153.151) (-1154.518) (-1153.843) * (-1155.636) [-1153.717] (-1155.450) (-1159.863) -- 0:00:49 221500 -- (-1153.346) [-1153.281] (-1153.179) (-1153.674) * (-1156.016) (-1155.478) (-1152.880) [-1153.464] -- 0:00:49 222000 -- [-1152.751] (-1157.395) (-1153.955) (-1152.361) * (-1157.511) (-1152.244) [-1154.905] (-1153.194) -- 0:00:49 222500 -- (-1154.810) [-1154.168] (-1152.736) (-1153.865) * (-1154.322) (-1155.967) (-1154.095) [-1153.386] -- 0:00:48 223000 -- (-1155.309) (-1158.770) [-1152.388] (-1154.513) * [-1154.907] (-1154.649) (-1152.463) (-1154.256) -- 0:00:52 223500 -- (-1152.694) [-1153.456] (-1153.303) (-1153.232) * (-1153.371) (-1156.190) [-1152.803] (-1154.651) -- 0:00:52 224000 -- [-1153.824] (-1152.938) (-1153.101) (-1156.279) * (-1158.054) (-1155.604) (-1154.650) [-1153.794] -- 0:00:51 224500 -- (-1154.973) [-1152.904] (-1152.853) (-1155.600) * (-1159.008) (-1155.134) (-1157.686) [-1156.707] -- 0:00:51 225000 -- [-1153.947] (-1154.416) (-1156.527) (-1153.848) * (-1152.684) (-1158.270) (-1157.144) [-1156.322] -- 0:00:51 Average standard deviation of split frequencies: 0.018564 225500 -- (-1154.554) [-1154.417] (-1159.827) (-1152.829) * (-1157.150) (-1158.099) [-1152.550] (-1154.209) -- 0:00:51 226000 -- (-1153.818) (-1154.065) (-1154.477) [-1152.818] * (-1153.806) (-1158.844) [-1154.668] (-1154.192) -- 0:00:51 226500 -- (-1153.274) (-1153.551) [-1153.480] (-1153.790) * [-1158.471] (-1158.885) (-1154.252) (-1154.224) -- 0:00:51 227000 -- [-1155.020] (-1153.439) (-1154.533) (-1156.785) * [-1154.834] (-1157.404) (-1153.034) (-1154.422) -- 0:00:51 227500 -- (-1155.392) (-1153.364) (-1153.782) [-1156.178] * (-1152.955) (-1153.620) [-1152.895] (-1154.260) -- 0:00:50 228000 -- [-1153.309] (-1154.521) (-1152.943) (-1154.948) * [-1154.019] (-1154.156) (-1155.146) (-1154.678) -- 0:00:50 228500 -- [-1152.361] (-1154.104) (-1155.914) (-1154.499) * [-1152.715] (-1156.614) (-1156.744) (-1157.169) -- 0:00:50 229000 -- (-1155.148) (-1157.052) [-1155.261] (-1156.669) * (-1155.211) [-1155.213] (-1153.877) (-1153.126) -- 0:00:50 229500 -- (-1156.136) (-1157.219) [-1155.116] (-1161.193) * (-1154.751) [-1157.198] (-1152.695) (-1152.872) -- 0:00:50 230000 -- (-1155.590) (-1152.552) (-1152.179) [-1157.103] * (-1154.633) [-1154.785] (-1155.137) (-1152.313) -- 0:00:50 Average standard deviation of split frequencies: 0.018052 230500 -- (-1155.963) (-1153.417) [-1153.897] (-1154.410) * [-1152.560] (-1152.381) (-1152.210) (-1157.450) -- 0:00:50 231000 -- (-1158.519) (-1154.813) [-1154.957] (-1153.177) * (-1153.674) (-1156.332) [-1152.379] (-1153.928) -- 0:00:49 231500 -- (-1156.728) (-1154.905) (-1154.864) [-1153.148] * (-1157.889) (-1153.931) (-1152.186) [-1152.915] -- 0:00:49 232000 -- [-1155.465] (-1158.113) (-1154.375) (-1156.336) * (-1157.470) (-1160.923) [-1152.911] (-1152.860) -- 0:00:49 232500 -- [-1153.760] (-1158.454) (-1154.420) (-1154.640) * [-1158.541] (-1155.543) (-1154.195) (-1152.627) -- 0:00:49 233000 -- (-1152.258) (-1152.846) (-1159.387) [-1153.913] * (-1157.707) [-1152.085] (-1156.786) (-1153.063) -- 0:00:49 233500 -- (-1152.261) (-1153.285) (-1153.145) [-1155.945] * [-1157.104] (-1153.515) (-1152.686) (-1155.821) -- 0:00:49 234000 -- (-1152.773) [-1154.680] (-1155.449) (-1155.850) * (-1156.872) (-1153.165) [-1152.878] (-1157.315) -- 0:00:49 234500 -- [-1152.347] (-1155.210) (-1154.254) (-1155.090) * (-1153.509) [-1155.924] (-1152.926) (-1154.417) -- 0:00:48 235000 -- (-1153.739) (-1153.149) [-1157.342] (-1156.687) * [-1154.268] (-1162.144) (-1153.278) (-1154.552) -- 0:00:48 Average standard deviation of split frequencies: 0.016097 235500 -- (-1154.044) (-1153.206) (-1153.777) [-1153.826] * (-1154.734) (-1155.354) [-1153.068] (-1154.541) -- 0:00:48 236000 -- (-1152.712) (-1153.364) (-1152.471) [-1152.928] * (-1154.773) (-1154.952) [-1153.124] (-1153.129) -- 0:00:48 236500 -- [-1152.671] (-1155.020) (-1153.368) (-1153.886) * (-1154.318) (-1152.715) [-1153.605] (-1152.299) -- 0:00:48 237000 -- [-1152.742] (-1156.335) (-1154.763) (-1153.346) * [-1154.852] (-1155.454) (-1152.715) (-1156.057) -- 0:00:48 237500 -- (-1155.206) (-1157.259) [-1153.710] (-1155.392) * (-1154.255) [-1157.014] (-1152.987) (-1157.332) -- 0:00:48 238000 -- (-1152.680) (-1153.051) [-1153.244] (-1153.529) * (-1153.686) [-1153.258] (-1155.208) (-1158.387) -- 0:00:48 238500 -- (-1155.273) [-1154.312] (-1155.738) (-1152.266) * (-1153.815) (-1153.426) [-1154.685] (-1155.841) -- 0:00:47 239000 -- (-1152.955) [-1152.010] (-1155.355) (-1152.593) * [-1155.435] (-1156.725) (-1153.800) (-1156.647) -- 0:00:50 239500 -- [-1153.441] (-1154.214) (-1154.200) (-1157.168) * (-1153.534) [-1152.721] (-1154.722) (-1158.659) -- 0:00:50 240000 -- (-1155.380) [-1154.036] (-1157.366) (-1154.153) * [-1154.754] (-1158.289) (-1160.042) (-1152.573) -- 0:00:50 Average standard deviation of split frequencies: 0.015900 240500 -- [-1153.722] (-1153.682) (-1155.433) (-1157.172) * (-1153.122) (-1155.660) [-1154.118] (-1154.731) -- 0:00:50 241000 -- [-1154.654] (-1158.514) (-1154.570) (-1156.333) * (-1155.501) (-1156.132) (-1153.216) [-1155.015] -- 0:00:50 241500 -- [-1153.542] (-1158.894) (-1154.976) (-1156.701) * (-1152.152) (-1152.161) [-1153.219] (-1157.965) -- 0:00:50 242000 -- (-1153.190) [-1159.641] (-1156.592) (-1155.601) * (-1152.224) [-1154.354] (-1154.709) (-1161.246) -- 0:00:50 242500 -- (-1153.059) (-1157.187) (-1154.692) [-1156.650] * (-1153.060) (-1152.413) (-1154.120) [-1155.989] -- 0:00:49 243000 -- (-1152.849) (-1153.946) (-1155.421) [-1153.603] * (-1154.795) [-1152.346] (-1156.681) (-1155.009) -- 0:00:49 243500 -- (-1152.729) (-1156.476) [-1154.387] (-1156.391) * (-1153.761) (-1152.647) [-1156.248] (-1153.527) -- 0:00:49 244000 -- (-1156.177) [-1152.502] (-1153.331) (-1152.709) * [-1152.671] (-1153.863) (-1158.593) (-1153.388) -- 0:00:49 244500 -- (-1156.192) [-1155.291] (-1153.865) (-1152.544) * [-1153.397] (-1153.185) (-1154.662) (-1154.003) -- 0:00:49 245000 -- [-1155.929] (-1152.019) (-1152.419) (-1155.022) * (-1153.406) [-1152.830] (-1152.921) (-1153.460) -- 0:00:49 Average standard deviation of split frequencies: 0.018457 245500 -- (-1154.307) [-1153.495] (-1153.133) (-1157.115) * (-1152.262) (-1152.197) (-1153.355) [-1153.149] -- 0:00:49 246000 -- [-1154.107] (-1152.877) (-1153.127) (-1155.585) * (-1156.787) [-1152.055] (-1154.243) (-1153.716) -- 0:00:49 246500 -- [-1155.498] (-1152.193) (-1151.847) (-1153.725) * (-1152.813) [-1152.613] (-1152.373) (-1154.367) -- 0:00:48 247000 -- (-1157.147) (-1152.527) (-1153.864) [-1155.978] * (-1156.744) (-1154.208) (-1155.015) [-1153.381] -- 0:00:48 247500 -- [-1155.773] (-1152.451) (-1153.151) (-1156.123) * (-1155.806) (-1153.973) (-1152.800) [-1153.203] -- 0:00:48 248000 -- (-1152.695) [-1153.465] (-1152.716) (-1153.051) * (-1154.754) (-1156.276) (-1152.857) [-1154.034] -- 0:00:48 248500 -- [-1154.112] (-1152.893) (-1153.758) (-1152.950) * (-1154.575) (-1152.613) (-1154.554) [-1156.070] -- 0:00:48 249000 -- (-1153.824) (-1156.285) [-1156.079] (-1157.937) * (-1153.596) [-1152.414] (-1153.497) (-1154.817) -- 0:00:48 249500 -- (-1154.366) (-1156.601) [-1152.461] (-1160.067) * (-1152.943) (-1153.978) [-1153.362] (-1155.138) -- 0:00:48 250000 -- (-1155.462) [-1157.940] (-1154.443) (-1154.940) * [-1154.863] (-1154.648) (-1156.076) (-1156.803) -- 0:00:48 Average standard deviation of split frequencies: 0.018179 250500 -- [-1153.676] (-1154.266) (-1160.287) (-1153.150) * (-1153.002) (-1159.266) (-1157.882) [-1155.675] -- 0:00:47 251000 -- [-1154.912] (-1152.596) (-1154.654) (-1154.427) * [-1153.473] (-1158.624) (-1153.081) (-1153.979) -- 0:00:47 251500 -- [-1155.179] (-1151.966) (-1154.972) (-1157.294) * (-1153.093) (-1154.219) [-1154.317] (-1155.161) -- 0:00:47 252000 -- (-1155.186) [-1152.234] (-1153.843) (-1154.461) * [-1152.870] (-1153.974) (-1154.248) (-1154.536) -- 0:00:47 252500 -- (-1159.048) (-1153.906) (-1153.199) [-1153.922] * (-1153.407) (-1156.383) [-1154.428] (-1153.417) -- 0:00:47 253000 -- (-1158.785) [-1154.539] (-1153.257) (-1158.653) * (-1154.288) (-1156.272) [-1152.583] (-1153.439) -- 0:00:47 253500 -- (-1156.442) [-1153.799] (-1151.968) (-1155.709) * (-1158.534) (-1152.647) (-1154.343) [-1153.503] -- 0:00:47 254000 -- [-1152.514] (-1153.208) (-1153.009) (-1155.144) * (-1153.747) [-1152.602] (-1157.767) (-1153.132) -- 0:00:46 254500 -- (-1152.464) (-1153.854) [-1152.278] (-1153.184) * (-1153.177) [-1153.060] (-1152.868) (-1154.448) -- 0:00:46 255000 -- [-1153.833] (-1154.651) (-1151.995) (-1153.142) * (-1153.832) (-1151.979) [-1154.653] (-1153.813) -- 0:00:46 Average standard deviation of split frequencies: 0.017903 255500 -- (-1152.088) (-1154.640) [-1151.970] (-1158.603) * [-1153.122] (-1154.328) (-1155.329) (-1153.807) -- 0:00:49 256000 -- (-1153.623) [-1154.164] (-1156.219) (-1153.625) * (-1155.957) [-1153.891] (-1154.721) (-1153.375) -- 0:00:49 256500 -- (-1155.385) [-1155.161] (-1158.543) (-1155.962) * [-1154.605] (-1154.619) (-1152.874) (-1153.048) -- 0:00:49 257000 -- (-1154.276) (-1152.926) (-1153.651) [-1155.420] * [-1153.264] (-1155.120) (-1155.225) (-1154.891) -- 0:00:49 257500 -- (-1153.746) (-1153.627) (-1153.271) [-1155.916] * (-1152.151) [-1153.806] (-1154.537) (-1158.549) -- 0:00:49 258000 -- (-1153.094) (-1154.025) [-1155.239] (-1156.091) * (-1157.217) (-1157.192) [-1155.316] (-1154.466) -- 0:00:48 258500 -- (-1155.682) (-1155.934) (-1154.877) [-1155.368] * [-1152.179] (-1155.542) (-1155.494) (-1162.536) -- 0:00:48 259000 -- [-1158.114] (-1155.196) (-1153.404) (-1159.049) * [-1156.078] (-1157.528) (-1162.735) (-1152.548) -- 0:00:48 259500 -- (-1160.651) (-1152.216) [-1152.856] (-1157.703) * (-1154.109) (-1156.599) [-1155.305] (-1153.211) -- 0:00:48 260000 -- (-1154.024) [-1156.750] (-1154.857) (-1154.598) * (-1160.550) (-1157.350) (-1155.911) [-1154.519] -- 0:00:48 Average standard deviation of split frequencies: 0.016979 260500 -- (-1157.134) (-1153.622) (-1155.400) [-1153.403] * (-1155.414) [-1157.066] (-1156.488) (-1159.384) -- 0:00:48 261000 -- [-1155.656] (-1154.971) (-1154.436) (-1153.859) * (-1154.782) [-1152.415] (-1160.064) (-1156.532) -- 0:00:48 261500 -- (-1152.191) (-1156.497) [-1155.626] (-1154.907) * [-1154.527] (-1152.595) (-1164.347) (-1154.570) -- 0:00:48 262000 -- (-1154.782) [-1154.239] (-1155.138) (-1153.590) * (-1153.335) (-1152.351) [-1159.872] (-1152.521) -- 0:00:47 262500 -- (-1154.038) (-1153.132) (-1155.138) [-1155.075] * (-1154.195) [-1153.375] (-1152.828) (-1155.037) -- 0:00:47 263000 -- [-1153.733] (-1155.678) (-1153.280) (-1157.249) * (-1156.265) [-1153.126] (-1158.550) (-1155.963) -- 0:00:47 263500 -- (-1154.115) [-1155.951] (-1152.089) (-1154.368) * (-1155.501) [-1152.182] (-1157.633) (-1153.371) -- 0:00:47 264000 -- (-1154.503) (-1154.223) (-1153.099) [-1154.074] * (-1155.055) (-1152.971) [-1154.938] (-1153.202) -- 0:00:47 264500 -- [-1156.344] (-1151.892) (-1153.277) (-1153.049) * (-1155.037) (-1152.841) (-1157.550) [-1160.099] -- 0:00:47 265000 -- (-1156.975) (-1153.119) [-1155.084] (-1155.043) * (-1152.455) [-1152.841] (-1152.450) (-1154.527) -- 0:00:47 Average standard deviation of split frequencies: 0.016784 265500 -- (-1157.838) [-1156.268] (-1152.908) (-1157.372) * [-1153.778] (-1158.662) (-1153.631) (-1155.486) -- 0:00:47 266000 -- (-1153.153) (-1158.171) [-1152.485] (-1156.044) * (-1155.151) (-1154.896) (-1153.469) [-1154.383] -- 0:00:46 266500 -- (-1152.920) (-1157.529) (-1152.723) [-1154.002] * (-1152.968) (-1155.181) (-1153.378) [-1153.466] -- 0:00:46 267000 -- (-1153.293) [-1153.996] (-1153.786) (-1152.439) * [-1155.656] (-1152.978) (-1155.974) (-1156.983) -- 0:00:46 267500 -- (-1154.767) (-1154.564) (-1155.153) [-1155.082] * (-1153.666) [-1152.840] (-1157.486) (-1153.852) -- 0:00:46 268000 -- [-1152.411] (-1153.487) (-1154.915) (-1155.503) * [-1153.130] (-1153.247) (-1155.245) (-1154.147) -- 0:00:46 268500 -- [-1153.046] (-1154.938) (-1155.071) (-1152.980) * (-1155.789) (-1154.410) [-1153.013] (-1154.193) -- 0:00:46 269000 -- [-1154.139] (-1158.014) (-1154.551) (-1154.094) * (-1156.389) [-1153.741] (-1153.994) (-1155.064) -- 0:00:46 269500 -- [-1154.854] (-1155.920) (-1153.875) (-1155.945) * [-1155.625] (-1152.620) (-1152.315) (-1158.068) -- 0:00:46 270000 -- (-1151.963) [-1152.320] (-1156.919) (-1155.877) * (-1153.589) (-1153.303) [-1153.962] (-1157.617) -- 0:00:45 Average standard deviation of split frequencies: 0.016085 270500 -- (-1154.382) (-1152.155) [-1157.863] (-1153.089) * (-1155.044) [-1153.913] (-1155.460) (-1154.682) -- 0:00:45 271000 -- [-1151.787] (-1152.850) (-1155.873) (-1153.504) * (-1152.611) [-1153.182] (-1156.105) (-1153.598) -- 0:00:45 271500 -- [-1151.826] (-1155.333) (-1154.196) (-1153.550) * (-1152.210) (-1152.895) (-1152.392) [-1153.343] -- 0:00:48 272000 -- (-1154.404) [-1153.148] (-1157.862) (-1154.193) * (-1152.425) (-1159.114) (-1153.834) [-1157.807] -- 0:00:48 272500 -- (-1153.350) (-1154.756) [-1157.790] (-1156.795) * (-1156.482) [-1158.070] (-1152.767) (-1156.663) -- 0:00:48 273000 -- [-1153.498] (-1158.704) (-1154.829) (-1155.627) * (-1156.822) (-1152.928) [-1153.037] (-1153.979) -- 0:00:47 273500 -- (-1155.223) (-1153.797) (-1152.915) [-1155.299] * (-1155.168) [-1153.698] (-1155.674) (-1154.248) -- 0:00:47 274000 -- (-1154.421) [-1153.930] (-1154.043) (-1153.263) * (-1155.435) (-1152.732) [-1154.734] (-1155.443) -- 0:00:47 274500 -- (-1160.104) (-1154.633) (-1153.215) [-1154.002] * (-1154.338) (-1153.113) (-1151.778) [-1153.569] -- 0:00:47 275000 -- [-1154.071] (-1151.972) (-1156.368) (-1155.752) * (-1155.597) [-1154.240] (-1151.989) (-1154.272) -- 0:00:47 Average standard deviation of split frequencies: 0.016578 275500 -- (-1154.247) (-1153.181) [-1157.060] (-1155.670) * (-1156.616) (-1155.000) (-1154.920) [-1154.612] -- 0:00:47 276000 -- [-1152.520] (-1153.358) (-1156.038) (-1155.342) * (-1155.400) (-1156.819) (-1156.738) [-1153.252] -- 0:00:47 276500 -- (-1151.881) (-1154.479) [-1153.152] (-1156.678) * (-1159.187) (-1155.270) (-1153.314) [-1152.565] -- 0:00:47 277000 -- [-1152.602] (-1155.377) (-1153.488) (-1155.758) * (-1156.507) [-1152.515] (-1153.315) (-1155.767) -- 0:00:46 277500 -- (-1152.578) (-1154.409) [-1155.338] (-1152.896) * (-1156.390) [-1152.370] (-1154.620) (-1154.746) -- 0:00:46 278000 -- (-1154.478) (-1154.450) (-1156.816) [-1152.340] * (-1157.168) [-1159.555] (-1154.717) (-1152.595) -- 0:00:46 278500 -- (-1156.816) [-1152.610] (-1156.048) (-1152.265) * (-1153.288) (-1152.806) (-1155.336) [-1153.423] -- 0:00:46 279000 -- (-1154.854) (-1153.249) (-1154.831) [-1154.270] * (-1153.118) (-1152.642) (-1156.833) [-1155.175] -- 0:00:46 279500 -- (-1161.511) [-1154.385] (-1155.663) (-1153.396) * (-1155.097) [-1153.557] (-1155.236) (-1157.779) -- 0:00:46 280000 -- (-1153.830) (-1156.834) [-1153.839] (-1154.102) * (-1155.233) (-1154.210) [-1153.200] (-1157.227) -- 0:00:46 Average standard deviation of split frequencies: 0.017586 280500 -- [-1155.069] (-1154.065) (-1155.074) (-1154.272) * [-1152.707] (-1153.989) (-1156.807) (-1163.652) -- 0:00:46 281000 -- (-1154.723) (-1152.618) (-1153.927) [-1158.931] * (-1153.314) (-1152.304) [-1153.377] (-1155.669) -- 0:00:46 281500 -- (-1157.625) [-1153.603] (-1153.550) (-1156.094) * [-1153.899] (-1152.300) (-1153.195) (-1153.384) -- 0:00:45 282000 -- [-1153.848] (-1155.420) (-1153.713) (-1152.219) * [-1152.927] (-1152.429) (-1153.484) (-1154.101) -- 0:00:45 282500 -- (-1152.360) [-1153.735] (-1155.975) (-1152.978) * (-1155.335) (-1153.899) (-1157.255) [-1153.894] -- 0:00:45 283000 -- [-1153.282] (-1155.174) (-1155.885) (-1153.414) * (-1154.006) (-1153.375) (-1158.304) [-1152.769] -- 0:00:45 283500 -- [-1155.139] (-1154.377) (-1153.880) (-1154.684) * (-1154.410) [-1156.172] (-1158.352) (-1154.804) -- 0:00:45 284000 -- (-1152.392) (-1155.684) (-1153.556) [-1160.285] * [-1152.473] (-1153.981) (-1156.967) (-1156.097) -- 0:00:45 284500 -- (-1152.717) (-1155.883) (-1153.212) [-1153.379] * (-1152.062) (-1153.665) [-1153.889] (-1155.185) -- 0:00:45 285000 -- (-1153.320) [-1154.175] (-1153.748) (-1155.265) * (-1153.741) (-1152.738) [-1154.553] (-1155.149) -- 0:00:45 Average standard deviation of split frequencies: 0.018034 285500 -- (-1153.116) [-1156.696] (-1153.429) (-1156.001) * (-1153.603) (-1154.758) [-1156.211] (-1153.518) -- 0:00:45 286000 -- [-1153.447] (-1153.296) (-1152.675) (-1154.828) * [-1156.185] (-1155.945) (-1156.541) (-1152.975) -- 0:00:44 286500 -- [-1153.679] (-1152.837) (-1157.579) (-1153.501) * [-1156.059] (-1154.709) (-1157.871) (-1152.033) -- 0:00:44 287000 -- (-1153.444) [-1153.787] (-1153.477) (-1160.166) * (-1155.431) (-1154.854) (-1153.332) [-1154.263] -- 0:00:44 287500 -- (-1156.177) [-1154.855] (-1155.511) (-1155.353) * (-1155.510) (-1154.658) [-1157.143] (-1158.584) -- 0:00:44 288000 -- (-1159.692) (-1152.913) [-1154.392] (-1153.797) * (-1153.029) (-1156.035) (-1153.237) [-1155.441] -- 0:00:46 288500 -- (-1158.572) [-1153.861] (-1153.034) (-1157.181) * (-1156.182) [-1152.473] (-1154.547) (-1156.486) -- 0:00:46 289000 -- (-1156.498) (-1155.979) (-1153.537) [-1155.443] * [-1153.812] (-1155.541) (-1153.790) (-1155.411) -- 0:00:46 289500 -- (-1155.432) (-1155.985) (-1152.712) [-1153.012] * (-1152.706) (-1152.253) [-1153.400] (-1155.337) -- 0:00:46 290000 -- (-1155.273) (-1158.325) (-1152.976) [-1152.961] * (-1153.763) [-1152.554] (-1154.456) (-1154.223) -- 0:00:46 Average standard deviation of split frequencies: 0.017479 290500 -- (-1153.523) (-1154.327) [-1153.757] (-1153.907) * (-1155.871) (-1154.302) (-1158.616) [-1154.084] -- 0:00:46 291000 -- (-1156.521) (-1154.603) (-1154.596) [-1153.664] * [-1153.553] (-1153.620) (-1156.940) (-1155.235) -- 0:00:46 291500 -- [-1152.399] (-1153.896) (-1154.708) (-1153.880) * (-1152.003) [-1154.800] (-1157.119) (-1155.242) -- 0:00:46 292000 -- (-1155.474) (-1154.039) (-1153.192) [-1152.631] * [-1153.956] (-1155.302) (-1154.451) (-1158.011) -- 0:00:46 292500 -- (-1154.118) (-1153.524) [-1153.196] (-1154.686) * (-1152.881) (-1159.048) [-1158.777] (-1154.996) -- 0:00:45 293000 -- (-1153.198) [-1152.719] (-1152.964) (-1155.418) * (-1152.061) [-1153.298] (-1158.612) (-1153.628) -- 0:00:45 293500 -- (-1159.197) [-1153.662] (-1152.378) (-1152.924) * (-1155.435) [-1154.477] (-1154.332) (-1153.458) -- 0:00:45 294000 -- [-1152.861] (-1154.778) (-1154.407) (-1154.946) * (-1157.115) [-1152.958] (-1153.372) (-1153.005) -- 0:00:45 294500 -- (-1155.149) [-1161.730] (-1155.632) (-1153.987) * (-1155.351) [-1153.029] (-1152.208) (-1152.534) -- 0:00:45 295000 -- (-1153.732) (-1158.822) (-1154.467) [-1154.050] * [-1154.197] (-1155.684) (-1153.234) (-1154.701) -- 0:00:45 Average standard deviation of split frequencies: 0.018830 295500 -- (-1152.726) [-1164.479] (-1157.715) (-1152.417) * (-1157.097) (-1156.551) [-1157.104] (-1157.725) -- 0:00:45 296000 -- (-1153.706) (-1157.110) (-1153.570) [-1153.559] * [-1153.736] (-1155.192) (-1158.947) (-1153.359) -- 0:00:45 296500 -- (-1152.396) (-1157.478) (-1158.320) [-1153.327] * (-1152.775) (-1154.169) [-1154.031] (-1153.856) -- 0:00:45 297000 -- (-1152.064) (-1155.514) [-1153.220] (-1154.679) * (-1152.931) (-1158.906) [-1152.990] (-1156.906) -- 0:00:44 297500 -- (-1153.747) (-1155.916) [-1156.932] (-1154.330) * [-1152.931] (-1155.453) (-1156.856) (-1154.397) -- 0:00:44 298000 -- [-1153.728] (-1155.698) (-1156.700) (-1154.117) * (-1155.383) (-1153.618) (-1156.320) [-1159.906] -- 0:00:44 298500 -- (-1154.459) (-1155.149) [-1153.774] (-1155.641) * [-1153.826] (-1152.693) (-1152.173) (-1164.618) -- 0:00:44 299000 -- [-1152.914] (-1154.057) (-1157.579) (-1155.879) * [-1154.978] (-1152.676) (-1153.426) (-1155.478) -- 0:00:44 299500 -- (-1153.343) (-1159.684) (-1156.625) [-1154.456] * (-1156.591) (-1153.579) (-1153.695) [-1152.612] -- 0:00:44 300000 -- (-1153.324) (-1153.333) (-1155.784) [-1154.562] * [-1156.946] (-1152.924) (-1158.471) (-1153.322) -- 0:00:44 Average standard deviation of split frequencies: 0.017072 300500 -- [-1152.252] (-1153.813) (-1158.103) (-1154.661) * (-1155.197) [-1154.766] (-1153.384) (-1155.136) -- 0:00:44 301000 -- (-1156.131) [-1154.683] (-1155.319) (-1152.299) * [-1154.128] (-1152.685) (-1151.907) (-1155.852) -- 0:00:44 301500 -- (-1158.113) (-1154.585) (-1154.405) [-1153.419] * [-1154.181] (-1154.533) (-1154.454) (-1154.039) -- 0:00:44 302000 -- [-1154.835] (-1153.963) (-1156.232) (-1153.415) * (-1154.042) (-1158.922) (-1154.454) [-1153.868] -- 0:00:43 302500 -- [-1152.383] (-1154.670) (-1153.262) (-1154.499) * [-1155.709] (-1156.876) (-1154.898) (-1155.519) -- 0:00:43 303000 -- (-1151.929) (-1158.439) [-1154.147] (-1155.046) * (-1154.506) [-1153.975] (-1153.991) (-1155.032) -- 0:00:43 303500 -- (-1152.600) (-1153.958) [-1154.729] (-1154.600) * (-1152.567) [-1154.099] (-1155.132) (-1158.469) -- 0:00:43 304000 -- (-1153.937) (-1156.102) [-1155.033] (-1154.983) * (-1153.997) [-1154.006] (-1153.976) (-1153.338) -- 0:00:45 304500 -- (-1159.590) (-1156.314) (-1153.095) [-1153.390] * (-1154.363) (-1152.974) (-1161.782) [-1159.517] -- 0:00:45 305000 -- [-1153.258] (-1154.872) (-1152.716) (-1154.058) * [-1156.666] (-1152.438) (-1159.697) (-1153.775) -- 0:00:45 Average standard deviation of split frequencies: 0.016459 305500 -- [-1152.565] (-1154.687) (-1156.934) (-1153.805) * (-1155.756) (-1155.261) (-1154.670) [-1154.753] -- 0:00:45 306000 -- (-1152.228) (-1156.165) (-1155.121) [-1156.096] * (-1154.154) (-1157.017) (-1153.108) [-1157.617] -- 0:00:45 306500 -- (-1152.760) [-1154.472] (-1153.624) (-1155.075) * (-1155.156) [-1154.426] (-1153.379) (-1154.551) -- 0:00:45 307000 -- [-1154.639] (-1156.171) (-1161.894) (-1155.083) * (-1158.828) (-1159.183) (-1155.267) [-1155.874] -- 0:00:45 307500 -- [-1159.213] (-1153.744) (-1162.623) (-1155.662) * (-1157.070) (-1154.269) (-1153.926) [-1151.899] -- 0:00:45 308000 -- (-1153.803) (-1155.141) (-1153.321) [-1154.697] * (-1154.097) (-1153.064) (-1154.550) [-1152.902] -- 0:00:44 308500 -- (-1155.829) (-1153.670) (-1153.674) [-1155.677] * (-1152.910) (-1155.669) [-1153.513] (-1155.739) -- 0:00:44 309000 -- (-1153.877) (-1153.319) (-1156.208) [-1152.621] * (-1152.008) (-1155.311) (-1152.801) [-1154.412] -- 0:00:44 309500 -- (-1157.362) (-1154.221) (-1153.347) [-1152.675] * [-1152.036] (-1154.652) (-1156.983) (-1153.170) -- 0:00:44 310000 -- (-1157.728) (-1153.973) (-1153.704) [-1152.774] * [-1158.327] (-1157.103) (-1152.696) (-1155.918) -- 0:00:44 Average standard deviation of split frequencies: 0.016212 310500 -- (-1157.289) (-1155.327) (-1155.153) [-1152.730] * (-1152.844) (-1159.120) [-1151.876] (-1154.975) -- 0:00:44 311000 -- (-1156.434) (-1155.968) [-1153.747] (-1154.752) * (-1152.436) (-1154.259) (-1152.832) [-1155.994] -- 0:00:44 311500 -- (-1152.790) [-1152.483] (-1155.999) (-1152.574) * [-1154.324] (-1154.430) (-1154.632) (-1154.301) -- 0:00:44 312000 -- [-1153.747] (-1151.999) (-1158.405) (-1153.545) * (-1154.628) (-1157.306) [-1158.338] (-1153.595) -- 0:00:44 312500 -- (-1153.502) [-1152.004] (-1153.938) (-1153.790) * (-1160.280) (-1160.281) [-1156.448] (-1154.400) -- 0:00:44 313000 -- [-1154.656] (-1155.717) (-1154.996) (-1152.931) * (-1157.513) [-1162.211] (-1155.673) (-1154.536) -- 0:00:43 313500 -- (-1153.211) (-1156.544) [-1157.300] (-1153.515) * (-1157.279) [-1156.938] (-1153.359) (-1153.632) -- 0:00:43 314000 -- [-1152.429] (-1155.826) (-1162.598) (-1156.237) * [-1154.929] (-1154.607) (-1156.902) (-1151.851) -- 0:00:43 314500 -- (-1152.393) (-1153.309) [-1155.551] (-1155.924) * (-1154.627) (-1153.509) [-1154.396] (-1153.069) -- 0:00:43 315000 -- (-1152.168) (-1154.931) (-1153.028) [-1152.652] * (-1154.110) (-1153.497) [-1154.829] (-1152.667) -- 0:00:43 Average standard deviation of split frequencies: 0.017073 315500 -- (-1152.232) [-1152.456] (-1152.574) (-1152.928) * (-1153.665) [-1152.168] (-1153.799) (-1152.741) -- 0:00:43 316000 -- (-1155.116) [-1152.615] (-1156.901) (-1153.897) * [-1156.635] (-1152.432) (-1155.390) (-1152.626) -- 0:00:43 316500 -- (-1161.406) (-1153.970) (-1158.696) [-1152.049] * (-1153.178) (-1154.518) [-1155.481] (-1154.539) -- 0:00:43 317000 -- (-1155.151) [-1158.101] (-1155.877) (-1154.511) * [-1154.266] (-1153.618) (-1153.134) (-1154.877) -- 0:00:43 317500 -- [-1153.830] (-1156.344) (-1152.956) (-1153.645) * [-1154.132] (-1155.009) (-1152.799) (-1154.524) -- 0:00:42 318000 -- (-1152.307) (-1157.891) (-1155.281) [-1153.085] * (-1154.075) [-1155.219] (-1153.488) (-1157.947) -- 0:00:42 318500 -- (-1152.375) [-1156.698] (-1154.997) (-1153.471) * (-1154.302) (-1154.648) [-1153.766] (-1155.738) -- 0:00:42 319000 -- (-1156.710) (-1155.405) [-1154.550] (-1155.122) * (-1154.044) (-1155.437) [-1152.984] (-1156.280) -- 0:00:42 319500 -- (-1154.535) (-1158.239) [-1152.488] (-1155.217) * (-1157.256) (-1155.351) [-1153.975] (-1156.303) -- 0:00:42 320000 -- (-1153.034) (-1155.733) (-1152.696) [-1154.501] * (-1155.361) (-1153.343) [-1153.446] (-1158.119) -- 0:00:44 Average standard deviation of split frequencies: 0.015911 320500 -- [-1156.635] (-1155.614) (-1152.702) (-1154.512) * (-1153.214) (-1158.327) [-1153.046] (-1153.968) -- 0:00:44 321000 -- (-1155.795) (-1157.517) (-1154.717) [-1152.695] * (-1153.945) [-1155.882] (-1153.172) (-1154.242) -- 0:00:44 321500 -- [-1153.388] (-1155.802) (-1153.349) (-1152.844) * (-1155.880) (-1153.980) [-1153.534] (-1155.606) -- 0:00:44 322000 -- (-1154.634) (-1158.897) [-1154.134] (-1154.278) * (-1153.457) (-1152.301) [-1153.075] (-1155.104) -- 0:00:44 322500 -- (-1158.296) (-1154.126) [-1154.735] (-1152.745) * [-1152.603] (-1152.209) (-1151.943) (-1153.728) -- 0:00:44 323000 -- (-1152.628) (-1154.812) [-1152.883] (-1153.008) * (-1152.597) (-1153.489) (-1153.066) [-1153.245] -- 0:00:44 323500 -- (-1153.444) (-1154.188) (-1152.513) [-1153.521] * (-1153.909) [-1154.066] (-1152.612) (-1153.424) -- 0:00:43 324000 -- (-1153.590) [-1154.176] (-1155.385) (-1156.632) * (-1153.859) (-1154.020) (-1153.828) [-1152.924] -- 0:00:43 324500 -- [-1153.508] (-1154.121) (-1159.538) (-1155.092) * (-1155.017) (-1152.773) [-1153.200] (-1154.060) -- 0:00:43 325000 -- (-1160.231) (-1153.533) (-1154.456) [-1153.470] * [-1157.392] (-1152.750) (-1152.442) (-1161.958) -- 0:00:43 Average standard deviation of split frequencies: 0.017182 325500 -- (-1155.353) [-1155.561] (-1152.622) (-1154.281) * (-1154.438) (-1151.887) [-1152.428] (-1153.159) -- 0:00:43 326000 -- (-1154.340) (-1153.171) [-1152.273] (-1153.099) * (-1155.162) (-1153.378) (-1153.160) [-1154.816] -- 0:00:43 326500 -- (-1155.794) (-1154.828) [-1153.123] (-1154.143) * [-1153.044] (-1153.888) (-1153.458) (-1154.153) -- 0:00:43 327000 -- (-1156.638) [-1155.008] (-1155.322) (-1154.012) * [-1152.756] (-1158.256) (-1158.168) (-1152.863) -- 0:00:43 327500 -- (-1154.640) (-1154.484) [-1156.407] (-1155.402) * (-1152.828) (-1154.538) (-1153.842) [-1153.880] -- 0:00:43 328000 -- (-1154.817) (-1154.025) (-1156.522) [-1154.345] * (-1154.081) [-1152.651] (-1154.117) (-1152.948) -- 0:00:43 328500 -- (-1154.834) [-1154.233] (-1158.115) (-1155.589) * (-1154.199) (-1158.815) (-1155.658) [-1154.135] -- 0:00:42 329000 -- (-1153.542) (-1158.054) (-1157.094) [-1152.057] * (-1156.431) (-1154.239) (-1153.094) [-1155.492] -- 0:00:42 329500 -- (-1154.398) (-1157.147) (-1154.270) [-1153.292] * (-1153.674) [-1154.753] (-1158.620) (-1155.304) -- 0:00:42 330000 -- (-1154.292) (-1151.957) (-1154.330) [-1153.988] * [-1152.822] (-1152.761) (-1153.856) (-1152.558) -- 0:00:42 Average standard deviation of split frequencies: 0.016856 330500 -- (-1155.529) [-1152.370] (-1156.362) (-1152.538) * (-1162.067) (-1154.165) [-1151.981] (-1152.123) -- 0:00:42 331000 -- [-1156.270] (-1152.736) (-1154.750) (-1153.215) * (-1156.569) (-1153.862) [-1153.992] (-1152.927) -- 0:00:42 331500 -- [-1153.787] (-1157.092) (-1151.906) (-1152.758) * [-1154.994] (-1154.051) (-1152.032) (-1152.802) -- 0:00:42 332000 -- (-1155.051) (-1153.269) [-1154.201] (-1153.687) * (-1153.533) (-1155.061) (-1151.990) [-1154.150] -- 0:00:42 332500 -- (-1154.496) (-1154.547) [-1154.533] (-1152.245) * [-1157.087] (-1155.447) (-1152.177) (-1154.968) -- 0:00:42 333000 -- [-1153.435] (-1154.536) (-1153.493) (-1154.279) * (-1158.285) (-1154.285) [-1152.098] (-1152.359) -- 0:00:42 333500 -- (-1153.150) (-1154.299) (-1153.695) [-1153.964] * [-1159.158] (-1155.105) (-1152.467) (-1155.309) -- 0:00:41 334000 -- (-1153.600) [-1157.335] (-1153.302) (-1153.195) * [-1153.432] (-1153.263) (-1157.024) (-1155.764) -- 0:00:41 334500 -- (-1153.037) (-1154.081) [-1152.974] (-1153.843) * (-1154.246) (-1153.453) [-1153.537] (-1155.276) -- 0:00:41 335000 -- (-1152.629) (-1152.221) [-1151.966] (-1154.240) * (-1155.367) [-1153.583] (-1158.853) (-1157.973) -- 0:00:41 Average standard deviation of split frequencies: 0.016258 335500 -- (-1153.600) (-1152.702) [-1152.790] (-1153.471) * (-1158.732) [-1154.195] (-1154.235) (-1153.271) -- 0:00:41 336000 -- (-1155.034) (-1152.795) (-1153.279) [-1153.311] * [-1153.303] (-1156.480) (-1154.911) (-1155.435) -- 0:00:41 336500 -- (-1153.738) (-1152.814) (-1152.002) [-1152.988] * [-1154.861] (-1159.660) (-1154.917) (-1152.810) -- 0:00:43 337000 -- (-1156.483) (-1152.493) (-1152.743) [-1153.498] * (-1159.848) [-1156.475] (-1154.459) (-1157.331) -- 0:00:43 337500 -- (-1152.395) (-1153.544) [-1153.444] (-1156.326) * (-1152.579) [-1153.495] (-1153.196) (-1155.994) -- 0:00:43 338000 -- [-1154.281] (-1152.628) (-1152.306) (-1155.295) * [-1155.164] (-1153.876) (-1155.111) (-1152.814) -- 0:00:43 338500 -- (-1153.909) (-1156.917) [-1152.300] (-1153.366) * (-1155.881) [-1153.247] (-1157.512) (-1154.216) -- 0:00:42 339000 -- [-1155.552] (-1157.794) (-1153.133) (-1156.126) * (-1153.643) [-1159.470] (-1157.406) (-1155.388) -- 0:00:42 339500 -- [-1152.780] (-1161.489) (-1153.618) (-1155.872) * [-1154.431] (-1155.994) (-1154.299) (-1152.335) -- 0:00:42 340000 -- (-1153.608) (-1152.694) (-1152.502) [-1155.098] * [-1154.063] (-1153.005) (-1154.405) (-1152.478) -- 0:00:42 Average standard deviation of split frequencies: 0.016605 340500 -- [-1157.335] (-1153.246) (-1152.530) (-1155.118) * (-1160.105) (-1155.630) (-1154.359) [-1152.525] -- 0:00:42 341000 -- [-1156.763] (-1154.791) (-1152.999) (-1155.179) * (-1153.813) (-1159.351) [-1154.807] (-1153.596) -- 0:00:42 341500 -- (-1154.360) (-1155.161) [-1152.610] (-1157.806) * (-1153.665) (-1154.179) (-1155.489) [-1155.278] -- 0:00:42 342000 -- (-1152.779) (-1155.612) [-1153.192] (-1158.598) * (-1155.382) (-1155.551) [-1153.222] (-1155.217) -- 0:00:42 342500 -- [-1151.831] (-1156.341) (-1152.940) (-1155.010) * (-1153.845) (-1152.689) (-1154.767) [-1158.509] -- 0:00:42 343000 -- (-1152.270) (-1154.308) (-1153.531) [-1153.672] * [-1153.378] (-1152.677) (-1154.875) (-1155.274) -- 0:00:42 343500 -- (-1153.087) (-1155.318) (-1155.284) [-1155.457] * (-1153.223) [-1153.696] (-1156.686) (-1155.713) -- 0:00:42 344000 -- (-1152.851) (-1155.903) [-1154.484] (-1155.322) * (-1153.999) [-1152.639] (-1154.452) (-1153.970) -- 0:00:41 344500 -- [-1153.113] (-1157.711) (-1154.934) (-1154.120) * [-1154.068] (-1152.601) (-1156.528) (-1153.431) -- 0:00:41 345000 -- (-1155.285) [-1153.872] (-1154.550) (-1155.847) * (-1153.708) (-1152.602) (-1156.659) [-1152.425] -- 0:00:41 Average standard deviation of split frequencies: 0.016047 345500 -- [-1156.528] (-1152.664) (-1154.515) (-1152.828) * (-1153.852) (-1155.024) (-1157.313) [-1153.812] -- 0:00:41 346000 -- (-1153.420) [-1151.810] (-1152.572) (-1158.295) * [-1153.414] (-1153.691) (-1154.055) (-1153.145) -- 0:00:41 346500 -- (-1152.498) [-1151.824] (-1152.901) (-1153.617) * [-1154.139] (-1153.787) (-1157.345) (-1152.539) -- 0:00:41 347000 -- (-1152.438) [-1151.894] (-1152.282) (-1153.446) * (-1155.370) (-1156.603) [-1154.507] (-1156.124) -- 0:00:41 347500 -- [-1152.521] (-1151.891) (-1152.373) (-1156.326) * [-1156.527] (-1152.706) (-1157.091) (-1153.550) -- 0:00:41 348000 -- (-1153.803) (-1157.201) [-1154.612] (-1153.364) * (-1155.315) (-1155.565) (-1154.680) [-1154.952] -- 0:00:41 348500 -- [-1153.057] (-1160.489) (-1151.813) (-1155.004) * (-1152.810) (-1155.750) (-1153.215) [-1153.164] -- 0:00:41 349000 -- (-1153.123) (-1160.806) (-1157.171) [-1154.165] * (-1153.541) [-1153.687] (-1152.789) (-1154.909) -- 0:00:41 349500 -- (-1153.931) [-1159.044] (-1156.476) (-1155.027) * (-1152.774) (-1155.097) (-1154.110) [-1152.977] -- 0:00:40 350000 -- (-1153.723) (-1158.117) [-1154.670] (-1154.212) * (-1153.447) (-1156.562) (-1155.229) [-1154.702] -- 0:00:40 Average standard deviation of split frequencies: 0.016655 350500 -- [-1155.908] (-1154.320) (-1153.471) (-1154.508) * (-1158.326) (-1155.405) (-1153.529) [-1153.588] -- 0:00:40 351000 -- (-1156.303) [-1153.470] (-1154.666) (-1155.998) * (-1159.173) (-1153.436) (-1153.279) [-1153.155] -- 0:00:40 351500 -- (-1152.619) [-1153.447] (-1154.805) (-1154.248) * (-1153.351) [-1154.671] (-1153.927) (-1153.369) -- 0:00:40 352000 -- (-1153.501) (-1155.524) (-1155.574) [-1154.584] * (-1153.261) [-1152.452] (-1153.934) (-1153.930) -- 0:00:40 352500 -- [-1154.338] (-1155.634) (-1155.437) (-1153.892) * (-1153.369) [-1153.258] (-1155.174) (-1154.856) -- 0:00:40 353000 -- (-1154.950) (-1153.096) (-1153.181) [-1154.679] * (-1155.275) [-1152.844] (-1155.357) (-1155.668) -- 0:00:42 353500 -- (-1154.487) [-1153.500] (-1153.309) (-1153.019) * (-1154.073) (-1153.033) [-1154.421] (-1153.691) -- 0:00:42 354000 -- (-1155.357) (-1158.365) [-1155.780] (-1153.171) * (-1156.538) [-1155.608] (-1154.494) (-1154.924) -- 0:00:41 354500 -- (-1155.079) (-1161.673) (-1153.553) [-1154.082] * (-1162.414) (-1153.266) [-1153.415] (-1153.852) -- 0:00:41 355000 -- [-1154.176] (-1159.997) (-1153.777) (-1152.370) * (-1157.690) (-1152.090) [-1153.823] (-1153.865) -- 0:00:41 Average standard deviation of split frequencies: 0.017141 355500 -- [-1158.264] (-1153.943) (-1155.019) (-1152.921) * [-1154.438] (-1154.647) (-1154.276) (-1154.640) -- 0:00:41 356000 -- (-1156.240) [-1157.235] (-1153.775) (-1153.723) * (-1158.934) (-1157.522) (-1155.891) [-1153.028] -- 0:00:41 356500 -- (-1153.638) (-1153.618) (-1157.359) [-1153.921] * [-1153.344] (-1155.500) (-1152.827) (-1153.905) -- 0:00:41 357000 -- [-1152.248] (-1156.982) (-1155.345) (-1153.280) * [-1156.130] (-1153.743) (-1152.814) (-1156.846) -- 0:00:41 357500 -- (-1152.710) [-1157.363] (-1152.295) (-1154.855) * (-1157.010) [-1157.529] (-1153.173) (-1157.065) -- 0:00:41 358000 -- (-1152.494) [-1156.483] (-1152.188) (-1158.142) * [-1156.992] (-1152.675) (-1156.239) (-1155.900) -- 0:00:41 358500 -- [-1154.032] (-1156.823) (-1153.679) (-1152.947) * [-1153.786] (-1152.763) (-1153.181) (-1154.149) -- 0:00:41 359000 -- (-1154.949) (-1155.254) [-1154.776] (-1157.496) * (-1154.084) (-1156.415) (-1153.230) [-1152.727] -- 0:00:41 359500 -- (-1154.588) (-1155.423) (-1152.754) [-1157.088] * [-1155.013] (-1154.984) (-1152.500) (-1152.634) -- 0:00:40 360000 -- [-1154.349] (-1154.430) (-1153.624) (-1156.412) * [-1153.893] (-1157.892) (-1153.447) (-1154.842) -- 0:00:40 Average standard deviation of split frequencies: 0.016701 360500 -- (-1153.551) [-1152.574] (-1154.830) (-1157.365) * (-1154.482) [-1154.536] (-1154.031) (-1154.315) -- 0:00:40 361000 -- [-1153.037] (-1153.299) (-1156.099) (-1158.600) * (-1157.420) [-1152.456] (-1153.115) (-1154.780) -- 0:00:40 361500 -- [-1152.951] (-1152.903) (-1154.565) (-1156.254) * (-1153.579) (-1154.191) [-1152.835] (-1153.277) -- 0:00:40 362000 -- (-1152.411) (-1154.634) [-1157.512] (-1155.658) * (-1154.879) (-1154.815) (-1154.118) [-1152.218] -- 0:00:40 362500 -- (-1153.276) (-1153.906) (-1156.222) [-1152.921] * (-1154.803) [-1155.524] (-1153.913) (-1154.680) -- 0:00:40 363000 -- (-1152.228) (-1154.948) (-1153.832) [-1152.868] * (-1154.070) (-1154.312) [-1152.747] (-1153.214) -- 0:00:40 363500 -- (-1153.401) [-1155.177] (-1154.946) (-1157.386) * (-1153.375) [-1153.575] (-1154.400) (-1153.934) -- 0:00:40 364000 -- (-1157.697) (-1158.420) (-1154.442) [-1154.689] * (-1160.391) (-1154.120) (-1156.743) [-1154.184] -- 0:00:40 364500 -- [-1154.897] (-1160.152) (-1152.374) (-1155.255) * (-1159.687) (-1153.166) (-1157.366) [-1153.798] -- 0:00:40 365000 -- (-1155.310) (-1158.709) (-1154.986) [-1154.897] * [-1152.656] (-1153.667) (-1155.677) (-1153.157) -- 0:00:40 Average standard deviation of split frequencies: 0.017245 365500 -- [-1154.119] (-1155.657) (-1157.050) (-1153.187) * (-1152.346) [-1154.051] (-1153.062) (-1154.668) -- 0:00:39 366000 -- [-1153.008] (-1152.359) (-1152.431) (-1152.766) * [-1152.213] (-1154.197) (-1158.557) (-1153.717) -- 0:00:39 366500 -- (-1153.764) (-1153.971) (-1152.514) [-1154.770] * [-1152.255] (-1152.714) (-1153.030) (-1154.894) -- 0:00:39 367000 -- (-1153.220) (-1153.325) [-1154.699] (-1153.913) * (-1152.470) (-1155.998) [-1153.728] (-1156.320) -- 0:00:39 367500 -- [-1153.635] (-1153.688) (-1153.974) (-1154.287) * (-1155.284) (-1154.116) (-1153.913) [-1154.492] -- 0:00:39 368000 -- (-1153.378) [-1154.041] (-1154.129) (-1153.422) * (-1153.810) (-1157.221) [-1154.307] (-1153.163) -- 0:00:39 368500 -- [-1153.276] (-1153.142) (-1154.129) (-1152.952) * [-1153.407] (-1153.338) (-1154.512) (-1152.996) -- 0:00:39 369000 -- (-1154.376) (-1153.512) [-1155.611] (-1153.772) * (-1154.080) [-1152.067] (-1153.549) (-1152.100) -- 0:00:41 369500 -- (-1152.758) (-1153.891) [-1154.894] (-1153.557) * [-1153.685] (-1152.373) (-1155.447) (-1152.166) -- 0:00:40 370000 -- (-1154.322) [-1151.988] (-1156.057) (-1153.702) * (-1153.156) (-1154.097) [-1153.549] (-1153.140) -- 0:00:40 Average standard deviation of split frequencies: 0.016604 370500 -- (-1154.471) (-1154.478) (-1154.806) [-1153.179] * (-1152.297) (-1154.399) [-1152.623] (-1155.441) -- 0:00:40 371000 -- (-1154.131) [-1157.704] (-1153.385) (-1153.538) * [-1154.611] (-1153.210) (-1156.210) (-1157.675) -- 0:00:40 371500 -- (-1153.910) [-1158.090] (-1153.452) (-1154.435) * (-1153.816) (-1153.310) (-1155.575) [-1154.177] -- 0:00:40 372000 -- (-1154.902) (-1156.656) (-1153.290) [-1153.838] * [-1152.764] (-1154.077) (-1153.371) (-1152.968) -- 0:00:40 372500 -- (-1153.559) [-1153.579] (-1154.553) (-1153.097) * (-1154.831) [-1156.099] (-1154.148) (-1153.007) -- 0:00:40 373000 -- (-1153.902) (-1152.875) (-1154.891) [-1154.085] * (-1155.412) [-1155.102] (-1155.351) (-1155.146) -- 0:00:40 373500 -- (-1153.667) (-1156.105) [-1154.489] (-1154.872) * [-1153.399] (-1153.556) (-1154.478) (-1152.411) -- 0:00:40 374000 -- (-1154.551) (-1153.557) (-1153.196) [-1152.717] * [-1152.830] (-1153.934) (-1155.461) (-1153.742) -- 0:00:40 374500 -- [-1154.348] (-1153.747) (-1152.164) (-1155.459) * [-1153.321] (-1153.964) (-1158.381) (-1153.388) -- 0:00:40 375000 -- (-1155.492) (-1153.444) (-1152.118) [-1154.859] * (-1153.248) (-1153.081) (-1153.280) [-1153.841] -- 0:00:40 Average standard deviation of split frequencies: 0.016299 375500 -- (-1154.611) (-1157.302) [-1152.633] (-1154.575) * [-1152.556] (-1154.527) (-1159.530) (-1152.695) -- 0:00:39 376000 -- (-1153.276) [-1154.377] (-1155.730) (-1152.215) * (-1153.585) [-1154.396] (-1156.059) (-1152.730) -- 0:00:39 376500 -- [-1154.104] (-1154.541) (-1155.060) (-1153.464) * (-1154.014) (-1155.664) [-1155.732] (-1152.758) -- 0:00:39 377000 -- (-1155.041) [-1153.295] (-1155.804) (-1160.288) * (-1152.916) (-1152.803) [-1155.207] (-1152.587) -- 0:00:39 377500 -- (-1155.033) (-1154.752) (-1155.404) [-1157.744] * [-1153.216] (-1153.965) (-1159.429) (-1152.696) -- 0:00:39 378000 -- (-1153.383) (-1158.394) [-1152.845] (-1157.309) * (-1154.672) (-1153.548) (-1164.500) [-1152.454] -- 0:00:39 378500 -- (-1153.458) (-1153.580) [-1152.491] (-1152.851) * (-1156.892) (-1155.134) [-1159.116] (-1156.811) -- 0:00:39 379000 -- (-1153.497) (-1154.170) (-1152.197) [-1153.556] * (-1152.111) (-1153.894) (-1153.472) [-1152.817] -- 0:00:39 379500 -- (-1153.005) (-1154.659) (-1156.087) [-1155.829] * (-1152.721) [-1155.614] (-1153.498) (-1152.660) -- 0:00:39 380000 -- (-1154.205) (-1153.658) (-1153.410) [-1152.553] * (-1153.184) (-1156.124) (-1154.235) [-1152.042] -- 0:00:39 Average standard deviation of split frequencies: 0.016463 380500 -- (-1154.803) (-1152.560) [-1153.042] (-1153.412) * (-1155.764) (-1152.988) (-1154.417) [-1153.757] -- 0:00:39 381000 -- (-1154.705) (-1156.390) [-1154.797] (-1156.256) * (-1153.338) [-1152.636] (-1153.068) (-1157.596) -- 0:00:38 381500 -- (-1157.013) (-1155.685) (-1158.495) [-1154.541] * (-1153.448) [-1152.007] (-1155.269) (-1155.637) -- 0:00:38 382000 -- [-1158.295] (-1156.998) (-1155.707) (-1157.365) * (-1155.232) (-1154.519) [-1153.625] (-1157.181) -- 0:00:38 382500 -- [-1157.854] (-1153.873) (-1155.657) (-1153.244) * (-1152.206) (-1154.298) (-1154.332) [-1153.608] -- 0:00:38 383000 -- (-1159.482) (-1154.345) (-1157.281) [-1154.529] * [-1152.394] (-1153.738) (-1158.016) (-1154.869) -- 0:00:38 383500 -- (-1155.629) (-1155.033) (-1155.111) [-1153.202] * (-1155.592) [-1156.311] (-1157.355) (-1157.656) -- 0:00:38 384000 -- (-1155.272) (-1153.843) [-1153.383] (-1154.917) * [-1155.944] (-1153.139) (-1154.845) (-1155.073) -- 0:00:38 384500 -- [-1153.029] (-1156.616) (-1154.277) (-1154.038) * (-1154.657) (-1154.451) [-1153.613] (-1158.944) -- 0:00:38 385000 -- (-1153.787) [-1154.394] (-1152.885) (-1155.281) * (-1155.680) (-1155.243) [-1152.769] (-1153.735) -- 0:00:38 Average standard deviation of split frequencies: 0.016451 385500 -- (-1155.702) (-1160.229) (-1152.260) [-1160.862] * [-1155.198] (-1153.502) (-1153.651) (-1155.940) -- 0:00:39 386000 -- [-1154.094] (-1154.509) (-1153.518) (-1155.664) * [-1154.806] (-1153.000) (-1154.679) (-1153.840) -- 0:00:39 386500 -- (-1156.456) (-1156.978) [-1153.806] (-1155.176) * (-1154.685) [-1153.705] (-1153.725) (-1153.555) -- 0:00:39 387000 -- (-1157.783) [-1155.180] (-1153.650) (-1152.169) * (-1161.368) (-1154.200) (-1154.552) [-1155.366] -- 0:00:39 387500 -- (-1154.736) (-1156.150) (-1154.926) [-1153.003] * (-1160.877) (-1153.372) (-1155.392) [-1157.437] -- 0:00:39 388000 -- (-1156.458) (-1154.521) (-1154.423) [-1153.301] * [-1157.480] (-1155.971) (-1154.325) (-1155.304) -- 0:00:39 388500 -- (-1160.643) (-1156.657) (-1153.985) [-1155.423] * (-1152.537) [-1152.898] (-1154.014) (-1156.009) -- 0:00:39 389000 -- (-1155.466) (-1157.421) (-1155.535) [-1154.485] * (-1155.231) (-1153.453) [-1154.091] (-1152.214) -- 0:00:39 389500 -- [-1153.374] (-1153.764) (-1155.689) (-1157.844) * (-1152.822) (-1153.023) (-1155.385) [-1153.247] -- 0:00:39 390000 -- (-1154.309) [-1153.657] (-1153.877) (-1152.910) * [-1153.294] (-1154.820) (-1155.580) (-1152.983) -- 0:00:39 Average standard deviation of split frequencies: 0.016680 390500 -- (-1154.130) (-1156.547) [-1155.585] (-1152.352) * (-1158.579) [-1157.000] (-1156.398) (-1152.590) -- 0:00:39 391000 -- (-1154.795) [-1154.712] (-1158.547) (-1153.525) * [-1154.232] (-1154.560) (-1161.469) (-1155.981) -- 0:00:38 391500 -- (-1156.387) (-1154.524) [-1156.149] (-1153.214) * (-1154.126) (-1153.541) (-1155.968) [-1152.998] -- 0:00:38 392000 -- (-1157.751) (-1155.584) [-1152.024] (-1152.435) * (-1153.727) [-1153.126] (-1153.868) (-1159.375) -- 0:00:38 392500 -- (-1153.274) (-1157.555) [-1153.948] (-1152.591) * [-1152.470] (-1153.021) (-1153.825) (-1153.954) -- 0:00:38 393000 -- (-1157.013) [-1154.561] (-1153.534) (-1153.208) * (-1153.650) [-1153.779] (-1153.088) (-1154.213) -- 0:00:38 393500 -- [-1152.147] (-1154.749) (-1153.718) (-1152.430) * (-1156.512) (-1156.662) [-1153.342] (-1152.633) -- 0:00:38 394000 -- (-1154.269) (-1154.189) (-1152.882) [-1154.561] * [-1156.085] (-1156.122) (-1154.072) (-1152.333) -- 0:00:38 394500 -- (-1153.454) (-1154.121) (-1155.969) [-1153.378] * (-1155.633) [-1155.601] (-1152.933) (-1154.917) -- 0:00:38 395000 -- (-1153.950) (-1158.780) (-1153.875) [-1152.295] * (-1155.079) [-1158.238] (-1154.286) (-1157.090) -- 0:00:38 Average standard deviation of split frequencies: 0.017576 395500 -- (-1154.809) (-1153.907) [-1154.445] (-1154.434) * (-1160.328) (-1155.000) (-1152.134) [-1154.657] -- 0:00:38 396000 -- (-1152.683) [-1154.067] (-1156.581) (-1157.009) * (-1155.391) (-1153.871) [-1156.196] (-1158.618) -- 0:00:38 396500 -- (-1153.804) (-1153.635) [-1154.169] (-1154.182) * (-1154.759) (-1153.815) (-1158.354) [-1158.648] -- 0:00:38 397000 -- (-1154.643) (-1154.585) [-1155.050] (-1154.080) * (-1154.999) [-1153.168] (-1153.081) (-1157.977) -- 0:00:37 397500 -- (-1153.128) [-1153.176] (-1155.171) (-1152.849) * (-1156.804) (-1152.726) [-1153.888] (-1153.730) -- 0:00:37 398000 -- (-1152.827) [-1154.771] (-1158.216) (-1153.579) * (-1153.606) (-1156.185) [-1151.856] (-1152.605) -- 0:00:37 398500 -- (-1153.986) [-1153.086] (-1154.983) (-1153.349) * (-1154.653) (-1155.042) (-1153.154) [-1153.786] -- 0:00:37 399000 -- [-1154.779] (-1153.122) (-1155.365) (-1153.686) * (-1158.777) (-1155.110) (-1152.615) [-1152.560] -- 0:00:37 399500 -- (-1153.391) (-1156.822) [-1153.431] (-1153.870) * (-1154.642) [-1155.634] (-1152.979) (-1157.794) -- 0:00:37 400000 -- [-1154.900] (-1158.918) (-1155.153) (-1154.344) * [-1155.648] (-1155.009) (-1155.129) (-1155.091) -- 0:00:37 Average standard deviation of split frequencies: 0.017025 400500 -- [-1156.003] (-1160.376) (-1153.258) (-1156.078) * (-1155.861) (-1154.420) [-1153.553] (-1154.120) -- 0:00:37 401000 -- (-1156.698) (-1159.903) [-1155.175] (-1156.794) * (-1163.417) [-1154.683] (-1151.749) (-1153.948) -- 0:00:37 401500 -- (-1153.513) (-1156.750) (-1156.781) [-1153.121] * (-1153.959) [-1153.387] (-1153.878) (-1153.930) -- 0:00:38 402000 -- [-1152.220] (-1157.047) (-1154.160) (-1152.739) * (-1154.289) (-1152.773) (-1155.897) [-1154.630] -- 0:00:38 402500 -- (-1154.628) (-1157.672) [-1152.899] (-1152.283) * (-1158.099) (-1155.452) (-1157.020) [-1152.504] -- 0:00:38 403000 -- [-1151.986] (-1154.787) (-1153.660) (-1152.762) * (-1156.053) [-1153.723] (-1153.387) (-1154.563) -- 0:00:38 403500 -- (-1154.430) (-1157.979) [-1152.916] (-1153.895) * (-1152.727) (-1154.726) [-1155.388] (-1153.501) -- 0:00:38 404000 -- (-1157.570) [-1153.049] (-1155.060) (-1154.208) * [-1153.065] (-1155.249) (-1154.976) (-1157.636) -- 0:00:38 404500 -- (-1157.043) [-1152.285] (-1158.552) (-1154.638) * (-1153.894) [-1155.346] (-1154.559) (-1158.174) -- 0:00:38 405000 -- (-1155.281) (-1154.318) [-1153.731] (-1156.607) * (-1153.653) (-1155.271) [-1154.173] (-1155.795) -- 0:00:38 Average standard deviation of split frequencies: 0.017280 405500 -- (-1154.067) (-1153.851) [-1152.576] (-1154.137) * (-1154.643) (-1152.685) (-1153.466) [-1152.752] -- 0:00:38 406000 -- [-1154.661] (-1157.100) (-1152.487) (-1154.961) * (-1153.044) (-1154.464) (-1153.501) [-1152.909] -- 0:00:38 406500 -- (-1154.533) (-1152.046) [-1153.593] (-1160.402) * (-1157.073) (-1154.059) (-1157.432) [-1152.674] -- 0:00:37 407000 -- (-1153.301) (-1154.124) (-1154.102) [-1157.793] * [-1154.727] (-1153.400) (-1155.223) (-1154.755) -- 0:00:37 407500 -- (-1152.401) (-1154.332) (-1154.350) [-1154.249] * (-1153.226) (-1158.646) (-1152.039) [-1153.722] -- 0:00:37 408000 -- [-1154.042] (-1156.144) (-1154.624) (-1154.178) * [-1153.586] (-1156.867) (-1152.193) (-1158.652) -- 0:00:37 408500 -- (-1153.708) [-1153.462] (-1154.866) (-1156.853) * [-1157.859] (-1164.888) (-1152.508) (-1156.120) -- 0:00:37 409000 -- [-1154.833] (-1155.472) (-1154.648) (-1155.081) * (-1157.281) (-1161.699) [-1152.724] (-1160.659) -- 0:00:37 409500 -- [-1154.274] (-1153.646) (-1152.875) (-1158.073) * [-1153.542] (-1154.928) (-1153.013) (-1154.125) -- 0:00:37 410000 -- (-1155.233) (-1156.357) [-1155.900] (-1156.395) * [-1155.483] (-1158.510) (-1152.628) (-1155.180) -- 0:00:37 Average standard deviation of split frequencies: 0.018434 410500 -- [-1152.475] (-1154.148) (-1157.634) (-1156.741) * (-1156.022) [-1155.222] (-1152.563) (-1154.674) -- 0:00:37 411000 -- (-1153.897) (-1157.247) (-1158.000) [-1153.223] * [-1154.121] (-1154.946) (-1155.907) (-1154.867) -- 0:00:37 411500 -- (-1153.489) (-1160.659) [-1157.248] (-1159.024) * [-1152.001] (-1157.722) (-1155.501) (-1152.429) -- 0:00:37 412000 -- (-1153.465) (-1155.963) [-1154.020] (-1156.454) * (-1151.728) [-1157.524] (-1157.005) (-1154.065) -- 0:00:37 412500 -- (-1155.622) [-1156.119] (-1154.118) (-1153.526) * (-1152.795) [-1153.062] (-1158.945) (-1156.722) -- 0:00:37 413000 -- [-1154.367] (-1155.981) (-1152.405) (-1154.593) * (-1153.077) (-1153.983) (-1152.540) [-1155.116] -- 0:00:36 413500 -- [-1153.424] (-1153.179) (-1156.616) (-1154.275) * (-1153.777) (-1155.327) [-1153.626] (-1157.516) -- 0:00:36 414000 -- (-1153.989) [-1157.046] (-1154.444) (-1155.185) * [-1153.328] (-1153.533) (-1153.223) (-1153.445) -- 0:00:36 414500 -- (-1153.098) (-1153.206) [-1154.557] (-1158.258) * [-1153.382] (-1153.177) (-1156.133) (-1154.362) -- 0:00:36 415000 -- (-1153.360) (-1153.385) [-1153.356] (-1155.154) * [-1154.482] (-1158.450) (-1159.479) (-1153.345) -- 0:00:36 Average standard deviation of split frequencies: 0.017398 415500 -- (-1155.967) (-1152.580) [-1155.535] (-1156.947) * (-1153.371) (-1157.801) (-1154.763) [-1153.228] -- 0:00:36 416000 -- (-1161.677) [-1154.650] (-1153.543) (-1157.849) * [-1152.747] (-1154.188) (-1158.186) (-1157.521) -- 0:00:36 416500 -- (-1152.570) (-1153.932) (-1154.559) [-1154.036] * (-1154.992) [-1155.037] (-1156.306) (-1153.912) -- 0:00:36 417000 -- (-1151.940) (-1155.160) [-1152.730] (-1156.822) * (-1154.215) (-1155.434) [-1154.696] (-1155.458) -- 0:00:36 417500 -- [-1152.574] (-1153.806) (-1154.709) (-1153.281) * (-1155.639) (-1155.218) [-1154.665] (-1153.858) -- 0:00:36 418000 -- (-1152.352) (-1158.191) [-1152.849] (-1157.400) * (-1159.369) (-1152.815) (-1153.574) [-1154.183] -- 0:00:37 418500 -- [-1152.948] (-1153.711) (-1155.170) (-1158.426) * (-1154.866) (-1154.589) [-1154.323] (-1153.983) -- 0:00:37 419000 -- [-1156.252] (-1153.384) (-1152.295) (-1153.639) * [-1152.994] (-1157.592) (-1153.420) (-1153.398) -- 0:00:37 419500 -- (-1157.462) (-1152.112) [-1156.168] (-1157.794) * [-1156.026] (-1156.433) (-1152.516) (-1154.467) -- 0:00:37 420000 -- (-1164.465) (-1152.283) (-1154.968) [-1157.260] * (-1156.531) (-1151.998) (-1151.988) [-1152.243] -- 0:00:37 Average standard deviation of split frequencies: 0.017271 420500 -- (-1153.898) (-1153.429) (-1157.648) [-1154.548] * (-1155.221) (-1153.078) (-1154.592) [-1152.456] -- 0:00:37 421000 -- (-1153.917) (-1154.792) (-1155.911) [-1153.470] * [-1153.099] (-1154.192) (-1155.074) (-1152.374) -- 0:00:37 421500 -- (-1154.243) (-1158.362) (-1152.451) [-1152.767] * [-1153.799] (-1152.760) (-1153.498) (-1154.050) -- 0:00:37 422000 -- (-1152.597) (-1155.792) (-1157.543) [-1152.396] * (-1153.714) (-1153.703) (-1153.318) [-1153.041] -- 0:00:36 422500 -- [-1153.384] (-1156.519) (-1154.573) (-1152.824) * (-1154.189) [-1155.185] (-1153.494) (-1153.177) -- 0:00:36 423000 -- (-1153.388) [-1155.706] (-1152.551) (-1154.716) * (-1152.859) [-1153.558] (-1155.705) (-1153.885) -- 0:00:36 423500 -- (-1154.110) (-1153.424) (-1155.380) [-1154.909] * (-1157.151) (-1156.494) [-1153.797] (-1155.468) -- 0:00:36 424000 -- [-1153.217] (-1154.940) (-1155.060) (-1155.335) * (-1160.285) (-1153.786) (-1157.057) [-1152.868] -- 0:00:36 424500 -- (-1153.093) (-1153.914) (-1153.189) [-1154.987] * (-1153.629) (-1152.404) (-1154.847) [-1152.879] -- 0:00:36 425000 -- (-1155.173) (-1153.348) (-1153.184) [-1152.471] * (-1154.358) [-1154.812] (-1153.557) (-1154.531) -- 0:00:36 Average standard deviation of split frequencies: 0.016664 425500 -- (-1153.721) [-1153.912] (-1154.336) (-1154.171) * (-1155.887) (-1156.416) [-1153.929] (-1156.932) -- 0:00:36 426000 -- [-1152.372] (-1155.058) (-1156.360) (-1153.827) * (-1152.332) [-1157.369] (-1152.702) (-1156.502) -- 0:00:36 426500 -- (-1154.215) [-1154.978] (-1153.090) (-1158.678) * (-1156.176) (-1156.664) (-1157.630) [-1153.935] -- 0:00:36 427000 -- (-1154.876) [-1153.952] (-1154.756) (-1156.599) * (-1154.037) (-1154.707) [-1159.012] (-1154.813) -- 0:00:36 427500 -- (-1153.583) (-1152.533) [-1157.826] (-1155.251) * [-1152.892] (-1155.684) (-1161.168) (-1155.072) -- 0:00:36 428000 -- (-1152.127) [-1152.524] (-1161.102) (-1156.257) * [-1153.839] (-1155.268) (-1155.128) (-1157.894) -- 0:00:36 428500 -- (-1154.746) (-1155.616) [-1152.254] (-1158.805) * (-1152.896) (-1153.857) [-1154.715] (-1154.593) -- 0:00:36 429000 -- (-1153.914) (-1153.887) (-1152.207) [-1153.937] * [-1154.911] (-1153.880) (-1156.044) (-1155.492) -- 0:00:35 429500 -- (-1152.497) (-1154.863) (-1153.021) [-1156.128] * [-1154.272] (-1153.063) (-1154.387) (-1159.324) -- 0:00:35 430000 -- (-1155.028) [-1155.318] (-1155.206) (-1159.029) * (-1154.033) (-1157.235) [-1156.939] (-1153.701) -- 0:00:35 Average standard deviation of split frequencies: 0.016008 430500 -- (-1154.736) [-1155.282] (-1157.807) (-1153.892) * (-1153.578) [-1153.034] (-1160.321) (-1154.903) -- 0:00:35 431000 -- (-1155.602) (-1155.026) (-1153.168) [-1152.428] * (-1156.721) [-1152.889] (-1160.003) (-1155.906) -- 0:00:35 431500 -- (-1154.859) [-1156.008] (-1155.825) (-1154.202) * [-1158.437] (-1155.217) (-1159.993) (-1156.308) -- 0:00:35 432000 -- [-1152.629] (-1156.484) (-1156.694) (-1159.510) * [-1153.716] (-1158.256) (-1155.994) (-1157.897) -- 0:00:35 432500 -- [-1152.649] (-1156.614) (-1154.818) (-1158.531) * [-1154.396] (-1155.239) (-1155.479) (-1153.718) -- 0:00:35 433000 -- [-1153.931] (-1159.886) (-1154.160) (-1154.111) * (-1155.134) [-1154.443] (-1152.400) (-1154.195) -- 0:00:35 433500 -- (-1155.732) (-1156.918) [-1160.937] (-1152.818) * (-1155.114) [-1154.311] (-1155.090) (-1153.702) -- 0:00:35 434000 -- (-1154.700) [-1156.648] (-1153.614) (-1153.847) * (-1158.414) (-1154.479) [-1153.487] (-1154.004) -- 0:00:36 434500 -- [-1153.982] (-1153.627) (-1153.653) (-1154.177) * (-1155.853) (-1155.652) (-1153.580) [-1154.720] -- 0:00:36 435000 -- (-1155.644) (-1153.408) [-1152.326] (-1159.668) * (-1158.155) (-1156.053) [-1154.340] (-1154.491) -- 0:00:36 Average standard deviation of split frequencies: 0.016961 435500 -- (-1154.369) (-1154.288) (-1152.276) [-1156.128] * (-1154.535) (-1156.627) [-1152.646] (-1155.336) -- 0:00:36 436000 -- (-1153.292) (-1154.629) [-1152.426] (-1156.219) * (-1154.843) (-1153.570) [-1152.375] (-1155.744) -- 0:00:36 436500 -- [-1155.461] (-1152.674) (-1153.486) (-1153.211) * [-1155.993] (-1154.345) (-1153.484) (-1153.692) -- 0:00:36 437000 -- (-1158.476) (-1152.054) [-1153.360] (-1154.754) * (-1157.044) (-1153.217) [-1153.614] (-1154.688) -- 0:00:36 437500 -- (-1153.298) [-1153.451] (-1156.183) (-1152.970) * (-1156.177) [-1153.103] (-1153.771) (-1156.526) -- 0:00:36 438000 -- [-1152.622] (-1156.047) (-1153.736) (-1153.545) * [-1154.027] (-1155.729) (-1153.555) (-1156.548) -- 0:00:35 438500 -- (-1153.393) [-1153.562] (-1153.911) (-1153.145) * (-1154.543) (-1153.980) (-1153.381) [-1152.747] -- 0:00:35 439000 -- (-1154.124) (-1155.894) (-1155.989) [-1153.131] * (-1153.052) [-1156.992] (-1153.745) (-1155.056) -- 0:00:35 439500 -- (-1155.355) [-1157.266] (-1153.608) (-1152.963) * (-1153.730) (-1157.565) (-1153.193) [-1153.655] -- 0:00:35 440000 -- [-1153.566] (-1157.765) (-1154.861) (-1154.686) * [-1157.150] (-1157.345) (-1152.816) (-1156.622) -- 0:00:35 Average standard deviation of split frequencies: 0.016782 440500 -- (-1153.160) [-1153.519] (-1155.065) (-1153.531) * (-1156.953) (-1153.469) [-1152.268] (-1154.702) -- 0:00:35 441000 -- (-1154.414) (-1154.267) [-1153.877] (-1153.610) * (-1155.124) (-1157.359) [-1152.499] (-1153.634) -- 0:00:35 441500 -- (-1154.833) [-1154.606] (-1153.520) (-1153.812) * (-1153.072) (-1156.160) [-1153.411] (-1152.975) -- 0:00:35 442000 -- [-1153.097] (-1155.619) (-1155.033) (-1152.971) * [-1155.004] (-1155.038) (-1153.272) (-1154.561) -- 0:00:35 442500 -- (-1154.177) (-1156.427) [-1152.058] (-1154.240) * (-1158.903) (-1155.897) (-1153.308) [-1155.337] -- 0:00:35 443000 -- [-1154.480] (-1153.664) (-1153.042) (-1154.434) * [-1152.893] (-1154.110) (-1154.459) (-1156.064) -- 0:00:35 443500 -- (-1152.218) (-1153.198) [-1153.261] (-1153.014) * [-1152.340] (-1154.255) (-1154.695) (-1156.242) -- 0:00:35 444000 -- [-1154.001] (-1154.286) (-1154.325) (-1155.242) * (-1153.293) (-1158.799) (-1155.178) [-1157.071] -- 0:00:35 444500 -- (-1152.750) [-1153.063] (-1155.612) (-1154.041) * (-1153.946) (-1156.264) [-1152.657] (-1154.950) -- 0:00:34 445000 -- [-1152.567] (-1152.941) (-1153.081) (-1155.654) * (-1155.107) (-1152.605) [-1153.682] (-1157.363) -- 0:00:34 Average standard deviation of split frequencies: 0.016581 445500 -- (-1155.440) [-1153.043] (-1154.769) (-1156.935) * (-1153.646) (-1153.119) [-1153.512] (-1156.232) -- 0:00:34 446000 -- [-1157.521] (-1152.361) (-1158.437) (-1154.029) * (-1155.035) [-1152.140] (-1154.681) (-1156.508) -- 0:00:34 446500 -- (-1156.110) (-1152.902) [-1158.533] (-1153.596) * (-1155.405) (-1154.941) [-1153.954] (-1154.048) -- 0:00:34 447000 -- (-1153.759) [-1153.592] (-1156.555) (-1157.338) * (-1153.623) (-1156.718) [-1153.674] (-1153.942) -- 0:00:34 447500 -- [-1156.648] (-1153.839) (-1154.864) (-1156.089) * (-1157.614) (-1158.723) (-1152.761) [-1154.083] -- 0:00:34 448000 -- (-1154.218) [-1154.978] (-1152.957) (-1155.186) * (-1153.225) (-1154.454) [-1153.768] (-1152.425) -- 0:00:34 448500 -- (-1154.054) (-1155.854) (-1153.134) [-1153.124] * (-1155.497) (-1153.062) [-1153.375] (-1152.759) -- 0:00:34 449000 -- (-1152.780) [-1155.867] (-1153.042) (-1156.164) * (-1156.098) [-1153.063] (-1152.914) (-1155.425) -- 0:00:34 449500 -- (-1153.067) [-1153.582] (-1152.754) (-1158.139) * (-1156.063) (-1153.990) (-1154.289) [-1152.170] -- 0:00:34 450000 -- (-1153.612) (-1154.817) [-1152.803] (-1161.819) * (-1153.452) [-1155.910] (-1158.870) (-1152.198) -- 0:00:35 Average standard deviation of split frequencies: 0.016932 450500 -- [-1156.685] (-1155.897) (-1158.390) (-1153.236) * (-1155.272) [-1153.444] (-1158.182) (-1156.741) -- 0:00:35 451000 -- (-1155.447) [-1153.559] (-1156.609) (-1154.238) * (-1155.494) (-1154.285) [-1154.776] (-1156.036) -- 0:00:35 451500 -- (-1153.480) (-1156.054) (-1154.763) [-1153.838] * (-1155.734) (-1155.609) (-1153.394) [-1157.859] -- 0:00:35 452000 -- [-1153.941] (-1156.854) (-1154.202) (-1154.391) * (-1153.618) (-1159.286) (-1153.576) [-1152.838] -- 0:00:35 452500 -- (-1156.326) [-1153.611] (-1153.532) (-1153.429) * [-1154.023] (-1154.144) (-1156.286) (-1152.055) -- 0:00:35 453000 -- (-1153.962) (-1153.643) (-1152.681) [-1153.298] * (-1156.767) (-1153.525) (-1154.706) [-1152.030] -- 0:00:35 453500 -- (-1154.130) (-1154.999) (-1153.589) [-1153.907] * (-1153.814) (-1158.816) (-1152.590) [-1152.701] -- 0:00:34 454000 -- (-1154.144) [-1154.416] (-1153.385) (-1155.412) * (-1157.527) (-1154.808) [-1152.324] (-1152.143) -- 0:00:34 454500 -- [-1153.151] (-1153.870) (-1157.122) (-1154.480) * (-1159.160) (-1157.678) [-1153.524] (-1155.038) -- 0:00:34 455000 -- (-1153.354) (-1152.927) (-1157.584) [-1154.675] * [-1152.916] (-1155.567) (-1154.811) (-1155.038) -- 0:00:34 Average standard deviation of split frequencies: 0.017251 455500 -- [-1155.274] (-1154.593) (-1153.582) (-1156.810) * [-1152.692] (-1155.112) (-1155.939) (-1154.339) -- 0:00:34 456000 -- (-1154.568) [-1154.200] (-1154.252) (-1153.438) * [-1153.323] (-1154.173) (-1156.373) (-1154.031) -- 0:00:34 456500 -- [-1158.754] (-1154.242) (-1154.392) (-1156.370) * (-1154.351) (-1156.875) [-1156.428] (-1152.570) -- 0:00:34 457000 -- (-1166.805) [-1154.083] (-1157.380) (-1155.318) * [-1155.478] (-1154.435) (-1152.383) (-1152.627) -- 0:00:34 457500 -- (-1159.064) (-1152.612) [-1155.052] (-1158.610) * (-1153.912) (-1154.957) (-1152.187) [-1152.751] -- 0:00:34 458000 -- [-1158.390] (-1157.421) (-1159.987) (-1156.345) * (-1154.124) [-1153.921] (-1153.382) (-1153.427) -- 0:00:34 458500 -- [-1160.758] (-1153.829) (-1158.814) (-1155.403) * (-1153.104) (-1153.188) [-1153.348] (-1153.519) -- 0:00:34 459000 -- (-1154.828) (-1154.178) (-1152.952) [-1155.510] * (-1152.225) (-1153.465) [-1152.918] (-1154.245) -- 0:00:34 459500 -- (-1156.507) (-1154.459) [-1153.003] (-1153.606) * (-1153.945) [-1152.528] (-1153.348) (-1154.802) -- 0:00:34 460000 -- (-1153.520) (-1155.553) [-1152.614] (-1154.063) * (-1154.772) (-1152.603) (-1156.296) [-1156.139] -- 0:00:34 Average standard deviation of split frequencies: 0.017204 460500 -- (-1154.937) (-1152.415) [-1154.669] (-1155.502) * [-1154.347] (-1155.406) (-1157.272) (-1152.882) -- 0:00:33 461000 -- (-1155.341) (-1154.406) [-1154.027] (-1155.864) * (-1155.629) (-1153.926) (-1154.473) [-1154.771] -- 0:00:33 461500 -- (-1154.719) [-1152.195] (-1156.460) (-1153.192) * (-1152.564) (-1156.293) [-1156.962] (-1156.678) -- 0:00:33 462000 -- (-1153.971) (-1154.898) [-1154.802] (-1153.329) * (-1154.763) (-1152.394) [-1156.313] (-1155.698) -- 0:00:33 462500 -- (-1157.432) [-1153.514] (-1156.884) (-1155.005) * (-1155.529) [-1152.721] (-1152.227) (-1152.033) -- 0:00:33 463000 -- [-1154.736] (-1156.006) (-1157.001) (-1158.020) * (-1156.430) [-1158.406] (-1157.086) (-1153.322) -- 0:00:33 463500 -- (-1154.609) (-1153.172) (-1154.710) [-1154.175] * (-1155.135) (-1156.884) (-1157.080) [-1152.125] -- 0:00:33 464000 -- (-1152.987) (-1153.251) [-1152.523] (-1154.117) * (-1155.471) (-1154.318) (-1152.666) [-1155.397] -- 0:00:33 464500 -- (-1152.237) [-1154.056] (-1154.520) (-1154.745) * (-1156.325) [-1153.685] (-1152.551) (-1156.344) -- 0:00:33 465000 -- (-1156.672) [-1153.102] (-1153.263) (-1156.872) * (-1154.899) (-1153.389) [-1153.089] (-1154.334) -- 0:00:33 Average standard deviation of split frequencies: 0.015743 465500 -- [-1155.292] (-1153.112) (-1155.357) (-1152.543) * (-1155.203) (-1153.033) [-1152.757] (-1152.950) -- 0:00:33 466000 -- (-1155.364) (-1153.851) [-1153.034] (-1153.988) * [-1153.746] (-1155.630) (-1152.641) (-1153.360) -- 0:00:33 466500 -- [-1152.637] (-1154.807) (-1152.778) (-1153.640) * [-1152.543] (-1153.684) (-1155.353) (-1155.455) -- 0:00:34 467000 -- (-1152.467) [-1152.814] (-1153.374) (-1152.975) * [-1153.188] (-1154.179) (-1153.214) (-1155.697) -- 0:00:34 467500 -- (-1152.884) [-1154.197] (-1152.191) (-1152.535) * [-1152.971] (-1155.004) (-1154.647) (-1154.866) -- 0:00:34 468000 -- (-1152.004) [-1155.571] (-1153.158) (-1154.408) * (-1153.938) (-1153.708) [-1154.928] (-1155.989) -- 0:00:34 468500 -- [-1152.337] (-1153.771) (-1155.485) (-1152.633) * (-1153.106) [-1153.521] (-1154.606) (-1156.151) -- 0:00:34 469000 -- (-1152.676) (-1152.965) [-1157.114] (-1154.052) * [-1152.823] (-1154.734) (-1155.434) (-1156.343) -- 0:00:33 469500 -- (-1153.236) (-1154.107) (-1155.681) [-1155.459] * (-1155.560) (-1153.549) (-1154.976) [-1153.681] -- 0:00:33 470000 -- (-1154.790) [-1156.393] (-1157.779) (-1154.123) * (-1155.402) (-1153.895) [-1154.976] (-1152.500) -- 0:00:33 Average standard deviation of split frequencies: 0.015462 470500 -- (-1154.341) [-1153.321] (-1158.538) (-1154.993) * [-1154.634] (-1155.082) (-1154.661) (-1151.982) -- 0:00:33 471000 -- (-1151.918) [-1154.481] (-1154.002) (-1153.915) * [-1153.135] (-1154.967) (-1154.197) (-1152.643) -- 0:00:33 471500 -- (-1155.311) (-1156.707) (-1153.503) [-1153.961] * (-1155.132) [-1152.471] (-1154.699) (-1152.853) -- 0:00:33 472000 -- (-1152.213) (-1153.735) [-1155.368] (-1152.786) * (-1155.180) (-1152.017) (-1154.346) [-1153.220] -- 0:00:33 472500 -- (-1155.202) [-1151.877] (-1155.188) (-1155.659) * (-1153.653) (-1153.881) (-1153.031) [-1154.894] -- 0:00:33 473000 -- [-1156.397] (-1153.900) (-1153.342) (-1152.357) * [-1152.388] (-1153.842) (-1152.216) (-1152.601) -- 0:00:33 473500 -- (-1155.053) (-1153.622) (-1152.080) [-1153.453] * (-1153.216) (-1152.537) (-1153.753) [-1153.353] -- 0:00:33 474000 -- (-1154.096) (-1152.405) (-1152.070) [-1153.949] * (-1156.676) (-1155.381) [-1153.744] (-1153.375) -- 0:00:33 474500 -- (-1161.004) (-1152.673) (-1154.754) [-1152.970] * [-1155.470] (-1155.527) (-1153.016) (-1156.248) -- 0:00:33 475000 -- (-1156.209) (-1152.600) (-1153.681) [-1152.700] * (-1152.852) (-1156.481) [-1153.178] (-1155.782) -- 0:00:33 Average standard deviation of split frequencies: 0.015474 475500 -- [-1153.094] (-1156.269) (-1157.029) (-1154.318) * (-1154.622) (-1156.108) [-1152.453] (-1156.955) -- 0:00:33 476000 -- [-1153.619] (-1154.917) (-1152.275) (-1156.493) * (-1154.335) [-1154.921] (-1154.210) (-1156.547) -- 0:00:33 476500 -- (-1156.448) (-1154.544) [-1152.157] (-1159.230) * [-1155.382] (-1154.968) (-1152.929) (-1154.773) -- 0:00:32 477000 -- (-1155.337) (-1154.232) (-1152.823) [-1155.089] * (-1158.087) (-1154.967) (-1153.090) [-1154.677] -- 0:00:32 477500 -- (-1154.158) [-1155.902] (-1152.841) (-1156.600) * (-1158.714) (-1153.676) (-1155.044) [-1153.617] -- 0:00:32 478000 -- (-1157.545) (-1153.221) [-1157.052] (-1152.558) * (-1159.012) (-1153.326) [-1156.913] (-1158.154) -- 0:00:32 478500 -- (-1154.091) (-1154.384) [-1155.512] (-1152.599) * (-1152.233) (-1154.025) [-1152.407] (-1152.103) -- 0:00:32 479000 -- (-1156.107) [-1155.402] (-1156.503) (-1153.242) * (-1154.674) (-1157.723) (-1153.381) [-1152.313] -- 0:00:32 479500 -- [-1153.714] (-1154.213) (-1156.505) (-1152.476) * [-1151.981] (-1152.109) (-1153.821) (-1154.444) -- 0:00:32 480000 -- (-1157.445) (-1152.912) [-1153.953] (-1153.458) * (-1160.901) (-1153.885) [-1155.850] (-1154.371) -- 0:00:32 Average standard deviation of split frequencies: 0.015692 480500 -- (-1155.305) (-1152.864) (-1154.662) [-1153.906] * [-1152.775] (-1155.177) (-1158.033) (-1157.341) -- 0:00:32 481000 -- (-1154.886) (-1153.938) (-1154.354) [-1156.084] * (-1156.493) (-1154.427) [-1155.830] (-1155.737) -- 0:00:32 481500 -- [-1154.829] (-1154.404) (-1154.840) (-1154.946) * (-1153.900) (-1153.413) [-1152.945] (-1154.647) -- 0:00:32 482000 -- (-1156.350) (-1155.253) (-1153.760) [-1155.960] * (-1154.480) (-1153.761) [-1152.953] (-1156.755) -- 0:00:32 482500 -- [-1154.392] (-1153.502) (-1155.434) (-1153.764) * (-1153.855) (-1153.720) [-1152.898] (-1154.117) -- 0:00:33 483000 -- [-1152.654] (-1157.652) (-1156.515) (-1153.904) * (-1153.629) (-1153.596) [-1154.077] (-1152.876) -- 0:00:33 483500 -- [-1153.280] (-1152.934) (-1162.152) (-1153.924) * [-1154.468] (-1156.963) (-1153.042) (-1152.917) -- 0:00:33 484000 -- [-1153.317] (-1153.517) (-1155.292) (-1154.018) * (-1153.897) (-1156.050) [-1153.870] (-1153.102) -- 0:00:33 484500 -- (-1153.940) (-1155.859) (-1155.028) [-1151.960] * (-1152.914) (-1152.899) [-1152.252] (-1153.099) -- 0:00:32 485000 -- (-1152.336) [-1155.021] (-1152.896) (-1153.544) * (-1152.065) (-1154.233) (-1156.872) [-1154.315] -- 0:00:32 Average standard deviation of split frequencies: 0.015641 485500 -- (-1154.083) [-1155.520] (-1152.996) (-1152.502) * (-1153.667) (-1153.400) (-1153.339) [-1155.691] -- 0:00:32 486000 -- (-1154.743) (-1154.883) (-1156.232) [-1155.121] * (-1154.393) [-1157.333] (-1153.360) (-1154.290) -- 0:00:32 486500 -- (-1155.579) (-1157.038) (-1155.621) [-1153.400] * (-1154.396) (-1157.034) [-1152.412] (-1153.499) -- 0:00:32 487000 -- (-1156.367) (-1154.166) [-1160.400] (-1155.422) * (-1156.079) [-1152.453] (-1152.033) (-1153.230) -- 0:00:32 487500 -- (-1155.589) (-1155.583) (-1161.148) [-1156.456] * (-1153.405) (-1152.835) [-1153.635] (-1152.910) -- 0:00:32 488000 -- [-1154.014] (-1153.617) (-1156.970) (-1157.365) * (-1156.140) (-1153.321) (-1155.492) [-1156.024] -- 0:00:32 488500 -- (-1155.085) (-1153.070) [-1153.203] (-1154.807) * [-1153.738] (-1152.916) (-1153.881) (-1152.266) -- 0:00:32 489000 -- (-1156.348) (-1156.447) [-1155.004] (-1153.371) * (-1157.451) (-1152.818) [-1152.243] (-1155.373) -- 0:00:32 489500 -- (-1155.255) (-1155.092) [-1153.355] (-1153.330) * (-1153.962) [-1154.502] (-1152.633) (-1152.745) -- 0:00:32 490000 -- [-1153.042] (-1155.565) (-1152.267) (-1152.446) * (-1152.756) (-1153.884) [-1152.500] (-1154.476) -- 0:00:32 Average standard deviation of split frequencies: 0.016092 490500 -- (-1153.652) (-1154.128) [-1151.996] (-1153.728) * [-1152.887] (-1153.950) (-1155.487) (-1153.936) -- 0:00:32 491000 -- (-1153.504) [-1158.765] (-1152.548) (-1153.811) * (-1152.166) (-1153.108) (-1155.568) [-1153.209] -- 0:00:32 491500 -- (-1156.177) [-1154.502] (-1154.840) (-1156.139) * [-1153.105] (-1152.994) (-1154.939) (-1155.519) -- 0:00:32 492000 -- (-1154.936) (-1154.222) [-1153.858] (-1154.259) * [-1154.631] (-1152.961) (-1156.488) (-1153.743) -- 0:00:32 492500 -- (-1154.302) (-1154.586) (-1153.800) [-1154.059] * (-1155.982) [-1155.497] (-1154.172) (-1153.874) -- 0:00:31 493000 -- [-1156.500] (-1159.715) (-1154.303) (-1156.831) * [-1151.904] (-1154.728) (-1154.838) (-1153.981) -- 0:00:31 493500 -- (-1154.223) [-1156.057] (-1153.420) (-1157.201) * (-1152.178) (-1154.892) (-1153.086) [-1154.000] -- 0:00:31 494000 -- [-1156.307] (-1154.565) (-1153.610) (-1155.130) * (-1154.597) [-1157.287] (-1153.097) (-1155.229) -- 0:00:31 494500 -- (-1154.718) [-1153.246] (-1156.429) (-1154.361) * (-1152.953) (-1159.624) [-1154.264] (-1156.836) -- 0:00:31 495000 -- (-1154.202) [-1152.862] (-1153.985) (-1155.145) * (-1152.539) (-1157.317) [-1152.504] (-1152.688) -- 0:00:31 Average standard deviation of split frequencies: 0.015444 495500 -- (-1152.677) [-1152.179] (-1154.411) (-1153.587) * (-1154.885) (-1157.881) (-1153.105) [-1151.889] -- 0:00:31 496000 -- (-1154.316) [-1153.025] (-1154.468) (-1153.644) * (-1152.766) (-1158.705) [-1152.313] (-1153.068) -- 0:00:31 496500 -- (-1155.387) (-1153.025) (-1153.916) [-1153.143] * (-1153.021) (-1158.534) (-1153.042) [-1153.680] -- 0:00:31 497000 -- (-1156.085) (-1154.382) (-1154.385) [-1157.918] * (-1154.808) (-1159.399) [-1152.919] (-1155.023) -- 0:00:31 497500 -- (-1156.446) (-1155.545) (-1152.734) [-1152.675] * [-1155.297] (-1154.244) (-1153.159) (-1155.753) -- 0:00:31 498000 -- (-1154.828) (-1152.978) [-1154.117] (-1152.957) * (-1158.260) (-1155.142) (-1153.701) [-1153.842] -- 0:00:31 498500 -- [-1156.852] (-1152.787) (-1152.960) (-1153.714) * (-1155.751) [-1155.711] (-1153.180) (-1154.535) -- 0:00:31 499000 -- (-1154.200) [-1152.124] (-1154.727) (-1152.437) * [-1152.085] (-1155.311) (-1152.792) (-1156.118) -- 0:00:32 499500 -- [-1154.901] (-1156.102) (-1154.530) (-1152.444) * [-1153.335] (-1158.852) (-1155.274) (-1156.363) -- 0:00:32 500000 -- (-1153.751) [-1155.465] (-1153.780) (-1152.427) * (-1153.079) [-1155.086] (-1154.004) (-1153.812) -- 0:00:32 Average standard deviation of split frequencies: 0.015771 500500 -- (-1154.831) [-1157.496] (-1155.766) (-1153.546) * (-1153.197) (-1152.263) (-1154.176) [-1156.691] -- 0:00:31 501000 -- (-1154.983) [-1153.990] (-1155.255) (-1157.147) * (-1157.462) [-1153.681] (-1152.998) (-1158.250) -- 0:00:31 501500 -- (-1156.046) (-1154.490) [-1154.134] (-1155.537) * (-1152.520) (-1152.958) [-1153.959] (-1154.765) -- 0:00:31 502000 -- (-1157.430) (-1152.303) (-1153.925) [-1156.207] * (-1153.752) [-1153.808] (-1159.274) (-1153.472) -- 0:00:31 502500 -- (-1157.347) (-1153.557) [-1153.881] (-1158.972) * (-1154.305) (-1155.869) (-1152.722) [-1153.578] -- 0:00:31 503000 -- (-1155.129) [-1153.387] (-1156.271) (-1156.683) * (-1153.156) (-1155.189) [-1152.854] (-1154.784) -- 0:00:31 503500 -- (-1154.320) [-1153.989] (-1156.169) (-1155.354) * (-1153.519) (-1154.996) [-1158.084] (-1154.072) -- 0:00:31 504000 -- (-1155.662) (-1157.520) (-1152.045) [-1154.660] * (-1152.303) (-1154.258) [-1153.858] (-1153.072) -- 0:00:31 504500 -- (-1156.713) [-1154.713] (-1154.630) (-1159.411) * (-1154.149) (-1155.804) [-1152.526] (-1157.744) -- 0:00:31 505000 -- (-1153.680) (-1154.312) (-1158.268) [-1155.597] * (-1154.308) (-1158.159) [-1153.649] (-1156.262) -- 0:00:31 Average standard deviation of split frequencies: 0.016245 505500 -- (-1153.399) [-1154.114] (-1156.714) (-1152.442) * (-1153.983) (-1154.515) [-1158.957] (-1153.271) -- 0:00:31 506000 -- (-1155.847) [-1156.819] (-1153.951) (-1156.256) * (-1155.741) (-1153.943) [-1153.153] (-1153.938) -- 0:00:31 506500 -- [-1154.233] (-1156.985) (-1154.942) (-1154.887) * (-1155.207) [-1152.774] (-1153.861) (-1155.099) -- 0:00:31 507000 -- (-1152.200) (-1153.580) [-1152.635] (-1153.825) * (-1153.525) (-1155.057) [-1152.819] (-1154.069) -- 0:00:31 507500 -- [-1155.572] (-1152.171) (-1152.943) (-1154.731) * (-1154.976) (-1152.713) (-1153.005) [-1153.894] -- 0:00:31 508000 -- (-1154.101) (-1152.207) [-1153.719] (-1154.561) * (-1155.996) (-1154.444) [-1152.683] (-1152.528) -- 0:00:30 508500 -- [-1154.368] (-1152.207) (-1153.247) (-1154.322) * (-1152.534) (-1155.819) (-1152.683) [-1153.283] -- 0:00:30 509000 -- (-1154.748) (-1152.370) [-1153.749] (-1157.540) * (-1152.406) (-1153.846) (-1152.634) [-1153.356] -- 0:00:30 509500 -- [-1154.240] (-1154.139) (-1153.871) (-1152.464) * (-1153.528) (-1153.577) (-1155.263) [-1153.180] -- 0:00:30 510000 -- (-1158.159) (-1153.841) [-1155.641] (-1153.737) * (-1152.296) [-1151.993] (-1154.703) (-1153.293) -- 0:00:30 Average standard deviation of split frequencies: 0.016039 510500 -- (-1152.903) [-1153.786] (-1157.168) (-1157.756) * [-1152.653] (-1154.504) (-1153.846) (-1156.674) -- 0:00:30 511000 -- (-1153.244) (-1153.453) (-1153.474) [-1154.038] * (-1152.638) (-1154.631) (-1154.047) [-1155.145] -- 0:00:30 511500 -- [-1153.155] (-1152.717) (-1153.692) (-1154.241) * (-1155.225) [-1157.341] (-1154.402) (-1154.432) -- 0:00:30 512000 -- (-1154.824) (-1152.450) [-1152.362] (-1156.077) * (-1154.751) (-1154.644) [-1153.126] (-1152.553) -- 0:00:30 512500 -- (-1154.241) (-1157.853) [-1155.683] (-1153.249) * (-1155.879) (-1156.326) [-1155.029] (-1154.645) -- 0:00:30 513000 -- [-1155.223] (-1153.270) (-1153.275) (-1153.408) * (-1155.425) (-1153.236) [-1155.069] (-1153.582) -- 0:00:30 513500 -- (-1157.862) [-1153.952] (-1153.256) (-1156.220) * (-1153.927) (-1153.621) (-1161.940) [-1152.571] -- 0:00:30 514000 -- (-1155.658) (-1154.423) [-1153.611] (-1156.582) * (-1154.102) [-1153.319] (-1157.207) (-1155.117) -- 0:00:30 514500 -- [-1154.790] (-1154.285) (-1155.896) (-1155.722) * (-1152.477) [-1155.631] (-1156.367) (-1154.488) -- 0:00:30 515000 -- (-1157.019) (-1154.578) [-1153.554] (-1153.552) * [-1151.966] (-1153.663) (-1155.921) (-1154.419) -- 0:00:30 Average standard deviation of split frequencies: 0.016102 515500 -- (-1156.763) (-1154.622) [-1153.603] (-1154.574) * [-1153.075] (-1154.000) (-1155.477) (-1154.603) -- 0:00:31 516000 -- (-1158.500) (-1155.283) (-1155.595) [-1157.100] * [-1152.257] (-1154.995) (-1153.834) (-1155.050) -- 0:00:30 516500 -- (-1160.708) [-1155.359] (-1153.702) (-1155.046) * (-1154.453) (-1153.471) (-1154.300) [-1155.844] -- 0:00:30 517000 -- (-1163.384) [-1153.386] (-1154.557) (-1154.361) * (-1157.162) [-1154.131] (-1154.593) (-1152.926) -- 0:00:30 517500 -- (-1154.207) (-1153.910) (-1155.497) [-1155.022] * (-1155.815) [-1153.870] (-1153.755) (-1154.488) -- 0:00:30 518000 -- (-1154.188) (-1154.604) (-1152.245) [-1154.135] * (-1152.461) [-1156.172] (-1154.840) (-1154.026) -- 0:00:30 518500 -- (-1154.625) [-1154.377] (-1153.283) (-1153.801) * [-1153.242] (-1153.808) (-1152.052) (-1155.925) -- 0:00:30 519000 -- [-1153.497] (-1153.437) (-1153.318) (-1153.602) * (-1155.399) [-1153.596] (-1155.295) (-1153.983) -- 0:00:30 519500 -- (-1152.895) (-1155.021) (-1155.581) [-1155.204] * (-1156.820) (-1153.362) [-1152.848] (-1155.936) -- 0:00:30 520000 -- (-1152.852) (-1152.869) [-1155.365] (-1155.622) * (-1154.035) [-1153.523] (-1152.860) (-1156.014) -- 0:00:30 Average standard deviation of split frequencies: 0.015788 520500 -- [-1152.327] (-1152.974) (-1156.889) (-1154.751) * (-1156.661) (-1154.858) (-1152.146) [-1152.175] -- 0:00:30 521000 -- (-1153.488) [-1154.310] (-1159.042) (-1156.797) * (-1157.819) (-1157.375) [-1154.004] (-1153.211) -- 0:00:30 521500 -- [-1154.029] (-1157.859) (-1155.741) (-1155.972) * (-1158.157) [-1151.889] (-1152.984) (-1153.188) -- 0:00:30 522000 -- (-1154.291) (-1152.500) (-1152.664) [-1155.825] * (-1152.094) (-1154.429) (-1152.812) [-1153.261] -- 0:00:30 522500 -- (-1154.178) [-1153.311] (-1152.808) (-1153.002) * (-1152.777) (-1153.251) [-1152.940] (-1153.944) -- 0:00:30 523000 -- (-1154.953) (-1155.087) [-1152.108] (-1154.452) * (-1159.529) [-1154.182] (-1153.193) (-1154.337) -- 0:00:30 523500 -- (-1152.560) (-1154.567) [-1152.744] (-1154.429) * (-1154.474) (-1152.863) [-1153.580] (-1158.252) -- 0:00:30 524000 -- (-1155.254) (-1152.325) (-1153.112) [-1156.439] * (-1153.121) (-1153.146) [-1153.089] (-1153.429) -- 0:00:29 524500 -- (-1156.680) [-1153.099] (-1155.890) (-1157.947) * (-1152.376) (-1160.700) [-1156.064] (-1154.519) -- 0:00:29 525000 -- (-1155.520) [-1152.822] (-1155.892) (-1157.710) * (-1155.646) (-1153.123) (-1155.197) [-1153.829] -- 0:00:29 Average standard deviation of split frequencies: 0.015684 525500 -- (-1153.385) (-1152.763) [-1155.776] (-1154.407) * (-1152.791) [-1152.657] (-1153.100) (-1153.059) -- 0:00:29 526000 -- (-1153.026) (-1157.546) [-1154.676] (-1156.703) * (-1154.766) [-1156.682] (-1154.930) (-1152.465) -- 0:00:29 526500 -- (-1152.736) [-1153.099] (-1153.018) (-1155.101) * (-1153.413) (-1154.259) [-1155.692] (-1152.660) -- 0:00:29 527000 -- (-1152.767) (-1153.209) (-1153.018) [-1153.711] * (-1156.039) [-1153.353] (-1155.393) (-1155.111) -- 0:00:29 527500 -- (-1152.865) (-1157.415) [-1154.964] (-1157.160) * (-1155.688) (-1153.667) (-1156.347) [-1154.728] -- 0:00:29 528000 -- [-1153.572] (-1152.017) (-1153.721) (-1155.181) * (-1155.394) (-1156.335) [-1152.660] (-1152.443) -- 0:00:29 528500 -- (-1155.055) (-1153.790) [-1153.435] (-1158.326) * (-1159.799) (-1153.713) [-1152.492] (-1153.460) -- 0:00:29 529000 -- (-1152.149) [-1154.157] (-1157.265) (-1158.167) * [-1155.422] (-1157.194) (-1153.629) (-1154.433) -- 0:00:29 529500 -- [-1153.683] (-1152.882) (-1154.902) (-1155.044) * (-1156.065) (-1156.276) (-1154.772) [-1153.845] -- 0:00:29 530000 -- (-1152.690) [-1155.193] (-1154.010) (-1156.702) * (-1156.147) (-1153.538) (-1153.247) [-1154.032] -- 0:00:29 Average standard deviation of split frequencies: 0.015879 530500 -- (-1159.141) (-1153.609) (-1156.437) [-1154.787] * [-1152.669] (-1155.048) (-1158.104) (-1153.221) -- 0:00:29 531000 -- (-1157.105) (-1156.763) [-1155.062] (-1153.360) * [-1154.997] (-1155.535) (-1152.326) (-1153.855) -- 0:00:29 531500 -- (-1152.885) (-1153.682) (-1159.615) [-1152.839] * (-1154.836) (-1154.038) (-1154.887) [-1151.846] -- 0:00:29 532000 -- (-1152.601) (-1154.880) (-1156.388) [-1152.522] * (-1154.439) [-1155.427] (-1157.601) (-1155.330) -- 0:00:29 532500 -- (-1154.279) (-1157.298) (-1155.831) [-1152.729] * (-1156.465) (-1154.278) [-1153.281] (-1153.608) -- 0:00:29 533000 -- (-1152.935) (-1152.920) (-1155.105) [-1153.588] * (-1153.160) [-1156.321] (-1154.607) (-1152.923) -- 0:00:29 533500 -- (-1152.908) (-1157.047) (-1152.328) [-1155.584] * (-1155.060) (-1155.899) [-1152.036] (-1153.487) -- 0:00:29 534000 -- (-1155.984) (-1155.224) (-1153.364) [-1152.650] * [-1156.686] (-1154.114) (-1152.035) (-1153.566) -- 0:00:29 534500 -- (-1153.459) (-1152.462) [-1152.645] (-1153.823) * (-1155.641) [-1156.338] (-1153.949) (-1156.068) -- 0:00:29 535000 -- [-1153.062] (-1153.098) (-1152.276) (-1152.578) * (-1155.709) (-1154.592) (-1157.588) [-1153.304] -- 0:00:29 Average standard deviation of split frequencies: 0.015061 535500 -- (-1153.258) [-1153.731] (-1152.991) (-1154.844) * (-1155.611) (-1155.738) (-1157.225) [-1154.957] -- 0:00:29 536000 -- [-1155.562] (-1155.755) (-1154.311) (-1152.733) * (-1155.393) (-1154.222) [-1157.676] (-1152.542) -- 0:00:29 536500 -- (-1157.370) (-1155.582) [-1152.609] (-1154.278) * (-1154.689) [-1153.985] (-1158.696) (-1152.712) -- 0:00:29 537000 -- (-1153.486) (-1156.142) [-1152.398] (-1153.848) * (-1154.396) (-1155.251) (-1155.525) [-1154.871] -- 0:00:29 537500 -- (-1154.094) (-1153.515) (-1153.895) [-1153.412] * (-1153.479) [-1151.909] (-1154.887) (-1154.649) -- 0:00:29 538000 -- (-1153.972) (-1156.626) [-1153.216] (-1154.955) * [-1153.053] (-1154.071) (-1155.010) (-1152.894) -- 0:00:29 538500 -- (-1155.051) [-1153.474] (-1154.272) (-1152.737) * (-1153.067) [-1152.686] (-1156.084) (-1152.393) -- 0:00:29 539000 -- [-1155.149] (-1154.696) (-1153.600) (-1152.760) * (-1154.441) (-1153.990) (-1159.876) [-1152.691] -- 0:00:29 539500 -- [-1153.866] (-1156.018) (-1153.322) (-1152.895) * (-1155.493) (-1153.157) [-1156.388] (-1152.285) -- 0:00:29 540000 -- (-1154.058) [-1155.118] (-1152.881) (-1156.154) * (-1152.112) (-1153.154) [-1152.858] (-1152.164) -- 0:00:28 Average standard deviation of split frequencies: 0.015585 540500 -- (-1158.330) (-1155.117) [-1153.975] (-1153.065) * (-1155.415) (-1155.002) [-1152.715] (-1152.310) -- 0:00:28 541000 -- [-1154.483] (-1154.827) (-1155.780) (-1154.661) * (-1158.703) (-1156.966) [-1153.291] (-1152.256) -- 0:00:28 541500 -- (-1156.840) [-1155.182] (-1152.922) (-1160.779) * [-1155.937] (-1154.197) (-1153.456) (-1154.657) -- 0:00:28 542000 -- (-1153.372) [-1152.449] (-1153.354) (-1155.518) * (-1154.840) (-1155.966) (-1153.384) [-1154.128] -- 0:00:28 542500 -- (-1155.803) (-1153.209) (-1159.380) [-1153.273] * [-1153.373] (-1157.055) (-1154.224) (-1153.752) -- 0:00:28 543000 -- (-1157.154) (-1154.644) [-1155.915] (-1153.516) * (-1157.488) (-1155.219) (-1152.806) [-1156.284] -- 0:00:28 543500 -- (-1153.090) [-1154.644] (-1155.123) (-1152.565) * [-1160.081] (-1156.474) (-1153.517) (-1155.108) -- 0:00:28 544000 -- [-1152.211] (-1154.653) (-1156.070) (-1153.271) * (-1160.302) (-1156.601) [-1153.358] (-1155.001) -- 0:00:28 544500 -- (-1154.490) (-1152.982) (-1154.552) [-1152.157] * [-1152.153] (-1155.893) (-1153.581) (-1156.285) -- 0:00:28 545000 -- (-1152.164) (-1152.729) [-1155.128] (-1154.754) * (-1152.153) [-1154.461] (-1153.140) (-1155.033) -- 0:00:28 Average standard deviation of split frequencies: 0.015649 545500 -- (-1154.882) (-1153.004) (-1154.824) [-1153.453] * (-1152.327) (-1155.888) [-1153.022] (-1153.271) -- 0:00:28 546000 -- (-1152.787) (-1152.501) [-1154.293] (-1155.545) * (-1152.322) (-1152.148) [-1156.109] (-1154.315) -- 0:00:28 546500 -- (-1155.352) [-1158.055] (-1155.277) (-1153.803) * (-1154.175) (-1152.105) (-1156.494) [-1156.991] -- 0:00:28 547000 -- (-1155.440) (-1156.982) (-1154.623) [-1159.443] * [-1157.339] (-1153.411) (-1153.922) (-1156.069) -- 0:00:28 547500 -- (-1153.797) (-1156.649) (-1155.248) [-1152.994] * (-1154.960) [-1153.381] (-1153.849) (-1157.257) -- 0:00:28 548000 -- (-1158.829) (-1154.327) (-1154.974) [-1153.884] * (-1154.483) (-1152.060) [-1156.989] (-1153.958) -- 0:00:28 548500 -- [-1154.076] (-1153.103) (-1153.497) (-1157.547) * (-1157.370) [-1153.239] (-1154.652) (-1152.333) -- 0:00:28 549000 -- (-1157.663) [-1154.061] (-1153.503) (-1155.247) * (-1156.486) (-1156.791) (-1155.698) [-1154.243] -- 0:00:28 549500 -- (-1154.394) (-1155.309) [-1152.991] (-1152.863) * (-1154.553) (-1152.183) [-1153.273] (-1153.669) -- 0:00:28 550000 -- (-1156.598) (-1152.580) (-1152.867) [-1152.778] * [-1152.955] (-1154.024) (-1152.300) (-1154.391) -- 0:00:28 Average standard deviation of split frequencies: 0.015516 550500 -- (-1155.406) (-1152.699) [-1152.701] (-1153.267) * (-1153.016) (-1154.813) [-1153.487] (-1156.409) -- 0:00:28 551000 -- (-1157.422) [-1153.046] (-1154.170) (-1155.275) * (-1153.045) (-1157.862) (-1153.608) [-1153.627] -- 0:00:28 551500 -- (-1152.973) [-1153.833] (-1153.746) (-1154.870) * [-1156.220] (-1156.231) (-1152.943) (-1154.319) -- 0:00:28 552000 -- [-1153.398] (-1154.916) (-1152.864) (-1156.686) * (-1154.139) [-1155.798] (-1152.607) (-1153.195) -- 0:00:28 552500 -- (-1152.328) [-1153.397] (-1153.344) (-1154.392) * [-1155.789] (-1156.233) (-1152.300) (-1154.872) -- 0:00:28 553000 -- (-1152.344) (-1156.263) [-1153.654] (-1154.461) * [-1154.373] (-1160.377) (-1152.358) (-1153.395) -- 0:00:28 553500 -- (-1152.631) (-1153.970) [-1155.136] (-1158.474) * (-1152.204) [-1153.656] (-1152.696) (-1154.081) -- 0:00:28 554000 -- (-1156.835) [-1153.009] (-1156.269) (-1155.481) * (-1152.161) (-1154.932) [-1158.130] (-1155.008) -- 0:00:28 554500 -- (-1161.478) [-1152.252] (-1156.545) (-1157.694) * (-1156.181) (-1152.620) (-1161.216) [-1152.220] -- 0:00:28 555000 -- (-1154.708) (-1154.452) [-1155.664] (-1158.779) * [-1155.116] (-1154.065) (-1154.379) (-1152.241) -- 0:00:28 Average standard deviation of split frequencies: 0.015420 555500 -- (-1155.319) (-1156.057) [-1154.574] (-1158.452) * (-1154.243) (-1153.390) (-1156.033) [-1153.960] -- 0:00:28 556000 -- [-1155.482] (-1154.393) (-1157.629) (-1154.756) * (-1153.152) (-1154.108) (-1153.913) [-1153.140] -- 0:00:27 556500 -- (-1153.909) (-1155.034) (-1156.086) [-1155.749] * (-1153.310) (-1152.195) (-1154.290) [-1157.928] -- 0:00:27 557000 -- (-1152.823) [-1155.171] (-1154.514) (-1154.917) * [-1157.656] (-1153.208) (-1154.265) (-1157.893) -- 0:00:27 557500 -- [-1152.245] (-1155.935) (-1153.175) (-1154.472) * [-1154.806] (-1152.380) (-1157.910) (-1157.355) -- 0:00:27 558000 -- (-1154.168) (-1155.116) (-1155.075) [-1152.868] * (-1156.735) (-1157.559) (-1153.012) [-1155.815] -- 0:00:27 558500 -- [-1153.851] (-1158.644) (-1153.483) (-1153.418) * [-1153.402] (-1153.304) (-1155.196) (-1152.673) -- 0:00:27 559000 -- (-1162.842) (-1152.186) [-1157.928] (-1156.134) * (-1154.012) (-1153.254) (-1156.937) [-1153.633] -- 0:00:27 559500 -- [-1159.126] (-1152.584) (-1159.182) (-1156.593) * [-1156.413] (-1152.630) (-1153.800) (-1153.126) -- 0:00:27 560000 -- (-1152.780) (-1153.877) [-1156.977] (-1158.679) * (-1156.933) (-1153.008) [-1155.188] (-1152.873) -- 0:00:27 Average standard deviation of split frequencies: 0.015765 560500 -- [-1152.780] (-1153.676) (-1155.684) (-1155.198) * (-1154.119) (-1153.061) (-1159.721) [-1155.044] -- 0:00:27 561000 -- (-1152.359) (-1158.928) [-1155.295] (-1153.372) * (-1153.079) [-1155.411] (-1157.209) (-1151.905) -- 0:00:27 561500 -- (-1152.297) [-1156.186] (-1151.986) (-1152.537) * (-1152.874) (-1154.130) (-1157.821) [-1151.905] -- 0:00:27 562000 -- (-1153.872) (-1158.550) [-1152.645] (-1152.424) * (-1157.531) (-1154.813) (-1159.403) [-1152.622] -- 0:00:27 562500 -- (-1153.817) (-1153.983) (-1155.185) [-1154.021] * [-1154.811] (-1154.415) (-1153.531) (-1156.410) -- 0:00:27 563000 -- [-1155.716] (-1154.103) (-1153.131) (-1156.037) * [-1156.707] (-1154.342) (-1158.808) (-1153.212) -- 0:00:27 563500 -- (-1157.493) [-1154.467] (-1155.065) (-1155.981) * (-1154.096) [-1156.349] (-1152.808) (-1152.593) -- 0:00:27 564000 -- (-1158.126) [-1153.333] (-1155.797) (-1155.467) * (-1155.709) (-1154.481) [-1153.132] (-1153.619) -- 0:00:27 564500 -- (-1155.262) [-1153.435] (-1153.533) (-1153.202) * (-1153.700) (-1155.781) (-1154.337) [-1154.767] -- 0:00:27 565000 -- (-1153.192) [-1154.406] (-1157.168) (-1156.863) * [-1154.557] (-1159.038) (-1152.779) (-1158.742) -- 0:00:27 Average standard deviation of split frequencies: 0.016137 565500 -- (-1153.310) (-1152.783) [-1152.057] (-1153.614) * (-1151.839) (-1154.577) (-1153.046) [-1152.792] -- 0:00:27 566000 -- (-1152.566) (-1155.005) (-1152.033) [-1156.697] * [-1152.615] (-1158.001) (-1154.253) (-1156.918) -- 0:00:27 566500 -- (-1154.176) (-1154.948) (-1154.053) [-1156.348] * (-1155.430) [-1155.404] (-1153.348) (-1154.918) -- 0:00:27 567000 -- [-1154.251] (-1155.571) (-1152.894) (-1158.340) * (-1154.371) (-1153.017) [-1153.058] (-1154.262) -- 0:00:27 567500 -- (-1155.874) (-1153.761) [-1154.136] (-1156.604) * (-1153.768) [-1154.349] (-1152.942) (-1154.501) -- 0:00:27 568000 -- [-1157.310] (-1157.081) (-1153.105) (-1157.952) * (-1154.607) (-1154.831) [-1152.917] (-1154.363) -- 0:00:27 568500 -- (-1156.804) [-1153.334] (-1154.834) (-1153.504) * [-1153.306] (-1155.418) (-1153.381) (-1156.854) -- 0:00:27 569000 -- (-1157.978) (-1156.282) [-1153.026] (-1153.069) * (-1154.270) (-1154.807) [-1153.631] (-1153.791) -- 0:00:27 569500 -- (-1153.042) (-1154.569) (-1154.816) [-1156.099] * (-1154.192) (-1153.522) (-1156.642) [-1155.728] -- 0:00:27 570000 -- [-1152.820] (-1156.378) (-1154.042) (-1154.814) * (-1153.208) (-1153.918) (-1156.416) [-1155.594] -- 0:00:27 Average standard deviation of split frequencies: 0.015953 570500 -- (-1152.834) (-1153.548) [-1152.551] (-1155.682) * (-1153.404) [-1154.864] (-1157.637) (-1153.141) -- 0:00:27 571000 -- [-1156.316] (-1153.236) (-1154.982) (-1156.760) * (-1156.503) (-1155.922) [-1153.435] (-1153.095) -- 0:00:27 571500 -- (-1160.222) (-1154.327) [-1154.071] (-1161.277) * (-1158.355) (-1155.097) [-1158.125] (-1153.211) -- 0:00:26 572000 -- (-1154.140) (-1152.620) [-1152.483] (-1154.413) * (-1158.354) (-1153.950) (-1158.522) [-1154.215] -- 0:00:26 572500 -- (-1157.707) [-1153.001] (-1152.154) (-1153.455) * (-1156.394) (-1158.227) (-1154.807) [-1158.662] -- 0:00:26 573000 -- [-1153.455] (-1156.075) (-1152.279) (-1153.026) * (-1152.281) [-1155.060] (-1152.981) (-1159.846) -- 0:00:26 573500 -- (-1153.236) (-1154.784) (-1152.289) [-1154.362] * (-1152.243) (-1153.366) [-1152.674] (-1153.127) -- 0:00:26 574000 -- [-1152.526] (-1154.897) (-1156.029) (-1154.074) * [-1151.985] (-1152.983) (-1153.949) (-1155.099) -- 0:00:26 574500 -- [-1152.293] (-1155.818) (-1153.162) (-1155.173) * (-1155.934) [-1153.103] (-1152.362) (-1153.844) -- 0:00:26 575000 -- [-1153.171] (-1156.000) (-1154.241) (-1155.334) * (-1152.795) (-1153.429) [-1153.626] (-1153.572) -- 0:00:26 Average standard deviation of split frequencies: 0.016215 575500 -- (-1155.526) [-1155.741] (-1154.757) (-1155.181) * (-1153.564) [-1154.988] (-1153.796) (-1152.680) -- 0:00:26 576000 -- (-1154.654) (-1156.961) [-1158.626] (-1162.268) * (-1154.042) [-1158.080] (-1154.018) (-1156.584) -- 0:00:26 576500 -- [-1154.346] (-1155.052) (-1154.343) (-1158.731) * [-1154.050] (-1157.237) (-1154.435) (-1153.580) -- 0:00:26 577000 -- (-1153.909) [-1155.520] (-1154.877) (-1154.098) * (-1155.158) (-1152.866) (-1155.763) [-1153.422] -- 0:00:26 577500 -- [-1156.289] (-1153.736) (-1152.897) (-1153.753) * (-1159.062) [-1155.672] (-1153.061) (-1154.270) -- 0:00:26 578000 -- (-1153.910) [-1154.607] (-1153.810) (-1154.393) * (-1155.225) (-1153.398) [-1151.921] (-1152.455) -- 0:00:26 578500 -- [-1159.428] (-1155.517) (-1160.012) (-1154.301) * [-1153.689] (-1152.460) (-1153.893) (-1154.942) -- 0:00:26 579000 -- (-1154.579) [-1153.941] (-1154.694) (-1152.501) * (-1157.247) (-1156.149) (-1152.441) [-1153.642] -- 0:00:26 579500 -- [-1155.608] (-1156.194) (-1153.353) (-1154.642) * (-1153.257) (-1155.991) [-1152.851] (-1152.961) -- 0:00:26 580000 -- (-1156.210) (-1154.119) [-1153.185] (-1157.864) * [-1153.201] (-1152.207) (-1153.052) (-1154.142) -- 0:00:26 Average standard deviation of split frequencies: 0.016389 580500 -- [-1152.886] (-1154.189) (-1155.252) (-1155.397) * (-1155.991) [-1152.338] (-1154.472) (-1153.384) -- 0:00:26 581000 -- (-1155.020) (-1156.725) (-1153.083) [-1154.979] * (-1153.918) (-1154.580) [-1154.059] (-1153.016) -- 0:00:26 581500 -- (-1160.969) (-1152.554) [-1154.647] (-1152.951) * (-1153.171) (-1154.498) [-1155.825] (-1157.021) -- 0:00:26 582000 -- (-1155.099) (-1152.574) (-1153.811) [-1153.667] * (-1153.257) (-1154.037) [-1155.811] (-1153.934) -- 0:00:26 582500 -- [-1153.878] (-1156.324) (-1152.628) (-1153.622) * (-1163.864) (-1152.811) (-1155.276) [-1154.327] -- 0:00:26 583000 -- (-1154.253) (-1157.249) (-1154.933) [-1154.095] * [-1152.867] (-1153.279) (-1156.692) (-1155.960) -- 0:00:26 583500 -- (-1154.094) (-1153.875) [-1152.722] (-1154.841) * [-1154.759] (-1155.224) (-1153.575) (-1156.120) -- 0:00:26 584000 -- (-1153.922) [-1154.184] (-1152.377) (-1154.001) * (-1152.484) [-1152.545] (-1159.082) (-1154.609) -- 0:00:26 584500 -- (-1157.624) [-1156.147] (-1153.391) (-1154.049) * (-1154.056) (-1154.010) [-1156.703] (-1155.123) -- 0:00:26 585000 -- (-1154.368) [-1155.345] (-1163.398) (-1156.265) * (-1157.706) [-1154.172] (-1154.772) (-1156.602) -- 0:00:26 Average standard deviation of split frequencies: 0.016541 585500 -- [-1155.163] (-1153.956) (-1156.599) (-1154.799) * (-1153.126) (-1153.655) [-1152.677] (-1156.831) -- 0:00:26 586000 -- (-1154.950) [-1154.896] (-1156.198) (-1155.021) * (-1152.997) (-1155.059) [-1153.181] (-1156.848) -- 0:00:26 586500 -- [-1152.727] (-1153.584) (-1155.540) (-1154.014) * [-1152.859] (-1154.697) (-1154.079) (-1155.754) -- 0:00:26 587000 -- (-1154.879) [-1152.355] (-1156.115) (-1153.553) * (-1153.213) (-1156.192) [-1156.924] (-1155.835) -- 0:00:26 587500 -- (-1155.215) (-1152.399) [-1153.989] (-1156.102) * [-1153.801] (-1153.668) (-1154.981) (-1153.801) -- 0:00:25 588000 -- (-1154.820) (-1154.313) (-1153.608) [-1154.079] * (-1153.211) [-1152.472] (-1152.382) (-1152.271) -- 0:00:25 588500 -- (-1153.250) (-1156.764) (-1155.113) [-1159.421] * [-1154.989] (-1154.467) (-1152.387) (-1155.239) -- 0:00:25 589000 -- (-1155.064) [-1154.850] (-1153.929) (-1154.151) * (-1154.475) (-1155.561) [-1152.309] (-1153.896) -- 0:00:25 589500 -- (-1158.725) (-1154.443) [-1152.637] (-1154.242) * [-1158.591] (-1154.919) (-1152.793) (-1157.914) -- 0:00:25 590000 -- (-1155.495) (-1155.683) [-1153.241] (-1153.630) * (-1153.624) (-1153.655) [-1154.373] (-1155.026) -- 0:00:25 Average standard deviation of split frequencies: 0.015962 590500 -- [-1154.575] (-1153.842) (-1155.722) (-1156.760) * (-1154.225) (-1157.354) [-1153.704] (-1152.621) -- 0:00:25 591000 -- (-1154.900) [-1153.757] (-1156.254) (-1154.605) * (-1154.696) (-1154.724) (-1153.995) [-1152.638] -- 0:00:25 591500 -- [-1154.474] (-1155.168) (-1151.905) (-1153.172) * [-1156.982] (-1153.613) (-1153.016) (-1153.111) -- 0:00:25 592000 -- (-1155.533) (-1152.403) [-1152.368] (-1154.693) * (-1157.411) [-1156.856] (-1155.541) (-1158.289) -- 0:00:25 592500 -- (-1153.430) (-1154.773) [-1152.414] (-1156.260) * (-1153.701) [-1154.896] (-1156.003) (-1153.749) -- 0:00:25 593000 -- (-1153.544) [-1152.490] (-1153.751) (-1155.976) * (-1154.959) (-1153.720) [-1153.258] (-1153.478) -- 0:00:25 593500 -- [-1152.943] (-1156.416) (-1153.432) (-1156.160) * (-1155.367) (-1154.642) (-1154.744) [-1153.039] -- 0:00:25 594000 -- [-1155.759] (-1154.409) (-1153.790) (-1153.670) * (-1154.520) (-1156.144) (-1156.725) [-1153.758] -- 0:00:25 594500 -- (-1156.768) (-1153.732) (-1153.831) [-1157.167] * [-1153.510] (-1157.649) (-1152.687) (-1154.628) -- 0:00:25 595000 -- (-1153.531) (-1152.057) [-1154.467] (-1152.766) * (-1154.946) (-1153.226) [-1152.340] (-1154.783) -- 0:00:25 Average standard deviation of split frequencies: 0.015819 595500 -- (-1156.754) [-1152.175] (-1156.330) (-1155.292) * (-1151.909) (-1159.936) (-1153.472) [-1153.756] -- 0:00:25 596000 -- [-1153.218] (-1153.649) (-1155.124) (-1156.127) * (-1152.583) [-1153.944] (-1154.912) (-1157.446) -- 0:00:25 596500 -- [-1153.964] (-1157.239) (-1153.903) (-1157.131) * (-1154.371) [-1154.297] (-1154.662) (-1154.832) -- 0:00:25 597000 -- (-1154.809) [-1158.631] (-1154.346) (-1155.464) * (-1154.320) [-1156.346] (-1153.230) (-1154.636) -- 0:00:25 597500 -- (-1152.968) [-1152.387] (-1154.087) (-1157.434) * (-1154.041) (-1154.386) [-1152.296] (-1154.662) -- 0:00:25 598000 -- (-1155.379) [-1152.065] (-1155.532) (-1160.120) * (-1154.490) (-1153.749) (-1155.213) [-1152.087] -- 0:00:25 598500 -- (-1153.182) (-1152.440) (-1154.134) [-1153.681] * (-1153.073) (-1154.751) (-1156.233) [-1152.708] -- 0:00:25 599000 -- [-1154.671] (-1152.971) (-1152.588) (-1155.032) * (-1152.727) [-1156.297] (-1157.387) (-1154.253) -- 0:00:25 599500 -- (-1152.647) (-1154.578) [-1152.746] (-1156.748) * [-1153.114] (-1154.339) (-1155.762) (-1155.088) -- 0:00:25 600000 -- (-1153.300) (-1154.750) (-1152.926) [-1153.563] * (-1154.753) [-1152.790] (-1153.883) (-1155.603) -- 0:00:25 Average standard deviation of split frequencies: 0.015794 600500 -- (-1156.848) (-1154.335) (-1153.344) [-1154.438] * (-1153.862) [-1152.412] (-1157.329) (-1153.796) -- 0:00:25 601000 -- (-1153.828) (-1153.164) [-1155.539] (-1158.235) * [-1152.715] (-1156.933) (-1158.342) (-1154.402) -- 0:00:25 601500 -- [-1153.922] (-1154.221) (-1156.004) (-1156.871) * [-1152.701] (-1153.474) (-1154.837) (-1157.730) -- 0:00:25 602000 -- [-1152.103] (-1153.889) (-1153.680) (-1152.947) * (-1152.968) (-1155.524) (-1154.064) [-1155.703] -- 0:00:25 602500 -- (-1154.099) (-1153.597) [-1152.159] (-1159.044) * [-1152.738] (-1153.529) (-1155.492) (-1154.850) -- 0:00:25 603000 -- (-1153.711) (-1155.176) (-1154.248) [-1155.761] * [-1153.011] (-1154.627) (-1154.846) (-1154.019) -- 0:00:25 603500 -- (-1152.717) (-1156.552) (-1153.825) [-1153.047] * (-1152.027) (-1155.705) [-1151.923] (-1152.777) -- 0:00:24 604000 -- (-1154.334) [-1155.237] (-1155.422) (-1158.564) * (-1152.425) (-1152.900) (-1154.467) [-1152.905] -- 0:00:24 604500 -- (-1153.956) [-1157.679] (-1154.151) (-1156.772) * [-1152.586] (-1153.000) (-1156.445) (-1156.591) -- 0:00:24 605000 -- [-1152.142] (-1156.823) (-1153.787) (-1156.420) * (-1154.894) (-1155.735) (-1155.120) [-1154.480] -- 0:00:24 Average standard deviation of split frequencies: 0.016093 605500 -- (-1154.687) (-1161.673) (-1153.449) [-1152.441] * [-1156.175] (-1153.693) (-1152.598) (-1154.141) -- 0:00:24 606000 -- (-1154.640) (-1154.531) [-1154.302] (-1152.668) * [-1153.409] (-1155.990) (-1154.607) (-1153.708) -- 0:00:24 606500 -- (-1152.885) (-1152.183) [-1153.981] (-1153.151) * (-1158.052) (-1156.080) (-1154.155) [-1152.211] -- 0:00:24 607000 -- [-1153.610] (-1153.956) (-1154.754) (-1154.019) * (-1152.758) [-1154.006] (-1160.126) (-1155.668) -- 0:00:24 607500 -- (-1153.686) [-1158.216] (-1158.054) (-1153.616) * [-1155.271] (-1154.468) (-1152.996) (-1153.669) -- 0:00:24 608000 -- (-1152.864) [-1157.765] (-1155.050) (-1154.869) * (-1154.696) (-1153.039) [-1155.277] (-1152.431) -- 0:00:24 608500 -- (-1157.576) [-1157.692] (-1155.686) (-1152.702) * (-1156.635) [-1152.277] (-1154.643) (-1153.161) -- 0:00:24 609000 -- [-1155.041] (-1158.738) (-1157.628) (-1155.340) * (-1156.569) [-1152.651] (-1153.827) (-1155.284) -- 0:00:24 609500 -- [-1153.864] (-1153.184) (-1156.676) (-1161.549) * (-1153.611) [-1152.144] (-1152.341) (-1158.252) -- 0:00:24 610000 -- (-1155.067) [-1153.780] (-1154.801) (-1163.165) * (-1154.781) [-1152.315] (-1152.695) (-1152.865) -- 0:00:24 Average standard deviation of split frequencies: 0.015970 610500 -- (-1155.732) (-1152.456) (-1153.833) [-1156.863] * (-1154.549) (-1152.582) (-1153.428) [-1156.321] -- 0:00:24 611000 -- (-1154.158) (-1155.422) [-1154.287] (-1158.995) * [-1153.748] (-1151.806) (-1155.283) (-1153.160) -- 0:00:24 611500 -- [-1155.147] (-1156.474) (-1152.541) (-1153.525) * (-1153.116) (-1151.979) (-1154.579) [-1153.604] -- 0:00:24 612000 -- (-1155.716) (-1152.032) (-1152.622) [-1155.651] * [-1154.139] (-1153.178) (-1152.701) (-1155.768) -- 0:00:24 612500 -- (-1155.406) [-1154.127] (-1153.263) (-1158.162) * [-1154.106] (-1152.965) (-1155.977) (-1154.619) -- 0:00:24 613000 -- (-1153.720) (-1152.943) (-1152.498) [-1158.099] * [-1154.550] (-1155.048) (-1157.607) (-1153.132) -- 0:00:24 613500 -- (-1155.110) (-1154.795) [-1153.042] (-1158.427) * (-1156.520) [-1156.645] (-1155.478) (-1153.792) -- 0:00:24 614000 -- (-1154.059) (-1153.145) [-1152.514] (-1155.853) * (-1152.110) (-1152.681) [-1156.629] (-1156.417) -- 0:00:24 614500 -- (-1152.007) (-1153.191) [-1153.248] (-1154.078) * (-1153.322) (-1161.629) (-1156.572) [-1153.290] -- 0:00:24 615000 -- (-1153.555) [-1157.475] (-1156.850) (-1154.708) * [-1152.171] (-1153.650) (-1153.137) (-1159.182) -- 0:00:24 Average standard deviation of split frequencies: 0.015784 615500 -- (-1153.432) (-1154.619) (-1158.690) [-1152.219] * (-1152.342) [-1154.413] (-1152.923) (-1158.050) -- 0:00:24 616000 -- [-1153.761] (-1154.315) (-1158.864) (-1152.061) * (-1154.210) (-1154.785) (-1154.224) [-1154.560] -- 0:00:24 616500 -- [-1153.515] (-1153.699) (-1154.773) (-1152.318) * (-1153.434) [-1153.716] (-1154.494) (-1155.645) -- 0:00:24 617000 -- (-1154.068) (-1152.606) (-1153.920) [-1155.995] * [-1154.993] (-1153.762) (-1154.650) (-1155.422) -- 0:00:24 617500 -- (-1153.073) (-1152.691) (-1154.510) [-1154.347] * (-1152.984) [-1153.796] (-1155.973) (-1152.413) -- 0:00:24 618000 -- [-1153.058] (-1152.254) (-1155.959) (-1153.323) * [-1153.165] (-1153.354) (-1154.836) (-1154.702) -- 0:00:24 618500 -- (-1154.580) [-1153.892] (-1153.455) (-1153.273) * (-1152.894) (-1155.228) [-1153.321] (-1156.845) -- 0:00:24 619000 -- (-1156.844) [-1152.279] (-1153.237) (-1156.846) * (-1152.620) [-1152.522] (-1153.383) (-1154.970) -- 0:00:24 619500 -- (-1154.143) [-1153.333] (-1154.786) (-1158.239) * (-1152.181) [-1153.565] (-1156.468) (-1153.005) -- 0:00:23 620000 -- (-1152.455) (-1153.556) (-1155.296) [-1158.020] * (-1153.618) (-1152.932) (-1154.079) [-1151.889] -- 0:00:23 Average standard deviation of split frequencies: 0.015428 620500 -- (-1155.353) (-1152.920) (-1154.385) [-1156.825] * (-1155.357) [-1154.079] (-1154.222) (-1152.047) -- 0:00:23 621000 -- (-1153.459) [-1152.746] (-1152.357) (-1156.066) * [-1154.839] (-1154.657) (-1156.219) (-1153.339) -- 0:00:23 621500 -- [-1154.276] (-1154.857) (-1152.866) (-1156.749) * (-1153.381) (-1156.717) (-1154.714) [-1153.955] -- 0:00:23 622000 -- [-1153.466] (-1153.800) (-1159.744) (-1155.522) * [-1153.578] (-1153.914) (-1153.829) (-1158.763) -- 0:00:23 622500 -- [-1153.243] (-1154.216) (-1158.047) (-1154.140) * [-1152.780] (-1154.520) (-1154.424) (-1156.470) -- 0:00:23 623000 -- (-1153.241) (-1152.697) (-1155.658) [-1153.536] * (-1153.455) (-1156.226) [-1157.247] (-1155.884) -- 0:00:23 623500 -- (-1153.674) (-1152.871) (-1156.523) [-1152.382] * (-1152.597) (-1155.823) (-1156.865) [-1153.537] -- 0:00:23 624000 -- (-1154.630) [-1155.470] (-1158.372) (-1152.893) * [-1152.580] (-1154.519) (-1152.791) (-1155.750) -- 0:00:23 624500 -- (-1153.660) [-1158.970] (-1161.165) (-1153.769) * (-1153.270) (-1155.048) [-1152.527] (-1152.482) -- 0:00:23 625000 -- [-1152.683] (-1152.325) (-1153.418) (-1155.536) * (-1154.714) (-1155.203) (-1153.857) [-1157.952] -- 0:00:23 Average standard deviation of split frequencies: 0.015720 625500 -- (-1154.038) (-1154.931) [-1154.162] (-1162.183) * (-1152.781) (-1154.432) (-1153.465) [-1152.643] -- 0:00:23 626000 -- [-1154.208] (-1154.619) (-1155.028) (-1152.114) * (-1152.879) (-1152.607) [-1153.269] (-1153.447) -- 0:00:23 626500 -- (-1156.946) (-1154.239) (-1154.800) [-1152.296] * (-1152.168) [-1152.566] (-1156.215) (-1153.266) -- 0:00:23 627000 -- [-1151.880] (-1154.580) (-1153.611) (-1153.605) * [-1152.984] (-1154.494) (-1157.293) (-1153.230) -- 0:00:23 627500 -- [-1151.925] (-1154.221) (-1155.499) (-1155.077) * (-1153.775) [-1152.715] (-1155.155) (-1154.442) -- 0:00:23 628000 -- (-1154.222) [-1157.660] (-1154.096) (-1155.764) * [-1153.780] (-1153.303) (-1153.952) (-1153.791) -- 0:00:23 628500 -- [-1153.818] (-1156.127) (-1152.782) (-1154.629) * (-1155.061) (-1152.441) [-1156.089] (-1151.969) -- 0:00:23 629000 -- [-1154.474] (-1157.378) (-1152.964) (-1154.174) * [-1157.001] (-1153.607) (-1153.194) (-1152.394) -- 0:00:23 629500 -- (-1155.484) (-1158.747) (-1154.559) [-1152.644] * (-1154.434) (-1154.145) (-1155.239) [-1154.065] -- 0:00:23 630000 -- (-1152.792) (-1155.089) [-1153.676] (-1154.997) * (-1156.501) [-1153.977] (-1153.165) (-1155.975) -- 0:00:23 Average standard deviation of split frequencies: 0.015323 630500 -- [-1152.313] (-1157.583) (-1155.404) (-1157.129) * [-1155.543] (-1152.780) (-1154.242) (-1154.548) -- 0:00:23 631000 -- (-1155.886) (-1154.552) [-1157.544] (-1154.733) * (-1155.325) [-1153.927] (-1155.661) (-1153.054) -- 0:00:23 631500 -- (-1154.285) (-1156.394) [-1154.193] (-1153.368) * (-1155.107) (-1153.042) [-1155.408] (-1156.462) -- 0:00:23 632000 -- (-1153.471) (-1154.247) (-1157.939) [-1154.197] * (-1153.364) (-1158.325) [-1157.351] (-1154.901) -- 0:00:23 632500 -- [-1153.825] (-1155.686) (-1155.861) (-1153.514) * [-1152.389] (-1156.035) (-1151.946) (-1153.414) -- 0:00:23 633000 -- (-1153.057) (-1154.039) (-1156.049) [-1155.446] * (-1152.840) (-1153.155) (-1152.355) [-1152.871] -- 0:00:23 633500 -- [-1152.115] (-1153.544) (-1152.501) (-1153.620) * (-1151.929) (-1153.907) (-1153.607) [-1152.165] -- 0:00:23 634000 -- (-1152.912) (-1154.780) (-1157.654) [-1153.738] * (-1152.348) [-1153.323] (-1153.964) (-1153.295) -- 0:00:23 634500 -- (-1153.391) (-1154.067) [-1153.759] (-1155.528) * (-1156.278) [-1155.018] (-1152.442) (-1152.088) -- 0:00:23 635000 -- [-1154.628] (-1153.468) (-1153.432) (-1157.356) * (-1154.972) [-1152.853] (-1152.498) (-1153.564) -- 0:00:22 Average standard deviation of split frequencies: 0.015287 635500 -- (-1152.519) (-1153.335) [-1155.573] (-1154.773) * (-1155.857) (-1153.803) [-1153.502] (-1153.820) -- 0:00:22 636000 -- [-1154.144] (-1154.274) (-1160.959) (-1155.288) * (-1155.468) (-1153.789) (-1154.010) [-1154.474] -- 0:00:22 636500 -- [-1153.896] (-1156.020) (-1155.223) (-1156.851) * (-1154.761) (-1155.277) [-1155.656] (-1157.645) -- 0:00:22 637000 -- (-1156.765) (-1154.945) (-1152.196) [-1155.050] * [-1154.107] (-1155.002) (-1156.610) (-1155.657) -- 0:00:22 637500 -- [-1153.044] (-1155.676) (-1152.123) (-1152.491) * (-1157.472) (-1157.319) [-1153.082] (-1157.132) -- 0:00:22 638000 -- [-1153.835] (-1152.908) (-1152.799) (-1158.385) * [-1153.735] (-1152.826) (-1154.591) (-1154.223) -- 0:00:22 638500 -- (-1154.656) (-1156.798) (-1153.777) [-1156.028] * [-1154.342] (-1152.981) (-1154.685) (-1156.841) -- 0:00:22 639000 -- (-1157.232) (-1152.344) (-1156.084) [-1155.606] * [-1153.187] (-1157.571) (-1153.405) (-1159.315) -- 0:00:22 639500 -- (-1152.933) (-1157.766) [-1153.293] (-1154.700) * (-1153.485) [-1155.700] (-1155.853) (-1154.657) -- 0:00:22 640000 -- (-1155.710) (-1156.050) (-1153.886) [-1152.785] * (-1156.523) (-1153.437) (-1155.681) [-1156.099] -- 0:00:22 Average standard deviation of split frequencies: 0.014992 640500 -- (-1157.367) [-1153.656] (-1153.664) (-1156.676) * [-1155.770] (-1153.836) (-1153.986) (-1156.603) -- 0:00:22 641000 -- [-1154.974] (-1153.455) (-1156.619) (-1156.018) * [-1152.058] (-1155.457) (-1154.814) (-1152.303) -- 0:00:22 641500 -- (-1152.922) (-1156.734) [-1154.638] (-1155.484) * (-1152.510) (-1157.355) [-1154.425] (-1153.926) -- 0:00:22 642000 -- [-1152.822] (-1155.220) (-1158.417) (-1158.286) * (-1153.273) (-1151.961) (-1159.311) [-1152.967] -- 0:00:22 642500 -- (-1153.540) (-1154.735) (-1155.120) [-1157.172] * (-1152.875) (-1152.713) (-1157.435) [-1154.745] -- 0:00:22 643000 -- (-1156.074) (-1155.992) [-1152.530] (-1156.885) * (-1152.505) (-1152.093) (-1154.937) [-1153.569] -- 0:00:22 643500 -- [-1154.185] (-1153.774) (-1152.184) (-1156.690) * (-1152.465) (-1152.175) (-1154.002) [-1156.450] -- 0:00:22 644000 -- (-1153.107) (-1151.928) [-1155.038] (-1154.308) * (-1155.839) (-1154.630) (-1158.465) [-1159.473] -- 0:00:22 644500 -- [-1155.363] (-1152.027) (-1152.945) (-1156.232) * (-1158.423) (-1156.315) (-1153.693) [-1152.499] -- 0:00:22 645000 -- (-1155.446) [-1152.313] (-1152.944) (-1156.870) * [-1155.125] (-1153.819) (-1155.987) (-1153.421) -- 0:00:22 Average standard deviation of split frequencies: 0.014503 645500 -- (-1152.299) [-1153.558] (-1153.710) (-1152.476) * (-1154.176) [-1153.983] (-1156.136) (-1153.018) -- 0:00:22 646000 -- [-1152.866] (-1155.052) (-1154.796) (-1154.046) * (-1153.081) (-1152.195) (-1155.412) [-1152.792] -- 0:00:22 646500 -- [-1154.129] (-1158.419) (-1156.428) (-1155.154) * (-1155.685) (-1152.643) (-1152.857) [-1155.884] -- 0:00:22 647000 -- [-1154.505] (-1157.217) (-1155.300) (-1153.837) * (-1157.072) [-1154.207] (-1153.318) (-1154.284) -- 0:00:22 647500 -- [-1156.149] (-1155.091) (-1153.090) (-1151.900) * (-1153.411) [-1152.658] (-1152.330) (-1155.749) -- 0:00:22 648000 -- (-1155.193) (-1155.060) [-1152.114] (-1154.091) * (-1154.597) (-1155.833) (-1154.915) [-1153.506] -- 0:00:22 648500 -- (-1154.246) (-1154.172) [-1155.543] (-1152.120) * (-1153.885) (-1159.716) (-1156.176) [-1152.658] -- 0:00:22 649000 -- [-1152.671] (-1154.837) (-1155.292) (-1154.841) * [-1152.934] (-1155.147) (-1156.580) (-1154.292) -- 0:00:22 649500 -- (-1154.155) (-1160.372) [-1153.690] (-1153.970) * (-1156.388) [-1153.263] (-1154.430) (-1154.406) -- 0:00:22 650000 -- (-1154.332) (-1152.762) (-1153.776) [-1153.048] * (-1154.251) [-1156.473] (-1153.624) (-1157.378) -- 0:00:22 Average standard deviation of split frequencies: 0.014580 650500 -- (-1152.732) [-1152.254] (-1154.295) (-1153.807) * (-1156.550) (-1153.186) [-1154.394] (-1157.192) -- 0:00:22 651000 -- (-1153.522) [-1152.963] (-1155.304) (-1153.765) * (-1155.383) [-1153.886] (-1153.068) (-1153.551) -- 0:00:21 651500 -- (-1154.379) [-1152.755] (-1154.173) (-1154.676) * (-1154.973) [-1154.317] (-1153.090) (-1154.286) -- 0:00:21 652000 -- (-1154.560) [-1153.746] (-1154.357) (-1155.321) * (-1156.531) (-1154.444) [-1156.821] (-1152.210) -- 0:00:21 652500 -- [-1153.549] (-1155.721) (-1156.139) (-1153.991) * (-1154.498) [-1152.454] (-1152.698) (-1156.239) -- 0:00:21 653000 -- (-1154.942) (-1153.993) (-1154.400) [-1154.215] * (-1154.836) [-1153.694] (-1155.089) (-1159.378) -- 0:00:21 653500 -- (-1156.442) (-1153.518) (-1154.476) [-1154.959] * (-1154.762) [-1152.999] (-1153.092) (-1153.228) -- 0:00:21 654000 -- (-1156.852) (-1154.609) (-1156.219) [-1154.709] * (-1155.450) [-1154.258] (-1156.659) (-1153.939) -- 0:00:21 654500 -- [-1152.652] (-1153.422) (-1152.532) (-1154.124) * (-1154.345) (-1153.894) (-1154.571) [-1153.496] -- 0:00:21 655000 -- (-1153.375) [-1153.089] (-1154.233) (-1157.060) * (-1154.965) (-1152.088) [-1154.033] (-1152.803) -- 0:00:21 Average standard deviation of split frequencies: 0.013743 655500 -- (-1153.877) (-1152.705) [-1155.407] (-1154.025) * [-1154.083] (-1152.929) (-1153.819) (-1155.918) -- 0:00:21 656000 -- (-1154.596) (-1153.880) [-1153.152] (-1153.174) * (-1153.194) [-1155.366] (-1154.915) (-1155.399) -- 0:00:21 656500 -- [-1157.037] (-1154.104) (-1156.250) (-1156.574) * [-1153.649] (-1153.696) (-1155.679) (-1156.308) -- 0:00:21 657000 -- [-1154.724] (-1153.016) (-1153.426) (-1155.431) * [-1153.827] (-1152.403) (-1155.607) (-1157.002) -- 0:00:21 657500 -- (-1158.942) [-1154.411] (-1154.814) (-1159.726) * [-1152.989] (-1154.578) (-1153.821) (-1155.994) -- 0:00:21 658000 -- (-1154.872) (-1163.504) (-1152.628) [-1153.727] * (-1152.843) (-1153.391) (-1154.193) [-1152.850] -- 0:00:21 658500 -- (-1155.319) (-1156.769) (-1157.323) [-1153.748] * [-1154.907] (-1155.293) (-1153.311) (-1153.366) -- 0:00:21 659000 -- (-1153.548) [-1154.343] (-1156.143) (-1153.393) * (-1156.166) (-1153.326) [-1153.523] (-1155.379) -- 0:00:21 659500 -- (-1155.800) [-1155.939] (-1153.157) (-1154.442) * (-1153.276) (-1158.984) [-1155.235] (-1155.015) -- 0:00:21 660000 -- [-1156.882] (-1157.667) (-1153.509) (-1156.563) * (-1156.270) [-1156.240] (-1153.385) (-1152.312) -- 0:00:21 Average standard deviation of split frequencies: 0.013557 660500 -- (-1161.626) (-1154.260) (-1154.005) [-1154.667] * (-1153.901) [-1152.955] (-1152.886) (-1153.410) -- 0:00:21 661000 -- (-1158.316) [-1161.356] (-1153.767) (-1152.499) * (-1154.914) [-1152.397] (-1152.716) (-1155.911) -- 0:00:21 661500 -- (-1154.612) (-1155.139) [-1154.998] (-1152.160) * (-1153.160) (-1153.262) [-1153.256] (-1153.119) -- 0:00:21 662000 -- (-1157.449) (-1156.446) (-1153.690) [-1154.305] * (-1152.646) (-1154.292) (-1153.324) [-1158.714] -- 0:00:21 662500 -- (-1153.191) [-1153.515] (-1153.023) (-1153.918) * (-1154.669) (-1154.152) (-1153.191) [-1153.575] -- 0:00:21 663000 -- (-1155.172) (-1152.829) (-1154.297) [-1153.576] * (-1159.467) [-1153.076] (-1155.649) (-1154.491) -- 0:00:21 663500 -- [-1152.498] (-1153.165) (-1156.326) (-1159.402) * [-1154.753] (-1156.133) (-1157.806) (-1155.917) -- 0:00:21 664000 -- [-1152.589] (-1154.620) (-1155.173) (-1157.449) * (-1153.102) [-1155.612] (-1152.848) (-1157.438) -- 0:00:21 664500 -- (-1152.590) (-1153.718) [-1155.252] (-1159.529) * [-1153.601] (-1152.978) (-1152.848) (-1154.224) -- 0:00:21 665000 -- (-1157.914) (-1153.183) (-1153.646) [-1157.584] * (-1154.070) (-1158.309) [-1153.048] (-1154.897) -- 0:00:21 Average standard deviation of split frequencies: 0.013360 665500 -- [-1153.455] (-1155.418) (-1155.371) (-1152.417) * [-1156.609] (-1152.712) (-1153.268) (-1152.495) -- 0:00:21 666000 -- [-1153.389] (-1153.833) (-1154.775) (-1153.408) * (-1155.081) [-1153.375] (-1153.454) (-1152.765) -- 0:00:21 666500 -- (-1153.830) [-1155.232] (-1156.234) (-1152.997) * (-1155.367) (-1154.643) (-1154.187) [-1152.988] -- 0:00:21 667000 -- (-1152.605) (-1154.234) [-1152.407] (-1157.065) * (-1156.575) (-1152.498) [-1152.968] (-1155.637) -- 0:00:20 667500 -- (-1158.642) (-1154.760) [-1152.575] (-1157.391) * [-1155.334] (-1153.824) (-1153.507) (-1152.230) -- 0:00:20 668000 -- [-1154.918] (-1155.251) (-1151.888) (-1156.269) * (-1154.805) [-1154.463] (-1154.166) (-1152.817) -- 0:00:20 668500 -- (-1154.499) [-1154.041] (-1154.312) (-1152.980) * (-1154.120) [-1152.203] (-1152.559) (-1156.261) -- 0:00:20 669000 -- (-1153.239) [-1154.978] (-1155.311) (-1153.527) * (-1154.437) (-1153.257) (-1153.077) [-1153.164] -- 0:00:20 669500 -- (-1155.254) (-1156.443) (-1154.693) [-1154.120] * (-1155.099) [-1152.916] (-1156.577) (-1153.480) -- 0:00:20 670000 -- (-1156.132) [-1156.194] (-1153.562) (-1155.230) * (-1156.340) (-1155.156) (-1154.600) [-1153.440] -- 0:00:20 Average standard deviation of split frequencies: 0.013882 670500 -- (-1157.967) (-1152.842) (-1152.608) [-1152.281] * (-1155.018) [-1153.320] (-1153.987) (-1152.928) -- 0:00:20 671000 -- (-1155.531) [-1152.860] (-1152.132) (-1152.579) * (-1154.449) (-1153.860) [-1153.125] (-1152.839) -- 0:00:20 671500 -- [-1152.681] (-1153.179) (-1154.079) (-1152.396) * (-1152.557) (-1154.410) (-1153.406) [-1154.263] -- 0:00:20 672000 -- [-1152.935] (-1153.495) (-1153.637) (-1152.230) * (-1152.391) (-1156.243) (-1155.630) [-1156.407] -- 0:00:20 672500 -- (-1154.052) (-1156.154) (-1154.954) [-1155.952] * (-1152.605) (-1153.984) [-1155.432] (-1153.092) -- 0:00:20 673000 -- (-1158.863) [-1154.773] (-1153.597) (-1152.060) * (-1152.503) (-1154.666) [-1154.236] (-1156.112) -- 0:00:20 673500 -- [-1153.138] (-1155.678) (-1154.078) (-1159.782) * (-1153.812) (-1155.241) (-1157.943) [-1153.393] -- 0:00:20 674000 -- (-1153.370) [-1152.337] (-1153.331) (-1157.973) * (-1155.739) (-1156.138) (-1154.230) [-1152.725] -- 0:00:20 674500 -- (-1157.191) (-1153.586) [-1155.167] (-1154.216) * (-1157.664) [-1155.530] (-1160.757) (-1152.708) -- 0:00:20 675000 -- (-1160.657) (-1153.468) [-1153.270] (-1153.545) * (-1153.042) (-1158.590) [-1153.747] (-1154.318) -- 0:00:20 Average standard deviation of split frequencies: 0.013816 675500 -- [-1159.150] (-1153.150) (-1152.360) (-1156.165) * (-1157.588) (-1155.347) (-1153.505) [-1155.058] -- 0:00:20 676000 -- (-1158.410) (-1153.687) (-1154.899) [-1156.186] * (-1154.962) [-1152.948] (-1153.525) (-1154.057) -- 0:00:20 676500 -- [-1154.752] (-1156.459) (-1153.033) (-1153.809) * (-1156.770) (-1152.636) [-1153.428] (-1153.827) -- 0:00:20 677000 -- (-1154.499) [-1152.454] (-1155.594) (-1153.697) * (-1156.140) (-1155.734) [-1152.539] (-1158.183) -- 0:00:20 677500 -- (-1156.006) (-1153.143) [-1154.695] (-1156.094) * [-1158.543] (-1154.714) (-1157.082) (-1155.614) -- 0:00:19 678000 -- (-1154.258) (-1155.251) [-1154.263] (-1155.763) * (-1153.475) [-1153.768] (-1153.610) (-1153.738) -- 0:00:20 678500 -- [-1154.102] (-1155.241) (-1153.782) (-1154.990) * [-1152.153] (-1155.233) (-1153.550) (-1153.717) -- 0:00:20 679000 -- (-1152.607) (-1156.277) (-1153.096) [-1155.040] * [-1152.281] (-1154.158) (-1154.846) (-1152.826) -- 0:00:20 679500 -- (-1157.463) (-1154.980) [-1153.021] (-1153.899) * (-1152.291) [-1153.442] (-1153.003) (-1155.751) -- 0:00:20 680000 -- (-1156.555) (-1154.904) (-1152.451) [-1152.978] * (-1153.376) (-1155.953) [-1152.473] (-1153.753) -- 0:00:20 Average standard deviation of split frequencies: 0.014587 680500 -- (-1156.865) (-1153.628) (-1153.456) [-1152.613] * [-1153.201] (-1154.202) (-1153.592) (-1152.874) -- 0:00:20 681000 -- (-1155.162) (-1154.725) (-1154.599) [-1153.632] * (-1153.548) (-1157.512) [-1153.530] (-1154.724) -- 0:00:20 681500 -- (-1153.007) [-1153.354] (-1154.598) (-1152.551) * [-1153.731] (-1153.441) (-1153.856) (-1156.414) -- 0:00:20 682000 -- [-1154.222] (-1156.928) (-1152.877) (-1153.079) * (-1154.032) [-1153.050] (-1152.820) (-1158.647) -- 0:00:20 682500 -- (-1156.988) (-1156.921) (-1152.837) [-1153.376] * (-1157.208) [-1157.446] (-1152.820) (-1154.337) -- 0:00:20 683000 -- (-1155.725) (-1153.191) (-1153.834) [-1156.152] * (-1154.785) (-1154.935) (-1153.123) [-1154.364] -- 0:00:19 683500 -- [-1153.699] (-1152.019) (-1152.340) (-1153.664) * (-1153.827) [-1154.550] (-1152.586) (-1155.867) -- 0:00:19 684000 -- (-1154.391) (-1156.845) (-1154.298) [-1153.238] * (-1153.680) (-1154.263) [-1152.458] (-1152.756) -- 0:00:19 684500 -- [-1153.747] (-1157.176) (-1153.351) (-1153.411) * [-1152.483] (-1154.659) (-1154.701) (-1156.488) -- 0:00:19 685000 -- (-1152.906) (-1154.637) [-1153.125] (-1153.110) * (-1154.370) (-1153.745) [-1152.800] (-1155.804) -- 0:00:19 Average standard deviation of split frequencies: 0.014560 685500 -- [-1152.067] (-1152.944) (-1152.685) (-1158.165) * (-1153.975) [-1154.195] (-1154.320) (-1154.484) -- 0:00:19 686000 -- [-1152.216] (-1153.490) (-1156.885) (-1154.553) * (-1154.174) (-1155.950) (-1155.553) [-1154.354] -- 0:00:19 686500 -- (-1152.474) [-1153.562] (-1152.172) (-1152.461) * (-1154.671) (-1153.042) [-1154.807] (-1155.753) -- 0:00:19 687000 -- (-1156.612) [-1152.823] (-1153.360) (-1152.791) * (-1155.562) (-1152.921) (-1152.806) [-1156.212] -- 0:00:19 687500 -- (-1154.021) [-1151.857] (-1152.942) (-1153.760) * (-1152.957) [-1152.531] (-1152.372) (-1157.300) -- 0:00:19 688000 -- (-1156.308) (-1154.975) (-1153.971) [-1153.340] * (-1157.635) (-1155.601) [-1153.001] (-1153.540) -- 0:00:19 688500 -- (-1152.704) (-1152.507) [-1152.387] (-1152.913) * [-1156.640] (-1155.054) (-1155.561) (-1158.628) -- 0:00:19 689000 -- (-1154.136) (-1152.555) (-1152.387) [-1154.719] * [-1152.361] (-1153.701) (-1155.823) (-1156.583) -- 0:00:19 689500 -- (-1154.522) [-1152.546] (-1153.578) (-1157.519) * [-1152.147] (-1155.536) (-1157.166) (-1159.712) -- 0:00:19 690000 -- (-1154.456) (-1153.119) [-1154.306] (-1164.445) * (-1151.991) (-1152.485) (-1157.743) [-1156.981] -- 0:00:19 Average standard deviation of split frequencies: 0.014205 690500 -- (-1154.428) [-1152.705] (-1157.290) (-1155.530) * (-1153.956) [-1155.055] (-1158.858) (-1159.339) -- 0:00:19 691000 -- [-1153.299] (-1153.640) (-1154.153) (-1154.724) * (-1152.543) (-1158.561) (-1156.971) [-1153.364] -- 0:00:19 691500 -- (-1154.182) (-1158.668) (-1155.264) [-1154.867] * [-1153.520] (-1155.032) (-1155.041) (-1152.687) -- 0:00:19 692000 -- (-1152.938) (-1153.611) [-1153.848] (-1160.898) * [-1153.382] (-1155.192) (-1153.036) (-1154.905) -- 0:00:19 692500 -- (-1156.855) (-1157.142) [-1153.911] (-1157.288) * (-1157.014) (-1156.859) [-1154.122] (-1155.458) -- 0:00:19 693000 -- (-1155.134) (-1158.963) [-1154.278] (-1155.335) * (-1154.209) (-1154.558) [-1154.066] (-1158.116) -- 0:00:19 693500 -- (-1156.337) (-1158.044) (-1152.122) [-1152.626] * (-1154.028) [-1154.459] (-1153.635) (-1154.126) -- 0:00:19 694000 -- (-1152.190) (-1157.916) [-1152.135] (-1154.158) * (-1155.225) [-1156.210] (-1153.955) (-1154.732) -- 0:00:18 694500 -- (-1154.173) [-1154.627] (-1152.815) (-1156.142) * [-1153.844] (-1155.297) (-1158.437) (-1156.574) -- 0:00:19 695000 -- [-1153.903] (-1155.339) (-1154.605) (-1154.264) * (-1153.474) [-1154.012] (-1152.382) (-1155.132) -- 0:00:19 Average standard deviation of split frequencies: 0.014181 695500 -- (-1153.908) (-1154.280) (-1154.552) [-1155.116] * (-1153.861) (-1152.440) [-1152.703] (-1157.213) -- 0:00:19 696000 -- (-1156.032) (-1161.674) [-1151.893] (-1155.366) * (-1152.773) [-1152.714] (-1156.506) (-1153.425) -- 0:00:19 696500 -- (-1152.726) (-1153.308) (-1151.900) [-1155.230] * (-1152.320) (-1157.196) (-1152.945) [-1156.628] -- 0:00:19 697000 -- [-1152.211] (-1153.675) (-1163.782) (-1155.761) * (-1155.417) [-1155.254] (-1152.544) (-1154.460) -- 0:00:19 697500 -- (-1153.558) (-1154.658) [-1156.487] (-1156.260) * (-1154.022) (-1159.391) [-1153.047] (-1152.004) -- 0:00:19 698000 -- [-1153.078] (-1154.232) (-1153.976) (-1152.947) * (-1155.567) [-1152.698] (-1153.510) (-1154.125) -- 0:00:19 698500 -- [-1158.859] (-1152.809) (-1156.418) (-1152.964) * (-1155.447) (-1157.272) [-1154.743] (-1155.203) -- 0:00:18 699000 -- (-1152.604) [-1153.084] (-1155.188) (-1153.785) * [-1155.915] (-1154.547) (-1153.393) (-1158.001) -- 0:00:18 699500 -- (-1161.436) [-1153.907] (-1158.199) (-1153.288) * (-1154.040) (-1156.174) [-1152.701] (-1153.531) -- 0:00:18 700000 -- [-1154.882] (-1153.406) (-1154.436) (-1153.559) * (-1155.918) [-1157.216] (-1154.304) (-1154.034) -- 0:00:18 Average standard deviation of split frequencies: 0.013834 700500 -- [-1152.686] (-1157.988) (-1154.120) (-1154.466) * (-1155.913) (-1154.567) (-1153.936) [-1154.580] -- 0:00:18 701000 -- (-1152.887) (-1157.191) [-1157.827] (-1153.525) * (-1152.727) [-1152.091] (-1154.096) (-1152.133) -- 0:00:18 701500 -- (-1159.667) (-1153.384) (-1157.701) [-1155.100] * (-1153.242) [-1152.365] (-1153.908) (-1152.927) -- 0:00:18 702000 -- (-1154.828) (-1153.381) (-1155.140) [-1155.088] * (-1153.676) (-1153.111) [-1153.128] (-1154.053) -- 0:00:18 702500 -- (-1154.833) [-1155.712] (-1155.103) (-1154.791) * [-1159.474] (-1153.311) (-1153.529) (-1152.520) -- 0:00:18 703000 -- (-1154.242) [-1152.057] (-1154.530) (-1156.889) * (-1156.583) (-1159.485) (-1154.096) [-1155.833] -- 0:00:18 703500 -- (-1156.335) [-1152.222] (-1156.655) (-1153.962) * (-1156.306) (-1154.877) [-1152.669] (-1152.528) -- 0:00:18 704000 -- (-1154.542) (-1153.454) [-1153.264] (-1153.272) * [-1154.694] (-1152.775) (-1153.975) (-1152.645) -- 0:00:18 704500 -- (-1152.567) [-1156.512] (-1155.969) (-1152.183) * [-1154.788] (-1153.020) (-1155.152) (-1156.348) -- 0:00:18 705000 -- [-1152.701] (-1154.593) (-1156.659) (-1154.481) * [-1157.024] (-1153.175) (-1156.201) (-1152.732) -- 0:00:18 Average standard deviation of split frequencies: 0.014147 705500 -- (-1156.993) [-1156.142] (-1154.183) (-1157.973) * (-1154.235) (-1160.229) (-1155.801) [-1152.611] -- 0:00:18 706000 -- (-1155.239) (-1153.078) (-1156.450) [-1156.529] * (-1157.320) (-1159.534) (-1153.500) [-1152.575] -- 0:00:18 706500 -- (-1154.396) (-1153.002) (-1153.554) [-1154.516] * (-1154.571) [-1152.422] (-1152.841) (-1155.782) -- 0:00:18 707000 -- (-1159.701) [-1152.649] (-1154.114) (-1155.150) * (-1157.027) (-1153.500) (-1153.515) [-1159.716] -- 0:00:18 707500 -- [-1154.803] (-1153.430) (-1159.380) (-1154.377) * [-1155.908] (-1157.478) (-1154.092) (-1158.817) -- 0:00:18 708000 -- (-1154.449) (-1152.560) [-1153.241] (-1156.525) * (-1155.665) (-1154.340) (-1152.081) [-1160.544] -- 0:00:18 708500 -- (-1153.196) (-1153.761) (-1153.482) [-1155.938] * (-1154.060) (-1153.953) [-1152.309] (-1159.297) -- 0:00:18 709000 -- (-1153.051) (-1154.000) (-1156.281) [-1156.604] * (-1156.886) (-1153.115) [-1156.017] (-1156.336) -- 0:00:18 709500 -- (-1159.561) (-1153.651) (-1155.047) [-1154.703] * (-1153.434) (-1155.695) [-1153.893] (-1153.842) -- 0:00:18 710000 -- (-1158.767) (-1155.393) (-1152.929) [-1154.210] * (-1153.545) (-1153.037) [-1152.857] (-1152.975) -- 0:00:17 Average standard deviation of split frequencies: 0.012736 710500 -- (-1153.800) (-1156.188) [-1153.709] (-1152.542) * [-1157.351] (-1153.549) (-1155.072) (-1153.427) -- 0:00:18 711000 -- (-1152.975) (-1153.757) [-1154.622] (-1152.950) * (-1156.914) [-1153.548] (-1155.062) (-1156.473) -- 0:00:18 711500 -- (-1153.410) (-1153.766) (-1158.239) [-1154.549] * (-1158.837) [-1155.091] (-1153.908) (-1156.662) -- 0:00:18 712000 -- (-1153.105) (-1154.320) (-1158.874) [-1155.742] * (-1153.321) (-1153.141) [-1155.335] (-1153.854) -- 0:00:18 712500 -- (-1154.105) (-1152.614) (-1153.014) [-1154.187] * [-1156.278] (-1154.862) (-1153.262) (-1156.634) -- 0:00:18 713000 -- (-1154.458) (-1154.634) [-1152.340] (-1154.171) * (-1152.359) [-1153.817] (-1154.582) (-1155.012) -- 0:00:18 713500 -- (-1156.204) (-1154.001) (-1152.386) [-1152.322] * (-1158.959) (-1154.216) [-1153.140] (-1151.794) -- 0:00:18 714000 -- (-1162.051) (-1155.079) (-1153.051) [-1152.728] * [-1153.442] (-1154.970) (-1154.593) (-1152.770) -- 0:00:18 714500 -- (-1153.258) [-1155.581] (-1153.710) (-1152.810) * [-1155.979] (-1156.871) (-1154.339) (-1153.409) -- 0:00:17 715000 -- (-1152.302) (-1153.925) (-1157.332) [-1153.233] * (-1154.854) (-1154.032) (-1153.159) [-1152.504] -- 0:00:17 Average standard deviation of split frequencies: 0.013291 715500 -- (-1154.910) (-1155.899) (-1154.192) [-1157.483] * [-1153.453] (-1155.003) (-1154.513) (-1154.543) -- 0:00:17 716000 -- [-1155.540] (-1155.012) (-1154.784) (-1152.930) * (-1155.801) [-1153.221] (-1153.389) (-1153.454) -- 0:00:17 716500 -- (-1155.605) (-1161.710) [-1153.132] (-1157.053) * (-1152.895) [-1151.839] (-1154.427) (-1154.400) -- 0:00:17 717000 -- (-1155.166) (-1153.685) [-1152.088] (-1153.981) * (-1151.832) (-1153.335) (-1157.885) [-1155.477] -- 0:00:17 717500 -- [-1154.382] (-1156.499) (-1153.540) (-1152.643) * [-1152.656] (-1154.940) (-1156.343) (-1158.275) -- 0:00:17 718000 -- (-1155.987) [-1153.729] (-1152.766) (-1154.923) * [-1152.767] (-1152.829) (-1156.035) (-1153.061) -- 0:00:17 718500 -- (-1156.649) (-1156.140) [-1152.749] (-1152.496) * [-1152.465] (-1152.959) (-1156.616) (-1154.851) -- 0:00:17 719000 -- [-1155.428] (-1155.608) (-1155.192) (-1152.496) * (-1153.341) (-1153.507) (-1152.264) [-1159.830] -- 0:00:17 719500 -- [-1153.192] (-1154.109) (-1153.500) (-1152.241) * [-1155.504] (-1151.816) (-1153.073) (-1154.072) -- 0:00:17 720000 -- (-1161.363) (-1152.135) (-1154.155) [-1152.279] * (-1153.992) (-1152.603) [-1153.072] (-1152.318) -- 0:00:17 Average standard deviation of split frequencies: 0.012341 720500 -- (-1158.273) [-1152.135] (-1153.448) (-1152.451) * (-1154.190) (-1155.465) [-1151.943] (-1158.355) -- 0:00:17 721000 -- (-1153.814) (-1151.793) (-1157.218) [-1152.620] * (-1155.258) (-1156.119) (-1156.658) [-1159.280] -- 0:00:17 721500 -- [-1152.427] (-1153.136) (-1155.716) (-1152.537) * (-1155.874) [-1153.681] (-1157.199) (-1154.019) -- 0:00:17 722000 -- [-1155.789] (-1156.616) (-1155.706) (-1159.406) * (-1154.324) [-1153.668] (-1158.350) (-1154.923) -- 0:00:17 722500 -- (-1158.202) [-1154.078] (-1153.201) (-1154.201) * [-1155.218] (-1153.044) (-1154.651) (-1157.283) -- 0:00:17 723000 -- [-1152.668] (-1156.168) (-1155.324) (-1153.042) * [-1157.941] (-1159.362) (-1153.742) (-1154.059) -- 0:00:17 723500 -- [-1152.043] (-1159.796) (-1154.472) (-1152.981) * (-1153.086) [-1152.971] (-1156.241) (-1154.762) -- 0:00:17 724000 -- [-1152.559] (-1156.473) (-1154.861) (-1154.077) * (-1153.863) [-1157.383] (-1157.146) (-1154.762) -- 0:00:17 724500 -- (-1154.848) (-1156.338) (-1155.458) [-1152.900] * [-1156.108] (-1154.843) (-1157.702) (-1153.965) -- 0:00:17 725000 -- [-1154.212] (-1156.505) (-1153.773) (-1152.333) * (-1157.455) (-1153.889) (-1154.088) [-1153.891] -- 0:00:17 Average standard deviation of split frequencies: 0.012510 725500 -- (-1157.266) (-1157.718) (-1159.249) [-1153.013] * (-1157.082) (-1153.570) [-1157.347] (-1153.649) -- 0:00:17 726000 -- (-1155.075) [-1153.147] (-1156.962) (-1152.938) * (-1154.462) (-1152.094) (-1155.332) [-1154.025] -- 0:00:16 726500 -- (-1153.412) [-1153.235] (-1153.248) (-1152.605) * (-1154.348) [-1152.667] (-1155.306) (-1153.249) -- 0:00:17 727000 -- (-1155.738) (-1153.715) (-1156.499) [-1156.062] * [-1156.284] (-1155.258) (-1155.592) (-1156.231) -- 0:00:17 727500 -- (-1156.157) [-1154.102] (-1156.025) (-1153.611) * (-1156.656) (-1154.651) (-1155.689) [-1152.431] -- 0:00:17 728000 -- (-1154.423) (-1158.548) [-1153.417] (-1152.349) * (-1155.152) (-1155.609) [-1151.797] (-1152.737) -- 0:00:17 728500 -- (-1152.292) (-1153.043) (-1155.403) [-1154.530] * (-1152.918) (-1153.513) [-1152.348] (-1153.793) -- 0:00:17 729000 -- (-1156.728) (-1153.148) [-1152.022] (-1158.098) * (-1155.502) (-1154.196) (-1154.113) [-1154.329] -- 0:00:17 729500 -- (-1153.368) (-1153.147) [-1152.147] (-1153.695) * (-1152.645) (-1154.604) [-1152.518] (-1153.216) -- 0:00:17 730000 -- (-1153.594) (-1153.351) (-1158.207) [-1157.118] * (-1153.361) (-1153.276) [-1152.414] (-1155.043) -- 0:00:17 Average standard deviation of split frequencies: 0.013347 730500 -- (-1156.256) [-1154.616] (-1156.147) (-1157.219) * [-1152.862] (-1153.463) (-1153.382) (-1152.551) -- 0:00:16 731000 -- (-1155.904) [-1152.989] (-1154.909) (-1160.516) * (-1153.707) (-1153.594) [-1154.735] (-1156.752) -- 0:00:16 731500 -- (-1154.506) [-1153.414] (-1156.465) (-1154.527) * (-1153.447) (-1157.217) [-1153.627] (-1154.897) -- 0:00:16 732000 -- (-1156.421) (-1153.366) [-1153.710] (-1153.034) * [-1153.127] (-1153.517) (-1155.395) (-1156.968) -- 0:00:16 732500 -- (-1157.553) (-1155.849) [-1153.337] (-1153.807) * (-1152.545) [-1152.714] (-1155.751) (-1155.588) -- 0:00:16 733000 -- (-1152.378) [-1152.919] (-1156.598) (-1155.271) * [-1152.406] (-1153.890) (-1154.651) (-1152.982) -- 0:00:16 733500 -- (-1155.133) (-1153.894) [-1156.006] (-1158.596) * [-1152.434] (-1154.151) (-1153.647) (-1152.048) -- 0:00:16 734000 -- [-1154.516] (-1152.800) (-1156.209) (-1156.830) * (-1156.493) (-1154.046) (-1155.159) [-1153.554] -- 0:00:16 734500 -- (-1155.552) (-1153.835) (-1154.825) [-1154.233] * (-1154.576) (-1156.758) (-1156.246) [-1153.303] -- 0:00:16 735000 -- (-1155.234) [-1154.510] (-1152.131) (-1154.898) * (-1152.770) (-1154.849) [-1156.342] (-1153.215) -- 0:00:16 Average standard deviation of split frequencies: 0.013691 735500 -- (-1153.396) [-1155.076] (-1152.617) (-1159.623) * (-1157.871) [-1153.187] (-1156.144) (-1152.450) -- 0:00:16 736000 -- (-1153.414) (-1154.116) [-1155.318] (-1156.573) * [-1155.540] (-1154.575) (-1153.396) (-1151.997) -- 0:00:16 736500 -- [-1155.071] (-1154.007) (-1152.556) (-1155.383) * (-1155.277) (-1152.189) (-1153.552) [-1152.350] -- 0:00:16 737000 -- (-1154.743) (-1154.827) [-1155.003] (-1154.896) * (-1154.057) (-1153.648) (-1153.396) [-1154.207] -- 0:00:16 737500 -- [-1154.619] (-1154.988) (-1153.309) (-1154.679) * (-1153.945) (-1152.517) [-1153.512] (-1156.858) -- 0:00:16 738000 -- (-1159.888) (-1155.702) [-1152.302] (-1153.730) * (-1155.653) (-1152.034) (-1154.324) [-1152.651] -- 0:00:16 738500 -- [-1153.194] (-1152.365) (-1159.971) (-1154.619) * (-1155.198) (-1152.193) [-1155.012] (-1156.191) -- 0:00:16 739000 -- (-1153.922) (-1155.312) [-1154.167] (-1154.956) * (-1152.104) (-1153.771) (-1153.733) [-1153.116] -- 0:00:16 739500 -- (-1155.637) (-1152.469) [-1153.501] (-1154.045) * (-1152.462) (-1152.684) [-1153.720] (-1154.124) -- 0:00:16 740000 -- (-1154.536) [-1152.420] (-1154.692) (-1154.184) * (-1152.868) (-1152.838) (-1154.234) [-1156.041] -- 0:00:16 Average standard deviation of split frequencies: 0.013644 740500 -- [-1154.123] (-1152.471) (-1153.451) (-1155.645) * (-1152.376) (-1154.082) [-1153.971] (-1152.427) -- 0:00:16 741000 -- [-1153.374] (-1152.977) (-1153.441) (-1152.733) * (-1153.585) (-1154.088) (-1153.034) [-1152.841] -- 0:00:16 741500 -- (-1157.251) (-1155.440) [-1153.362] (-1153.010) * (-1154.944) [-1154.059] (-1154.143) (-1153.720) -- 0:00:16 742000 -- [-1156.287] (-1156.075) (-1154.842) (-1153.589) * (-1154.056) [-1152.391] (-1156.440) (-1156.271) -- 0:00:15 742500 -- [-1152.387] (-1158.491) (-1155.710) (-1153.616) * (-1153.143) (-1152.329) (-1153.855) [-1152.743] -- 0:00:15 743000 -- (-1152.236) [-1156.070] (-1153.556) (-1155.002) * (-1155.107) (-1156.501) (-1152.614) [-1153.048] -- 0:00:16 743500 -- [-1153.835] (-1157.473) (-1153.247) (-1154.769) * (-1157.008) [-1153.145] (-1155.892) (-1153.620) -- 0:00:16 744000 -- [-1152.973] (-1154.432) (-1155.773) (-1154.812) * [-1155.955] (-1159.613) (-1157.314) (-1152.789) -- 0:00:16 744500 -- (-1152.402) (-1157.924) [-1155.895] (-1154.301) * (-1152.843) (-1156.641) [-1153.971] (-1153.074) -- 0:00:16 745000 -- [-1152.433] (-1156.054) (-1153.651) (-1153.971) * (-1152.870) (-1155.285) [-1154.661] (-1156.119) -- 0:00:16 Average standard deviation of split frequencies: 0.013144 745500 -- (-1154.417) (-1154.209) (-1153.290) [-1152.607] * (-1157.112) (-1152.620) [-1154.826] (-1153.465) -- 0:00:16 746000 -- (-1153.169) [-1154.792] (-1155.358) (-1152.604) * (-1153.907) [-1152.558] (-1155.538) (-1154.042) -- 0:00:16 746500 -- (-1152.659) (-1158.938) (-1155.968) [-1153.232] * [-1153.977] (-1154.529) (-1153.456) (-1153.781) -- 0:00:15 747000 -- (-1152.661) [-1158.072] (-1153.513) (-1155.661) * [-1154.848] (-1153.872) (-1152.481) (-1153.110) -- 0:00:15 747500 -- (-1154.739) (-1157.578) [-1153.196] (-1153.856) * (-1154.422) [-1152.770] (-1153.941) (-1153.437) -- 0:00:15 748000 -- (-1154.493) (-1157.676) [-1153.678] (-1153.189) * [-1153.471] (-1156.961) (-1155.410) (-1155.253) -- 0:00:15 748500 -- (-1156.725) [-1153.582] (-1153.204) (-1154.377) * (-1152.438) (-1153.354) (-1154.015) [-1155.843] -- 0:00:15 749000 -- [-1152.708] (-1154.110) (-1154.951) (-1157.114) * (-1154.204) (-1155.109) [-1155.570] (-1155.381) -- 0:00:15 749500 -- (-1153.016) (-1153.602) (-1155.413) [-1155.158] * (-1155.687) (-1154.305) (-1155.826) [-1154.206] -- 0:00:15 750000 -- (-1156.558) (-1154.794) [-1154.290] (-1154.626) * (-1154.167) [-1155.609] (-1154.036) (-1155.966) -- 0:00:15 Average standard deviation of split frequencies: 0.013313 750500 -- (-1153.446) [-1153.109] (-1159.202) (-1153.428) * (-1154.561) (-1153.496) (-1153.376) [-1158.398] -- 0:00:15 751000 -- (-1154.376) [-1153.444] (-1156.901) (-1155.968) * (-1153.619) (-1153.801) (-1153.347) [-1152.879] -- 0:00:15 751500 -- [-1156.500] (-1154.307) (-1154.189) (-1155.880) * (-1154.075) (-1152.401) [-1153.694] (-1153.622) -- 0:00:15 752000 -- (-1153.798) (-1152.727) [-1152.899] (-1155.812) * (-1154.249) [-1152.741] (-1152.081) (-1157.876) -- 0:00:15 752500 -- (-1158.163) [-1153.530] (-1153.690) (-1154.400) * (-1154.454) (-1153.742) [-1153.044] (-1155.659) -- 0:00:15 753000 -- (-1157.003) (-1155.155) (-1153.095) [-1153.509] * [-1152.019] (-1154.134) (-1155.112) (-1153.413) -- 0:00:15 753500 -- [-1153.682] (-1155.730) (-1153.048) (-1154.076) * (-1156.549) [-1154.286] (-1155.802) (-1156.499) -- 0:00:15 754000 -- [-1154.304] (-1154.192) (-1153.741) (-1154.236) * (-1153.400) [-1156.481] (-1154.925) (-1157.738) -- 0:00:15 754500 -- (-1155.771) (-1156.263) [-1153.753] (-1156.550) * (-1154.025) (-1156.819) (-1157.619) [-1154.661] -- 0:00:15 755000 -- (-1157.787) [-1154.388] (-1155.298) (-1157.809) * (-1153.270) [-1153.267] (-1154.858) (-1156.334) -- 0:00:15 Average standard deviation of split frequencies: 0.013261 755500 -- (-1155.525) (-1154.619) (-1152.334) [-1151.919] * (-1153.907) [-1156.299] (-1154.398) (-1154.934) -- 0:00:15 756000 -- (-1154.782) (-1155.808) (-1152.125) [-1151.919] * (-1154.798) (-1153.471) [-1159.363] (-1157.511) -- 0:00:15 756500 -- (-1154.044) (-1154.022) [-1152.621] (-1152.113) * (-1156.885) (-1154.510) [-1152.481] (-1158.690) -- 0:00:15 757000 -- (-1154.496) (-1153.234) (-1153.845) [-1154.854] * (-1152.083) (-1154.470) [-1152.453] (-1152.845) -- 0:00:15 757500 -- (-1153.820) [-1152.765] (-1155.028) (-1152.136) * (-1153.881) [-1152.680] (-1155.875) (-1153.650) -- 0:00:15 758000 -- (-1153.466) [-1153.253] (-1152.532) (-1153.582) * (-1157.098) (-1153.199) (-1152.948) [-1153.268] -- 0:00:15 758500 -- (-1153.316) [-1153.830] (-1152.943) (-1153.836) * [-1152.725] (-1152.999) (-1154.622) (-1152.749) -- 0:00:14 759000 -- (-1155.650) (-1152.016) [-1152.723] (-1153.006) * [-1152.931] (-1152.401) (-1153.945) (-1154.351) -- 0:00:14 759500 -- (-1153.486) (-1152.519) (-1153.004) [-1153.936] * (-1152.663) (-1153.699) (-1153.686) [-1153.775] -- 0:00:15 760000 -- [-1153.414] (-1153.391) (-1154.232) (-1154.849) * (-1153.353) (-1154.272) [-1153.114] (-1156.229) -- 0:00:15 Average standard deviation of split frequencies: 0.014447 760500 -- [-1154.074] (-1153.732) (-1153.020) (-1154.998) * [-1155.848] (-1152.638) (-1152.911) (-1157.734) -- 0:00:15 761000 -- (-1154.043) (-1152.594) (-1153.653) [-1152.084] * (-1158.629) (-1153.610) [-1162.038] (-1155.890) -- 0:00:15 761500 -- (-1154.044) [-1152.708] (-1152.435) (-1154.095) * [-1155.550] (-1153.354) (-1157.831) (-1155.524) -- 0:00:15 762000 -- (-1153.666) [-1154.850] (-1153.347) (-1152.570) * [-1154.283] (-1154.176) (-1153.753) (-1158.758) -- 0:00:14 762500 -- (-1156.210) (-1154.314) [-1152.207] (-1152.455) * (-1155.124) [-1153.088] (-1152.702) (-1153.518) -- 0:00:14 763000 -- (-1152.724) (-1154.641) [-1152.285] (-1152.929) * (-1155.201) [-1155.233] (-1152.773) (-1155.859) -- 0:00:14 763500 -- [-1153.887] (-1156.955) (-1154.080) (-1154.547) * (-1156.610) [-1152.741] (-1153.001) (-1158.958) -- 0:00:14 764000 -- (-1154.842) (-1152.920) (-1154.293) [-1153.390] * (-1155.083) (-1156.760) (-1156.310) [-1155.923] -- 0:00:14 764500 -- (-1153.841) [-1153.887] (-1153.195) (-1153.138) * (-1153.051) [-1152.719] (-1154.554) (-1154.860) -- 0:00:14 765000 -- (-1156.803) [-1157.141] (-1156.374) (-1153.425) * (-1156.105) (-1152.538) (-1155.663) [-1158.031] -- 0:00:14 Average standard deviation of split frequencies: 0.014270 765500 -- (-1152.456) [-1155.288] (-1156.141) (-1153.350) * (-1153.376) [-1153.498] (-1155.231) (-1153.362) -- 0:00:14 766000 -- [-1152.168] (-1154.871) (-1155.284) (-1155.686) * (-1153.965) [-1155.111] (-1156.136) (-1158.228) -- 0:00:14 766500 -- [-1152.133] (-1151.779) (-1152.665) (-1154.838) * (-1154.642) (-1153.870) (-1153.562) [-1154.601] -- 0:00:14 767000 -- (-1153.613) [-1153.386] (-1156.904) (-1153.886) * (-1153.368) (-1154.927) (-1153.212) [-1154.153] -- 0:00:14 767500 -- (-1154.675) (-1152.611) [-1153.880] (-1153.230) * (-1155.352) (-1155.134) (-1154.771) [-1153.743] -- 0:00:14 768000 -- (-1154.260) (-1154.886) [-1154.531] (-1153.765) * (-1152.471) (-1155.904) [-1155.623] (-1153.314) -- 0:00:14 768500 -- (-1154.929) (-1153.053) [-1154.614] (-1157.208) * (-1153.688) [-1156.868] (-1155.245) (-1153.445) -- 0:00:14 769000 -- [-1155.966] (-1152.582) (-1159.070) (-1153.598) * (-1154.420) [-1155.694] (-1154.260) (-1154.036) -- 0:00:14 769500 -- [-1156.086] (-1153.428) (-1156.964) (-1153.443) * (-1155.191) [-1155.658] (-1158.526) (-1153.850) -- 0:00:14 770000 -- [-1156.346] (-1154.952) (-1154.671) (-1153.848) * [-1152.211] (-1154.300) (-1158.668) (-1159.584) -- 0:00:14 Average standard deviation of split frequencies: 0.013865 770500 -- (-1156.695) (-1155.006) [-1155.544] (-1154.824) * (-1152.201) (-1153.257) [-1153.368] (-1154.430) -- 0:00:14 771000 -- (-1154.752) [-1152.275] (-1159.491) (-1154.872) * (-1156.048) (-1152.820) [-1154.346] (-1154.522) -- 0:00:14 771500 -- (-1152.592) [-1155.063] (-1154.174) (-1157.545) * (-1151.749) (-1153.000) (-1153.676) [-1154.027] -- 0:00:14 772000 -- (-1155.123) (-1154.434) (-1152.703) [-1154.614] * (-1152.135) (-1157.453) [-1152.157] (-1155.920) -- 0:00:14 772500 -- (-1154.626) (-1156.827) (-1154.637) [-1154.691] * [-1152.807] (-1154.173) (-1153.157) (-1158.804) -- 0:00:14 773000 -- (-1153.910) [-1155.763] (-1154.754) (-1152.318) * (-1160.911) (-1154.993) [-1153.596] (-1154.493) -- 0:00:14 773500 -- (-1153.160) (-1155.616) (-1153.980) [-1153.876] * [-1154.106] (-1154.818) (-1153.523) (-1154.410) -- 0:00:14 774000 -- (-1153.765) (-1155.837) [-1152.699] (-1154.757) * (-1155.194) (-1152.976) (-1153.297) [-1152.865] -- 0:00:14 774500 -- (-1154.230) (-1153.979) (-1153.690) [-1153.837] * (-1155.228) [-1153.937] (-1153.667) (-1152.342) -- 0:00:13 775000 -- (-1154.233) [-1154.833] (-1153.017) (-1156.517) * (-1154.718) (-1154.115) [-1152.434] (-1153.638) -- 0:00:13 Average standard deviation of split frequencies: 0.013729 775500 -- (-1155.644) (-1152.376) [-1152.369] (-1155.833) * (-1152.548) (-1155.630) (-1151.923) [-1154.213] -- 0:00:14 776000 -- (-1154.157) (-1155.331) [-1157.427] (-1158.394) * (-1155.168) (-1156.825) (-1152.485) [-1153.419] -- 0:00:14 776500 -- (-1153.373) [-1152.679] (-1155.023) (-1158.541) * (-1153.182) [-1152.652] (-1156.888) (-1152.690) -- 0:00:14 777000 -- (-1153.283) (-1155.087) [-1152.638] (-1156.782) * [-1154.562] (-1153.018) (-1155.902) (-1155.649) -- 0:00:14 777500 -- (-1154.408) [-1155.437] (-1152.316) (-1154.958) * [-1152.826] (-1152.571) (-1162.557) (-1156.394) -- 0:00:14 778000 -- (-1153.294) (-1153.175) [-1152.150] (-1156.598) * (-1155.964) (-1154.417) (-1158.252) [-1154.674] -- 0:00:13 778500 -- (-1153.139) (-1156.084) [-1154.798] (-1156.394) * (-1153.347) (-1153.137) (-1153.784) [-1154.237] -- 0:00:13 779000 -- (-1155.313) (-1155.216) (-1154.388) [-1156.833] * (-1154.153) (-1154.844) (-1156.828) [-1154.570] -- 0:00:13 779500 -- (-1152.659) (-1154.890) (-1153.345) [-1153.794] * (-1152.461) (-1155.084) [-1153.020] (-1156.275) -- 0:00:13 780000 -- [-1153.868] (-1159.307) (-1158.117) (-1152.836) * [-1153.175] (-1153.184) (-1152.689) (-1155.418) -- 0:00:13 Average standard deviation of split frequencies: 0.014170 780500 -- (-1152.716) [-1153.703] (-1156.162) (-1154.265) * (-1155.363) (-1157.320) [-1151.843] (-1153.172) -- 0:00:13 781000 -- (-1152.132) [-1152.090] (-1151.974) (-1152.484) * (-1155.052) (-1156.003) (-1152.246) [-1152.099] -- 0:00:13 781500 -- (-1153.378) [-1152.907] (-1152.492) (-1152.484) * (-1154.021) (-1154.132) [-1154.341] (-1152.230) -- 0:00:13 782000 -- [-1157.167] (-1154.393) (-1152.396) (-1152.484) * (-1154.020) (-1153.797) (-1152.748) [-1152.332] -- 0:00:13 782500 -- (-1152.656) (-1156.554) (-1156.716) [-1153.140] * [-1151.979] (-1153.156) (-1154.624) (-1153.376) -- 0:00:13 783000 -- [-1153.430] (-1157.063) (-1152.204) (-1154.702) * (-1156.367) [-1154.854] (-1155.219) (-1154.136) -- 0:00:13 783500 -- (-1155.201) [-1153.022] (-1152.723) (-1154.339) * [-1153.181] (-1153.720) (-1153.245) (-1152.095) -- 0:00:13 784000 -- (-1153.790) (-1152.451) (-1152.438) [-1154.248] * (-1154.070) [-1155.434] (-1155.546) (-1152.453) -- 0:00:13 784500 -- (-1152.981) (-1157.154) [-1152.998] (-1155.395) * [-1153.381] (-1154.332) (-1153.597) (-1154.691) -- 0:00:13 785000 -- (-1156.098) (-1153.678) [-1155.231] (-1154.840) * (-1153.315) (-1152.543) [-1153.497] (-1155.701) -- 0:00:13 Average standard deviation of split frequencies: 0.014154 785500 -- [-1155.696] (-1153.994) (-1153.756) (-1155.246) * (-1153.958) [-1152.998] (-1152.185) (-1152.429) -- 0:00:13 786000 -- (-1156.233) [-1153.779] (-1153.800) (-1153.739) * (-1154.725) [-1152.408] (-1153.565) (-1152.504) -- 0:00:13 786500 -- [-1156.842] (-1153.518) (-1157.391) (-1154.570) * [-1154.113] (-1155.097) (-1155.955) (-1154.614) -- 0:00:13 787000 -- (-1161.139) (-1154.153) (-1152.471) [-1155.040] * (-1153.622) (-1153.385) [-1152.284] (-1155.887) -- 0:00:13 787500 -- (-1154.352) (-1155.043) [-1152.851] (-1155.042) * (-1154.095) (-1153.430) [-1153.819] (-1160.859) -- 0:00:13 788000 -- (-1154.353) (-1156.274) (-1158.641) [-1152.641] * (-1154.979) (-1153.169) (-1153.352) [-1154.468] -- 0:00:13 788500 -- (-1153.225) (-1157.545) (-1156.533) [-1152.796] * (-1154.484) [-1154.274] (-1154.909) (-1153.948) -- 0:00:13 789000 -- (-1153.672) (-1155.838) [-1155.604] (-1153.912) * (-1153.062) (-1164.357) (-1154.237) [-1152.976] -- 0:00:13 789500 -- [-1152.131] (-1156.413) (-1153.501) (-1155.200) * [-1153.243] (-1157.278) (-1153.566) (-1157.258) -- 0:00:13 790000 -- [-1155.577] (-1154.144) (-1153.171) (-1155.989) * (-1156.175) [-1154.098] (-1154.297) (-1153.573) -- 0:00:13 Average standard deviation of split frequencies: 0.014495 790500 -- (-1153.352) (-1154.170) [-1154.401] (-1153.139) * (-1155.137) [-1153.368] (-1158.850) (-1155.045) -- 0:00:12 791000 -- (-1151.984) (-1155.155) (-1152.639) [-1153.655] * [-1152.528] (-1154.980) (-1158.398) (-1153.634) -- 0:00:12 791500 -- (-1151.915) [-1154.664] (-1152.144) (-1155.947) * (-1152.359) (-1154.261) (-1154.019) [-1154.286] -- 0:00:12 792000 -- [-1152.975] (-1155.747) (-1153.096) (-1154.339) * (-1158.481) (-1154.503) [-1153.802] (-1153.446) -- 0:00:13 792500 -- [-1153.802] (-1153.408) (-1154.269) (-1155.360) * (-1153.628) [-1155.354] (-1153.614) (-1155.441) -- 0:00:13 793000 -- (-1154.095) [-1152.664] (-1157.195) (-1154.590) * (-1152.835) (-1153.760) [-1153.287] (-1153.121) -- 0:00:13 793500 -- (-1153.380) (-1152.443) (-1153.996) [-1153.528] * (-1154.620) (-1155.672) [-1153.492] (-1156.194) -- 0:00:13 794000 -- (-1154.750) [-1154.523] (-1154.253) (-1153.941) * (-1158.240) (-1153.996) [-1152.609] (-1153.585) -- 0:00:12 794500 -- (-1155.208) (-1157.923) [-1152.644] (-1154.230) * (-1153.906) (-1155.202) (-1153.589) [-1152.728] -- 0:00:12 795000 -- (-1158.544) (-1158.152) (-1153.019) [-1155.020] * (-1154.276) (-1153.677) (-1155.734) [-1152.666] -- 0:00:12 Average standard deviation of split frequencies: 0.013503 795500 -- (-1154.686) [-1153.082] (-1152.373) (-1153.818) * [-1154.505] (-1157.741) (-1155.212) (-1154.323) -- 0:00:12 796000 -- (-1155.357) (-1157.532) (-1153.516) [-1156.233] * (-1160.512) (-1154.175) (-1153.416) [-1152.757] -- 0:00:12 796500 -- [-1155.268] (-1152.741) (-1154.734) (-1154.791) * (-1157.019) [-1153.130] (-1152.364) (-1153.775) -- 0:00:12 797000 -- (-1157.535) (-1156.303) [-1152.123] (-1152.723) * [-1157.431] (-1152.636) (-1153.844) (-1153.267) -- 0:00:12 797500 -- [-1154.775] (-1153.616) (-1153.814) (-1156.002) * (-1159.725) (-1152.914) [-1158.751] (-1155.716) -- 0:00:12 798000 -- (-1159.662) (-1154.590) (-1152.501) [-1154.069] * [-1158.803] (-1153.287) (-1153.043) (-1154.958) -- 0:00:12 798500 -- (-1152.059) [-1154.590] (-1154.308) (-1154.058) * (-1155.399) (-1154.075) [-1154.949] (-1152.919) -- 0:00:12 799000 -- (-1153.470) [-1152.588] (-1154.717) (-1161.613) * (-1152.750) [-1153.511] (-1153.078) (-1152.672) -- 0:00:12 799500 -- (-1154.212) (-1153.815) [-1152.486] (-1157.047) * (-1153.370) (-1158.975) [-1156.860] (-1152.957) -- 0:00:12 800000 -- [-1155.092] (-1152.095) (-1155.361) (-1157.855) * (-1156.656) [-1153.586] (-1155.451) (-1154.974) -- 0:00:12 Average standard deviation of split frequencies: 0.013777 800500 -- [-1153.341] (-1153.678) (-1155.311) (-1155.705) * (-1155.373) (-1153.452) (-1153.095) [-1152.992] -- 0:00:12 801000 -- [-1154.408] (-1153.725) (-1158.961) (-1151.913) * (-1153.630) (-1152.824) [-1153.869] (-1154.604) -- 0:00:12 801500 -- (-1153.918) [-1154.674] (-1155.378) (-1156.463) * [-1152.631] (-1153.342) (-1153.409) (-1153.011) -- 0:00:12 802000 -- (-1155.088) [-1153.046] (-1153.102) (-1156.315) * (-1154.436) [-1152.750] (-1154.530) (-1153.399) -- 0:00:12 802500 -- (-1153.368) (-1153.860) (-1153.140) [-1152.489] * [-1154.427] (-1153.564) (-1154.152) (-1153.987) -- 0:00:12 803000 -- (-1153.639) [-1152.444] (-1153.140) (-1153.234) * (-1154.121) [-1154.528] (-1160.884) (-1152.075) -- 0:00:12 803500 -- (-1153.236) (-1153.061) (-1152.877) [-1152.734] * (-1155.387) (-1160.838) (-1160.513) [-1152.521] -- 0:00:12 804000 -- [-1155.852] (-1154.780) (-1158.895) (-1152.080) * (-1153.269) (-1157.556) (-1159.476) [-1152.584] -- 0:00:12 804500 -- (-1155.075) [-1153.751] (-1154.311) (-1152.258) * (-1153.064) (-1157.209) (-1153.243) [-1154.283] -- 0:00:12 805000 -- [-1152.207] (-1153.600) (-1155.892) (-1152.258) * (-1155.513) (-1152.424) [-1155.802] (-1153.994) -- 0:00:12 Average standard deviation of split frequencies: 0.013881 805500 -- [-1152.553] (-1154.091) (-1155.939) (-1152.789) * [-1154.209] (-1152.551) (-1155.623) (-1153.780) -- 0:00:12 806000 -- (-1152.680) (-1152.020) [-1155.493] (-1156.380) * [-1156.595] (-1153.878) (-1154.813) (-1154.197) -- 0:00:12 806500 -- (-1154.084) (-1153.472) [-1154.487] (-1151.951) * (-1153.585) (-1154.053) [-1153.476] (-1152.984) -- 0:00:11 807000 -- (-1154.645) [-1152.698] (-1154.276) (-1152.085) * [-1155.197] (-1154.007) (-1152.829) (-1154.505) -- 0:00:11 807500 -- (-1156.504) [-1153.641] (-1153.947) (-1153.645) * [-1154.055] (-1152.067) (-1152.785) (-1153.350) -- 0:00:11 808000 -- (-1154.424) (-1156.354) [-1153.418] (-1153.167) * [-1152.828] (-1152.369) (-1156.145) (-1153.141) -- 0:00:12 808500 -- (-1155.131) [-1155.770] (-1154.393) (-1154.066) * [-1154.406] (-1153.410) (-1154.962) (-1155.175) -- 0:00:12 809000 -- [-1153.781] (-1154.236) (-1152.600) (-1153.133) * (-1152.787) (-1156.810) (-1155.156) [-1155.353] -- 0:00:12 809500 -- (-1156.441) (-1154.632) [-1152.954] (-1155.278) * (-1156.831) [-1156.378] (-1155.344) (-1153.895) -- 0:00:12 810000 -- [-1155.610] (-1155.577) (-1154.552) (-1153.747) * (-1153.564) [-1156.052] (-1154.615) (-1153.643) -- 0:00:11 Average standard deviation of split frequencies: 0.014065 810500 -- (-1155.909) [-1154.521] (-1155.120) (-1153.168) * (-1154.399) (-1153.405) (-1154.615) [-1152.155] -- 0:00:11 811000 -- (-1154.166) (-1156.564) [-1152.890] (-1152.450) * [-1155.266] (-1154.598) (-1152.827) (-1155.406) -- 0:00:11 811500 -- (-1153.664) [-1153.972] (-1152.052) (-1155.695) * (-1155.281) (-1154.089) [-1152.581] (-1159.700) -- 0:00:11 812000 -- (-1153.820) (-1156.393) (-1152.455) [-1154.734] * (-1155.295) (-1156.965) (-1152.287) [-1155.935] -- 0:00:11 812500 -- (-1152.160) (-1153.130) [-1156.116] (-1154.734) * (-1155.623) [-1157.969] (-1153.162) (-1157.195) -- 0:00:11 813000 -- [-1152.324] (-1153.450) (-1153.066) (-1154.009) * (-1157.511) [-1153.589] (-1155.664) (-1161.870) -- 0:00:11 813500 -- (-1153.198) [-1153.358] (-1154.293) (-1157.521) * (-1156.181) (-1155.455) [-1154.567] (-1154.735) -- 0:00:11 814000 -- (-1155.064) (-1153.615) [-1154.409] (-1156.053) * (-1156.788) [-1156.166] (-1154.353) (-1152.088) -- 0:00:11 814500 -- (-1153.022) (-1154.988) [-1159.895] (-1155.198) * [-1155.496] (-1154.032) (-1153.110) (-1156.750) -- 0:00:11 815000 -- [-1154.116] (-1151.889) (-1155.848) (-1153.250) * [-1153.238] (-1155.664) (-1154.571) (-1157.083) -- 0:00:11 Average standard deviation of split frequencies: 0.013829 815500 -- (-1157.182) [-1154.043] (-1154.883) (-1153.776) * (-1153.532) (-1152.962) (-1156.759) [-1154.856] -- 0:00:11 816000 -- (-1155.344) [-1153.659] (-1153.406) (-1153.041) * (-1152.858) (-1153.697) (-1156.029) [-1153.681] -- 0:00:11 816500 -- [-1152.579] (-1152.561) (-1152.761) (-1154.086) * (-1154.982) (-1156.877) (-1153.995) [-1152.501] -- 0:00:11 817000 -- [-1153.279] (-1158.129) (-1152.090) (-1153.346) * (-1154.244) (-1156.128) (-1154.177) [-1155.379] -- 0:00:11 817500 -- (-1154.735) (-1155.547) [-1152.050] (-1153.018) * (-1154.712) (-1154.703) [-1153.501] (-1155.273) -- 0:00:11 818000 -- (-1154.791) (-1156.842) [-1152.816] (-1154.191) * [-1155.679] (-1155.495) (-1156.083) (-1154.410) -- 0:00:11 818500 -- (-1155.505) [-1152.389] (-1152.817) (-1154.238) * (-1159.810) (-1152.565) [-1153.387] (-1156.070) -- 0:00:11 819000 -- [-1155.501] (-1152.131) (-1153.057) (-1154.704) * (-1153.323) [-1155.919] (-1154.428) (-1154.969) -- 0:00:11 819500 -- (-1157.408) (-1155.673) [-1156.739] (-1153.253) * (-1153.748) (-1155.116) [-1155.974] (-1154.705) -- 0:00:11 820000 -- (-1153.857) (-1160.478) (-1153.771) [-1153.697] * [-1153.742] (-1152.963) (-1154.376) (-1154.258) -- 0:00:11 Average standard deviation of split frequencies: 0.014054 820500 -- (-1153.866) (-1154.725) (-1155.763) [-1154.033] * (-1153.881) (-1155.206) [-1155.207] (-1157.660) -- 0:00:11 821000 -- (-1155.704) (-1156.379) (-1154.159) [-1153.368] * (-1156.523) (-1154.298) (-1153.912) [-1152.990] -- 0:00:11 821500 -- [-1154.157] (-1154.370) (-1153.277) (-1152.387) * (-1155.470) (-1156.754) [-1153.427] (-1155.339) -- 0:00:11 822000 -- (-1153.395) [-1155.263] (-1154.250) (-1154.601) * (-1155.844) (-1153.049) [-1153.735] (-1154.075) -- 0:00:11 822500 -- (-1156.503) (-1155.132) [-1153.295] (-1158.455) * (-1160.194) [-1152.526] (-1153.052) (-1154.659) -- 0:00:11 823000 -- (-1153.007) [-1155.897] (-1155.071) (-1157.969) * (-1162.140) [-1154.732] (-1152.926) (-1153.678) -- 0:00:10 823500 -- (-1155.483) (-1152.284) (-1154.928) [-1156.181] * [-1155.803] (-1152.208) (-1153.369) (-1154.050) -- 0:00:10 824000 -- (-1156.374) [-1155.139] (-1156.684) (-1153.344) * [-1155.783] (-1156.294) (-1154.986) (-1154.440) -- 0:00:10 824500 -- (-1153.480) (-1153.252) (-1157.486) [-1155.131] * (-1157.261) [-1158.524] (-1153.329) (-1153.921) -- 0:00:11 825000 -- (-1153.791) (-1153.260) [-1160.774] (-1153.646) * [-1154.089] (-1161.954) (-1153.512) (-1154.092) -- 0:00:11 Average standard deviation of split frequencies: 0.013545 825500 -- (-1155.152) [-1153.840] (-1152.809) (-1155.956) * (-1154.482) [-1155.691] (-1154.548) (-1157.866) -- 0:00:10 826000 -- (-1154.629) (-1155.645) [-1154.369] (-1156.122) * (-1158.695) [-1155.555] (-1153.149) (-1154.067) -- 0:00:10 826500 -- (-1155.667) (-1152.616) (-1153.260) [-1156.434] * (-1152.969) (-1153.899) [-1153.691] (-1153.602) -- 0:00:10 827000 -- (-1154.068) (-1153.260) [-1155.781] (-1154.860) * [-1155.889] (-1153.197) (-1153.082) (-1154.754) -- 0:00:10 827500 -- [-1155.016] (-1153.705) (-1154.079) (-1154.822) * (-1155.169) (-1156.383) (-1153.924) [-1153.493] -- 0:00:10 828000 -- (-1153.716) [-1155.249] (-1154.574) (-1157.631) * [-1152.682] (-1152.906) (-1152.732) (-1152.757) -- 0:00:10 828500 -- [-1154.288] (-1155.748) (-1154.856) (-1154.135) * (-1152.236) [-1153.001] (-1156.046) (-1152.903) -- 0:00:10 829000 -- (-1153.547) (-1155.464) [-1154.243] (-1153.149) * [-1154.183] (-1155.354) (-1160.153) (-1153.005) -- 0:00:10 829500 -- [-1152.826] (-1152.336) (-1154.514) (-1153.115) * [-1154.015] (-1155.153) (-1152.270) (-1154.273) -- 0:00:10 830000 -- (-1153.116) (-1152.853) (-1154.066) [-1152.536] * (-1153.894) (-1153.105) (-1154.584) [-1152.231] -- 0:00:10 Average standard deviation of split frequencies: 0.013015 830500 -- (-1153.116) [-1154.923] (-1155.877) (-1154.682) * (-1158.210) [-1153.699] (-1153.520) (-1154.445) -- 0:00:10 831000 -- (-1152.898) [-1154.454] (-1154.548) (-1153.567) * (-1154.664) (-1155.494) [-1153.545] (-1157.680) -- 0:00:10 831500 -- (-1152.626) (-1154.632) [-1153.355] (-1156.504) * (-1152.454) (-1155.576) (-1152.986) [-1158.439] -- 0:00:10 832000 -- (-1157.923) (-1154.863) [-1153.589] (-1154.926) * [-1155.639] (-1155.014) (-1153.448) (-1156.530) -- 0:00:10 832500 -- (-1157.441) (-1153.997) [-1153.246] (-1154.710) * (-1154.344) (-1155.513) [-1153.504] (-1156.248) -- 0:00:10 833000 -- (-1157.261) (-1155.875) [-1153.160] (-1154.394) * (-1154.720) [-1153.343] (-1158.467) (-1155.885) -- 0:00:10 833500 -- [-1154.499] (-1153.027) (-1154.643) (-1158.574) * (-1155.289) (-1154.335) (-1156.139) [-1158.120] -- 0:00:10 834000 -- (-1154.607) (-1153.248) [-1152.771] (-1156.022) * (-1153.282) (-1153.678) [-1153.212] (-1157.194) -- 0:00:10 834500 -- (-1153.330) (-1153.125) (-1152.707) [-1153.393] * (-1154.582) (-1156.393) (-1153.635) [-1152.386] -- 0:00:10 835000 -- (-1158.027) [-1152.620] (-1153.376) (-1158.907) * (-1153.150) (-1152.579) [-1154.560] (-1152.829) -- 0:00:10 Average standard deviation of split frequencies: 0.013308 835500 -- (-1152.498) [-1154.709] (-1152.831) (-1155.496) * (-1152.553) (-1159.294) (-1153.554) [-1156.456] -- 0:00:10 836000 -- (-1157.957) [-1152.396] (-1152.561) (-1155.269) * (-1152.873) (-1153.261) (-1156.949) [-1153.460] -- 0:00:10 836500 -- [-1154.345] (-1154.280) (-1154.205) (-1154.713) * (-1154.252) [-1154.023] (-1153.865) (-1152.850) -- 0:00:10 837000 -- (-1155.869) (-1154.552) (-1152.270) [-1157.964] * (-1152.519) (-1152.731) (-1153.222) [-1157.197] -- 0:00:10 837500 -- (-1153.620) (-1157.183) [-1153.178] (-1154.383) * [-1152.585] (-1152.200) (-1157.480) (-1152.219) -- 0:00:10 838000 -- (-1154.194) [-1154.853] (-1154.674) (-1156.242) * [-1154.174] (-1155.003) (-1157.722) (-1156.801) -- 0:00:10 838500 -- (-1155.256) [-1153.200] (-1154.042) (-1156.759) * [-1153.399] (-1152.706) (-1152.890) (-1152.405) -- 0:00:10 839000 -- (-1153.472) (-1152.642) (-1153.799) [-1154.256] * [-1155.359] (-1152.577) (-1153.049) (-1154.436) -- 0:00:09 839500 -- [-1154.677] (-1154.694) (-1153.103) (-1153.968) * (-1155.795) (-1155.107) (-1152.056) [-1152.344] -- 0:00:09 840000 -- [-1154.963] (-1155.223) (-1157.400) (-1152.345) * (-1161.645) (-1155.303) (-1154.948) [-1155.379] -- 0:00:09 Average standard deviation of split frequencies: 0.013383 840500 -- (-1154.874) (-1152.325) [-1153.777] (-1155.359) * (-1158.140) (-1152.574) (-1153.919) [-1153.286] -- 0:00:10 841000 -- (-1154.996) (-1153.590) (-1155.317) [-1154.298] * (-1154.591) [-1152.890] (-1152.277) (-1154.393) -- 0:00:10 841500 -- (-1156.747) (-1155.198) [-1154.036] (-1153.119) * (-1153.833) (-1152.850) [-1152.219] (-1154.499) -- 0:00:09 842000 -- (-1155.151) [-1154.416] (-1152.895) (-1152.707) * (-1159.960) (-1153.423) [-1153.029] (-1155.014) -- 0:00:09 842500 -- (-1154.495) [-1154.000] (-1154.423) (-1152.877) * (-1156.399) [-1154.984] (-1152.665) (-1155.794) -- 0:00:09 843000 -- [-1155.531] (-1154.339) (-1154.621) (-1155.376) * (-1154.851) (-1156.781) (-1154.051) [-1155.059] -- 0:00:09 843500 -- (-1153.510) [-1153.807] (-1153.645) (-1153.259) * (-1154.399) [-1154.533] (-1156.963) (-1152.935) -- 0:00:09 844000 -- (-1152.181) (-1157.776) [-1153.806] (-1154.960) * (-1152.245) [-1154.613] (-1156.038) (-1155.704) -- 0:00:09 844500 -- (-1157.009) (-1152.718) (-1153.351) [-1154.554] * (-1153.442) [-1153.587] (-1153.285) (-1155.674) -- 0:00:09 845000 -- (-1155.077) (-1154.713) (-1155.847) [-1152.749] * [-1155.312] (-1156.336) (-1158.043) (-1153.572) -- 0:00:09 Average standard deviation of split frequencies: 0.013002 845500 -- [-1152.973] (-1154.958) (-1152.771) (-1152.639) * (-1153.140) (-1157.382) (-1157.098) [-1153.173] -- 0:00:09 846000 -- (-1152.997) (-1155.657) (-1153.110) [-1151.933] * [-1153.780] (-1158.084) (-1153.713) (-1156.104) -- 0:00:09 846500 -- (-1153.280) (-1153.180) (-1153.339) [-1157.716] * (-1154.634) (-1152.610) [-1153.219] (-1156.947) -- 0:00:09 847000 -- (-1153.895) [-1156.917] (-1154.994) (-1153.654) * (-1155.590) (-1154.379) (-1153.661) [-1153.674] -- 0:00:09 847500 -- (-1152.867) [-1154.302] (-1155.689) (-1153.291) * (-1155.909) [-1152.486] (-1152.428) (-1155.794) -- 0:00:09 848000 -- [-1153.143] (-1154.326) (-1157.604) (-1154.238) * [-1153.495] (-1153.623) (-1155.675) (-1154.179) -- 0:00:09 848500 -- (-1154.566) (-1154.518) [-1153.450] (-1152.425) * [-1155.548] (-1154.532) (-1153.920) (-1154.115) -- 0:00:09 849000 -- (-1155.042) (-1152.235) (-1154.484) [-1152.412] * (-1153.707) [-1153.085] (-1153.629) (-1152.697) -- 0:00:09 849500 -- [-1154.076] (-1154.549) (-1153.343) (-1152.521) * (-1153.283) (-1153.001) (-1153.589) [-1152.640] -- 0:00:09 850000 -- (-1155.794) (-1153.500) (-1155.306) [-1152.340] * [-1156.336] (-1153.922) (-1152.770) (-1159.199) -- 0:00:09 Average standard deviation of split frequencies: 0.013004 850500 -- (-1154.930) [-1157.741] (-1156.518) (-1155.443) * (-1153.586) [-1154.459] (-1154.052) (-1156.942) -- 0:00:09 851000 -- (-1160.790) (-1157.303) [-1157.665] (-1152.851) * (-1157.957) (-1154.561) [-1156.545] (-1156.595) -- 0:00:09 851500 -- (-1153.732) [-1154.547] (-1155.980) (-1156.665) * [-1152.482] (-1153.075) (-1152.959) (-1157.849) -- 0:00:09 852000 -- (-1152.934) [-1156.259] (-1153.605) (-1160.328) * (-1152.698) (-1157.684) [-1153.060] (-1152.944) -- 0:00:09 852500 -- (-1155.600) (-1157.045) (-1153.923) [-1154.192] * (-1153.065) [-1154.022] (-1153.303) (-1154.837) -- 0:00:09 853000 -- [-1154.529] (-1154.163) (-1153.204) (-1153.590) * [-1154.991] (-1152.906) (-1153.978) (-1152.826) -- 0:00:09 853500 -- (-1156.752) (-1153.201) (-1155.478) [-1157.180] * [-1153.588] (-1154.319) (-1153.881) (-1159.369) -- 0:00:09 854000 -- (-1153.052) (-1153.557) [-1152.543] (-1153.591) * (-1152.089) (-1152.454) (-1155.203) [-1154.965] -- 0:00:09 854500 -- [-1152.780] (-1155.155) (-1154.833) (-1153.819) * (-1152.421) (-1155.073) [-1153.212] (-1153.107) -- 0:00:09 855000 -- [-1154.452] (-1154.214) (-1154.047) (-1155.662) * (-1153.548) (-1159.131) [-1152.878] (-1152.974) -- 0:00:08 Average standard deviation of split frequencies: 0.012776 855500 -- [-1156.379] (-1153.007) (-1152.995) (-1157.946) * (-1154.292) (-1156.479) [-1153.630] (-1153.774) -- 0:00:08 856000 -- [-1156.688] (-1155.319) (-1157.581) (-1155.196) * (-1152.614) (-1153.976) [-1153.622] (-1153.661) -- 0:00:08 856500 -- (-1156.927) [-1152.793] (-1155.051) (-1154.090) * (-1155.195) (-1155.553) (-1153.623) [-1154.749] -- 0:00:08 857000 -- [-1153.725] (-1155.400) (-1157.263) (-1154.162) * (-1154.755) (-1152.622) [-1154.190] (-1161.019) -- 0:00:09 857500 -- [-1157.248] (-1156.479) (-1152.907) (-1153.392) * (-1153.241) (-1151.998) [-1153.760] (-1153.886) -- 0:00:08 858000 -- (-1157.823) (-1153.845) [-1154.496] (-1153.146) * [-1151.944] (-1152.297) (-1154.910) (-1153.647) -- 0:00:08 858500 -- (-1158.843) (-1157.414) (-1155.006) [-1154.981] * (-1153.705) [-1153.381] (-1156.198) (-1154.645) -- 0:00:08 859000 -- (-1159.355) (-1152.754) (-1155.006) [-1155.360] * [-1153.174] (-1154.690) (-1158.282) (-1154.022) -- 0:00:08 859500 -- [-1152.597] (-1156.582) (-1157.266) (-1154.098) * [-1152.758] (-1153.415) (-1153.833) (-1153.195) -- 0:00:08 860000 -- (-1154.092) (-1152.298) (-1156.151) [-1154.764] * (-1155.983) [-1156.288] (-1154.190) (-1152.276) -- 0:00:08 Average standard deviation of split frequencies: 0.012525 860500 -- (-1153.202) (-1155.202) (-1153.630) [-1153.138] * (-1154.454) [-1154.257] (-1160.009) (-1159.082) -- 0:00:08 861000 -- [-1153.224] (-1153.078) (-1156.112) (-1154.951) * (-1155.648) (-1154.134) [-1152.222] (-1156.209) -- 0:00:08 861500 -- (-1153.395) (-1154.182) (-1154.227) [-1153.095] * (-1152.619) (-1160.460) (-1154.296) [-1154.397] -- 0:00:08 862000 -- [-1152.647] (-1152.171) (-1153.604) (-1152.945) * (-1152.715) (-1154.636) [-1153.500] (-1154.107) -- 0:00:08 862500 -- (-1155.229) (-1155.955) [-1152.359] (-1153.589) * [-1152.764] (-1155.065) (-1152.421) (-1153.961) -- 0:00:08 863000 -- (-1160.811) (-1157.134) (-1152.557) [-1154.681] * [-1152.997] (-1151.879) (-1156.230) (-1153.906) -- 0:00:08 863500 -- (-1155.319) (-1152.728) [-1153.027] (-1151.918) * [-1155.959] (-1152.678) (-1155.492) (-1153.788) -- 0:00:08 864000 -- [-1156.804] (-1153.342) (-1155.762) (-1157.890) * (-1152.692) (-1157.002) [-1153.283] (-1155.088) -- 0:00:08 864500 -- (-1153.920) (-1153.134) (-1154.384) [-1155.698] * (-1153.687) [-1157.912] (-1153.058) (-1152.540) -- 0:00:08 865000 -- (-1156.033) [-1152.708] (-1153.003) (-1154.852) * (-1153.045) (-1154.936) (-1158.096) [-1153.004] -- 0:00:08 Average standard deviation of split frequencies: 0.012484 865500 -- (-1155.970) (-1161.063) (-1154.798) [-1152.841] * [-1153.456] (-1155.615) (-1155.047) (-1152.218) -- 0:00:08 866000 -- (-1154.301) (-1153.248) [-1153.580] (-1152.843) * (-1160.387) (-1153.218) [-1155.460] (-1153.014) -- 0:00:08 866500 -- [-1153.915] (-1155.884) (-1157.522) (-1152.902) * (-1152.675) [-1154.508] (-1152.441) (-1153.135) -- 0:00:08 867000 -- (-1153.048) [-1153.324] (-1153.993) (-1159.593) * [-1153.155] (-1153.049) (-1154.413) (-1152.652) -- 0:00:08 867500 -- [-1153.987] (-1153.657) (-1156.973) (-1155.960) * (-1158.886) [-1154.589] (-1152.485) (-1154.952) -- 0:00:08 868000 -- (-1153.285) (-1155.137) [-1156.496] (-1156.650) * [-1157.009] (-1155.137) (-1153.256) (-1154.669) -- 0:00:08 868500 -- (-1153.982) [-1155.911] (-1157.186) (-1156.111) * (-1153.985) [-1153.775] (-1152.154) (-1154.504) -- 0:00:08 869000 -- (-1154.719) (-1152.593) (-1155.458) [-1155.626] * [-1153.307] (-1153.229) (-1153.531) (-1155.303) -- 0:00:08 869500 -- [-1152.917] (-1153.154) (-1155.132) (-1153.479) * [-1157.502] (-1153.024) (-1154.832) (-1152.620) -- 0:00:08 870000 -- (-1154.915) [-1153.786] (-1156.980) (-1152.596) * (-1153.295) (-1153.462) (-1153.399) [-1153.482] -- 0:00:08 Average standard deviation of split frequencies: 0.012308 870500 -- [-1155.656] (-1157.485) (-1154.485) (-1155.311) * (-1153.692) (-1153.722) [-1154.174] (-1153.071) -- 0:00:08 871000 -- (-1155.399) (-1157.097) [-1153.207] (-1157.489) * [-1152.729] (-1153.250) (-1154.795) (-1152.478) -- 0:00:07 871500 -- (-1155.179) (-1154.404) (-1153.374) [-1154.617] * (-1155.088) [-1155.225] (-1155.806) (-1152.388) -- 0:00:07 872000 -- (-1152.842) [-1153.392] (-1153.619) (-1153.783) * (-1155.228) [-1153.927] (-1153.922) (-1152.905) -- 0:00:07 872500 -- (-1154.047) (-1154.055) (-1152.544) [-1152.621] * (-1152.560) (-1153.011) (-1153.604) [-1153.691] -- 0:00:07 873000 -- (-1152.511) [-1153.021] (-1154.455) (-1152.087) * (-1154.493) (-1154.282) [-1155.479] (-1157.930) -- 0:00:08 873500 -- [-1152.458] (-1153.563) (-1155.567) (-1156.946) * (-1154.763) (-1155.501) (-1153.528) [-1154.873] -- 0:00:07 874000 -- (-1154.726) [-1154.291] (-1154.674) (-1154.500) * (-1154.917) [-1156.003] (-1154.627) (-1152.408) -- 0:00:07 874500 -- [-1155.159] (-1155.600) (-1153.763) (-1154.827) * (-1153.826) (-1157.058) (-1153.774) [-1158.609] -- 0:00:07 875000 -- (-1155.874) [-1152.320] (-1153.129) (-1155.411) * (-1155.311) (-1152.266) [-1155.810] (-1158.330) -- 0:00:07 Average standard deviation of split frequencies: 0.012413 875500 -- [-1153.518] (-1152.484) (-1154.102) (-1154.372) * (-1156.633) (-1152.516) [-1156.522] (-1155.174) -- 0:00:07 876000 -- [-1152.992] (-1154.011) (-1154.561) (-1154.239) * (-1154.128) (-1157.528) [-1153.216] (-1157.053) -- 0:00:07 876500 -- (-1159.487) (-1154.492) (-1153.506) [-1152.058] * [-1155.404] (-1153.544) (-1153.806) (-1155.964) -- 0:00:07 877000 -- (-1159.487) (-1158.514) [-1154.093] (-1152.287) * [-1153.503] (-1152.508) (-1154.044) (-1154.220) -- 0:00:07 877500 -- [-1154.698] (-1154.373) (-1155.486) (-1155.032) * [-1155.075] (-1152.236) (-1156.590) (-1153.435) -- 0:00:07 878000 -- (-1157.185) [-1152.579] (-1156.845) (-1152.295) * [-1151.972] (-1153.250) (-1154.846) (-1151.884) -- 0:00:07 878500 -- (-1158.406) (-1152.007) [-1153.274] (-1154.986) * (-1151.994) (-1152.806) [-1152.742] (-1152.067) -- 0:00:07 879000 -- (-1152.996) (-1153.389) (-1153.911) [-1156.423] * [-1152.740] (-1154.572) (-1154.331) (-1152.449) -- 0:00:07 879500 -- (-1156.587) [-1152.835] (-1154.340) (-1154.564) * (-1153.029) [-1154.308] (-1157.732) (-1152.276) -- 0:00:07 880000 -- (-1154.873) (-1152.916) (-1155.099) [-1153.422] * [-1153.866] (-1154.459) (-1152.821) (-1154.208) -- 0:00:07 Average standard deviation of split frequencies: 0.012169 880500 -- (-1160.124) (-1155.149) (-1154.455) [-1152.417] * (-1153.157) (-1153.484) [-1152.959] (-1157.449) -- 0:00:07 881000 -- (-1154.010) [-1152.758] (-1152.547) (-1153.559) * (-1152.860) [-1154.300] (-1155.075) (-1157.258) -- 0:00:07 881500 -- [-1153.386] (-1156.791) (-1153.645) (-1153.397) * (-1152.860) (-1153.584) [-1156.286] (-1155.666) -- 0:00:07 882000 -- (-1154.540) (-1156.457) (-1154.162) [-1153.173] * (-1154.685) [-1152.491] (-1155.539) (-1152.819) -- 0:00:07 882500 -- (-1159.046) [-1153.812] (-1158.191) (-1152.911) * (-1153.125) (-1155.164) [-1152.410] (-1154.238) -- 0:00:07 883000 -- (-1155.906) (-1158.335) (-1156.204) [-1153.592] * (-1154.872) (-1161.002) (-1152.424) [-1153.551] -- 0:00:07 883500 -- (-1154.197) (-1155.300) (-1157.883) [-1153.903] * (-1153.727) (-1156.901) (-1155.239) [-1153.241] -- 0:00:07 884000 -- (-1154.318) [-1154.172] (-1153.743) (-1156.857) * [-1152.920] (-1155.035) (-1153.225) (-1152.942) -- 0:00:07 884500 -- (-1158.607) (-1157.504) [-1152.375] (-1153.728) * (-1153.899) (-1152.310) [-1152.833] (-1153.507) -- 0:00:07 885000 -- (-1152.683) [-1153.335] (-1152.679) (-1154.379) * [-1157.231] (-1155.498) (-1154.327) (-1156.011) -- 0:00:07 Average standard deviation of split frequencies: 0.012271 885500 -- (-1153.047) (-1154.907) [-1152.588] (-1155.611) * (-1153.883) (-1155.559) (-1154.216) [-1153.714] -- 0:00:07 886000 -- (-1154.071) [-1152.044] (-1155.217) (-1155.729) * (-1153.916) (-1152.475) [-1154.638] (-1156.239) -- 0:00:07 886500 -- (-1154.181) [-1152.600] (-1153.788) (-1154.743) * (-1153.895) (-1152.512) (-1154.466) [-1153.266] -- 0:00:07 887000 -- (-1157.134) [-1152.323] (-1156.128) (-1153.926) * (-1158.420) (-1152.511) (-1156.905) [-1152.404] -- 0:00:07 887500 -- (-1157.514) [-1153.960] (-1153.573) (-1154.339) * (-1160.993) [-1152.711] (-1154.096) (-1152.149) -- 0:00:06 888000 -- (-1154.920) (-1153.975) (-1156.156) [-1154.790] * (-1154.662) (-1152.342) (-1155.352) [-1155.303] -- 0:00:06 888500 -- [-1153.497] (-1154.257) (-1152.439) (-1152.926) * [-1152.869] (-1152.449) (-1163.144) (-1155.204) -- 0:00:06 889000 -- (-1157.606) (-1153.590) [-1153.374] (-1153.217) * (-1155.170) (-1156.616) (-1156.621) [-1157.425] -- 0:00:06 889500 -- [-1153.998] (-1154.698) (-1157.437) (-1156.822) * [-1154.059] (-1153.694) (-1153.959) (-1153.197) -- 0:00:06 890000 -- [-1158.383] (-1152.852) (-1152.074) (-1152.767) * [-1153.254] (-1154.947) (-1152.875) (-1156.398) -- 0:00:06 Average standard deviation of split frequencies: 0.011924 890500 -- [-1155.954] (-1152.632) (-1153.439) (-1152.305) * [-1153.799] (-1154.940) (-1154.600) (-1156.042) -- 0:00:06 891000 -- [-1152.804] (-1154.092) (-1154.145) (-1157.209) * (-1153.149) [-1154.068] (-1153.489) (-1156.369) -- 0:00:06 891500 -- (-1153.651) [-1162.303] (-1153.874) (-1154.537) * (-1153.760) (-1153.881) (-1152.854) [-1154.219] -- 0:00:06 892000 -- [-1155.374] (-1153.989) (-1152.164) (-1158.831) * (-1153.935) [-1152.020] (-1154.950) (-1154.754) -- 0:00:06 892500 -- [-1156.105] (-1153.910) (-1153.331) (-1159.600) * (-1156.157) [-1153.518] (-1157.570) (-1152.540) -- 0:00:06 893000 -- (-1153.380) (-1153.771) [-1152.524] (-1158.125) * (-1153.872) [-1154.677] (-1153.809) (-1155.344) -- 0:00:06 893500 -- (-1151.908) (-1155.682) (-1155.154) [-1155.213] * (-1154.831) (-1159.299) (-1152.785) [-1155.173] -- 0:00:06 894000 -- (-1155.849) (-1156.905) [-1152.795] (-1154.771) * [-1153.451] (-1154.008) (-1152.787) (-1152.345) -- 0:00:06 894500 -- (-1153.622) (-1155.991) [-1153.665] (-1152.980) * (-1155.087) [-1152.904] (-1154.118) (-1154.393) -- 0:00:06 895000 -- [-1153.586] (-1153.237) (-1153.953) (-1154.000) * (-1155.706) (-1156.201) [-1153.404] (-1154.452) -- 0:00:06 Average standard deviation of split frequencies: 0.012035 895500 -- (-1153.634) [-1153.706] (-1152.871) (-1156.146) * (-1156.276) (-1155.091) (-1158.744) [-1154.536] -- 0:00:06 896000 -- (-1156.450) (-1157.139) (-1152.697) [-1157.175] * (-1154.657) [-1155.402] (-1155.569) (-1155.658) -- 0:00:06 896500 -- (-1154.036) (-1158.148) [-1153.415] (-1156.863) * (-1153.391) (-1153.703) (-1156.767) [-1152.199] -- 0:00:06 897000 -- (-1153.657) [-1154.568] (-1154.139) (-1160.298) * (-1154.784) [-1152.151] (-1153.913) (-1152.313) -- 0:00:06 897500 -- (-1153.969) (-1157.768) [-1152.258] (-1159.287) * (-1153.960) [-1153.758] (-1154.377) (-1152.161) -- 0:00:06 898000 -- (-1154.718) (-1154.083) [-1152.199] (-1158.055) * [-1155.783] (-1152.867) (-1157.581) (-1152.355) -- 0:00:06 898500 -- [-1153.404] (-1153.143) (-1152.946) (-1156.849) * (-1152.183) (-1153.113) [-1156.575] (-1153.790) -- 0:00:06 899000 -- (-1156.008) [-1152.727] (-1155.956) (-1155.551) * (-1152.962) (-1153.467) [-1153.767] (-1155.350) -- 0:00:06 899500 -- (-1154.519) (-1155.688) (-1155.496) [-1154.908] * (-1152.384) (-1152.586) [-1153.011] (-1154.972) -- 0:00:06 900000 -- (-1156.571) (-1156.185) [-1155.419] (-1157.899) * (-1153.062) [-1152.419] (-1152.720) (-1156.096) -- 0:00:06 Average standard deviation of split frequencies: 0.012069 900500 -- (-1156.192) (-1154.698) (-1155.468) [-1152.892] * (-1155.970) [-1157.502] (-1152.286) (-1156.229) -- 0:00:06 901000 -- (-1152.629) (-1154.526) [-1154.875] (-1152.414) * (-1155.705) (-1154.990) [-1153.769] (-1155.712) -- 0:00:06 901500 -- (-1154.980) (-1152.006) [-1154.763] (-1152.917) * (-1153.673) (-1156.158) (-1155.599) [-1152.137] -- 0:00:06 902000 -- (-1154.787) (-1152.023) [-1153.669] (-1152.966) * (-1152.561) (-1155.113) [-1154.589] (-1153.799) -- 0:00:06 902500 -- [-1155.093] (-1153.455) (-1152.230) (-1153.931) * (-1152.989) (-1153.617) (-1152.668) [-1153.441] -- 0:00:06 903000 -- (-1154.792) (-1156.106) [-1152.629] (-1153.317) * (-1154.674) (-1153.422) (-1152.299) [-1152.420] -- 0:00:06 903500 -- (-1153.436) (-1152.573) (-1153.439) [-1158.657] * (-1153.710) (-1155.067) [-1152.551] (-1152.921) -- 0:00:05 904000 -- (-1155.719) (-1152.948) [-1154.377] (-1153.185) * (-1153.932) (-1159.423) (-1152.574) [-1152.294] -- 0:00:05 904500 -- (-1152.604) (-1153.615) (-1153.728) [-1155.750] * (-1158.318) [-1153.945] (-1157.674) (-1153.725) -- 0:00:05 905000 -- (-1155.244) (-1155.907) (-1154.636) [-1153.395] * (-1157.293) (-1153.971) (-1156.860) [-1153.375] -- 0:00:05 Average standard deviation of split frequencies: 0.012059 905500 -- (-1154.709) (-1155.379) (-1155.498) [-1153.051] * (-1155.514) (-1153.665) [-1155.915] (-1153.029) -- 0:00:05 906000 -- (-1156.581) (-1156.331) (-1156.205) [-1152.663] * [-1153.475] (-1153.573) (-1154.788) (-1153.825) -- 0:00:05 906500 -- [-1153.529] (-1155.356) (-1152.824) (-1156.161) * (-1154.504) (-1156.770) [-1154.569] (-1153.945) -- 0:00:05 907000 -- [-1155.103] (-1156.343) (-1152.894) (-1153.564) * (-1152.181) (-1152.510) (-1155.402) [-1152.248] -- 0:00:05 907500 -- (-1155.387) [-1152.199] (-1152.941) (-1154.218) * (-1154.199) [-1154.434] (-1154.838) (-1155.001) -- 0:00:05 908000 -- (-1155.260) (-1154.891) [-1152.495] (-1155.567) * (-1156.074) (-1156.468) (-1153.754) [-1154.213] -- 0:00:05 908500 -- (-1154.075) (-1159.967) (-1153.259) [-1153.495] * (-1156.485) [-1156.726] (-1153.634) (-1152.235) -- 0:00:05 909000 -- (-1152.157) (-1153.813) (-1156.330) [-1155.624] * (-1158.108) (-1152.997) (-1152.942) [-1153.383] -- 0:00:05 909500 -- (-1153.175) (-1153.470) (-1154.501) [-1153.121] * [-1153.530] (-1154.953) (-1152.593) (-1153.993) -- 0:00:05 910000 -- (-1152.195) (-1156.454) (-1153.107) [-1152.507] * (-1155.871) (-1153.621) [-1156.057] (-1156.037) -- 0:00:05 Average standard deviation of split frequencies: 0.011997 910500 -- [-1154.329] (-1154.242) (-1154.854) (-1156.597) * (-1155.835) [-1154.493] (-1153.384) (-1152.956) -- 0:00:05 911000 -- (-1155.239) [-1152.328] (-1153.588) (-1155.561) * (-1156.033) [-1155.973] (-1154.224) (-1152.820) -- 0:00:05 911500 -- (-1156.230) (-1153.806) (-1153.622) [-1155.396] * (-1157.342) [-1156.052] (-1154.055) (-1152.622) -- 0:00:05 912000 -- (-1155.038) (-1153.089) (-1152.039) [-1156.300] * (-1153.536) (-1155.308) (-1157.887) [-1153.965] -- 0:00:05 912500 -- [-1156.512] (-1152.621) (-1151.960) (-1154.190) * [-1156.269] (-1153.941) (-1154.644) (-1155.711) -- 0:00:05 913000 -- (-1154.730) [-1152.207] (-1151.961) (-1154.558) * [-1155.997] (-1154.877) (-1153.066) (-1156.869) -- 0:00:05 913500 -- [-1153.228] (-1154.578) (-1151.881) (-1152.965) * (-1153.476) (-1152.748) (-1153.237) [-1155.880] -- 0:00:05 914000 -- (-1154.422) (-1152.543) [-1153.571] (-1155.378) * [-1154.677] (-1154.379) (-1152.357) (-1155.484) -- 0:00:05 914500 -- (-1153.651) (-1152.190) (-1153.934) [-1156.859] * (-1153.103) [-1153.074] (-1152.203) (-1154.469) -- 0:00:05 915000 -- (-1154.774) [-1152.996] (-1155.205) (-1153.561) * (-1153.545) (-1153.402) (-1153.992) [-1152.580] -- 0:00:05 Average standard deviation of split frequencies: 0.012062 915500 -- (-1154.504) (-1154.580) (-1159.327) [-1153.147] * (-1153.949) (-1155.288) (-1153.607) [-1153.850] -- 0:00:05 916000 -- (-1152.817) (-1153.259) (-1152.542) [-1154.258] * (-1155.428) (-1155.654) (-1153.453) [-1153.160] -- 0:00:05 916500 -- (-1152.830) (-1153.119) (-1152.821) [-1152.716] * [-1152.440] (-1160.301) (-1153.728) (-1153.930) -- 0:00:05 917000 -- (-1152.279) [-1153.003] (-1154.232) (-1158.850) * (-1152.350) [-1152.911] (-1152.734) (-1152.825) -- 0:00:05 917500 -- (-1153.840) (-1154.676) (-1157.170) [-1154.619] * (-1153.502) (-1154.956) [-1157.848] (-1157.217) -- 0:00:05 918000 -- [-1155.790] (-1155.549) (-1153.186) (-1152.099) * (-1153.811) (-1154.450) (-1152.982) [-1156.087] -- 0:00:05 918500 -- (-1152.725) (-1159.006) (-1155.849) [-1151.977] * (-1154.641) (-1159.086) [-1152.789] (-1155.250) -- 0:00:05 919000 -- (-1152.242) [-1157.292] (-1153.177) (-1156.487) * (-1154.789) (-1155.044) [-1152.931] (-1154.570) -- 0:00:05 919500 -- (-1157.443) (-1154.096) (-1155.087) [-1156.944] * [-1154.090] (-1155.481) (-1155.052) (-1155.313) -- 0:00:04 920000 -- (-1153.329) [-1153.522] (-1156.765) (-1156.217) * [-1154.208] (-1154.171) (-1154.855) (-1160.184) -- 0:00:04 Average standard deviation of split frequencies: 0.011681 920500 -- [-1152.903] (-1154.519) (-1158.645) (-1159.522) * [-1153.694] (-1156.357) (-1153.732) (-1156.373) -- 0:00:04 921000 -- (-1153.729) [-1152.700] (-1154.253) (-1155.431) * [-1152.886] (-1158.173) (-1156.251) (-1152.831) -- 0:00:04 921500 -- (-1152.718) (-1152.689) [-1155.245] (-1157.525) * (-1152.616) (-1154.174) (-1156.543) [-1155.265] -- 0:00:04 922000 -- (-1152.479) (-1154.642) (-1154.252) [-1153.854] * [-1152.847] (-1153.332) (-1153.346) (-1155.116) -- 0:00:04 922500 -- (-1152.488) (-1153.416) (-1154.513) [-1153.971] * (-1152.827) [-1153.229] (-1163.036) (-1154.095) -- 0:00:04 923000 -- [-1153.340] (-1154.558) (-1153.256) (-1153.049) * (-1153.657) [-1152.309] (-1155.625) (-1151.929) -- 0:00:04 923500 -- (-1156.436) (-1152.317) [-1157.025] (-1154.709) * [-1152.735] (-1153.586) (-1154.183) (-1153.562) -- 0:00:04 924000 -- [-1153.571] (-1152.318) (-1153.310) (-1154.463) * (-1155.362) [-1153.956] (-1155.653) (-1152.658) -- 0:00:04 924500 -- (-1155.016) [-1153.902] (-1155.857) (-1153.465) * (-1153.249) (-1152.162) (-1154.786) [-1156.209] -- 0:00:04 925000 -- (-1153.484) (-1155.209) [-1153.246] (-1153.438) * (-1153.915) (-1153.392) (-1156.413) [-1153.848] -- 0:00:04 Average standard deviation of split frequencies: 0.011645 925500 -- (-1154.533) (-1157.804) (-1155.178) [-1154.181] * (-1153.406) [-1152.432] (-1154.541) (-1156.887) -- 0:00:04 926000 -- (-1152.587) [-1154.271] (-1154.034) (-1154.138) * (-1154.354) (-1152.860) (-1154.625) [-1157.123] -- 0:00:04 926500 -- (-1152.753) (-1154.781) (-1155.434) [-1155.666] * (-1153.945) [-1153.117] (-1155.172) (-1157.419) -- 0:00:04 927000 -- (-1152.908) (-1156.891) (-1157.768) [-1153.152] * (-1153.788) (-1154.369) [-1154.592] (-1152.523) -- 0:00:04 927500 -- [-1152.950] (-1156.550) (-1153.823) (-1153.021) * [-1152.722] (-1153.549) (-1156.292) (-1152.515) -- 0:00:04 928000 -- (-1155.824) [-1154.151] (-1152.793) (-1155.773) * [-1154.588] (-1154.900) (-1154.219) (-1152.175) -- 0:00:04 928500 -- [-1153.257] (-1153.598) (-1157.334) (-1157.855) * (-1153.200) [-1154.902] (-1155.902) (-1153.554) -- 0:00:04 929000 -- (-1156.349) [-1153.611] (-1153.569) (-1161.406) * [-1152.469] (-1157.504) (-1158.356) (-1152.428) -- 0:00:04 929500 -- (-1153.435) (-1153.798) (-1154.117) [-1154.470] * [-1154.973] (-1157.577) (-1156.436) (-1155.443) -- 0:00:04 930000 -- (-1155.080) (-1153.605) [-1154.603] (-1151.862) * (-1155.614) [-1153.650] (-1156.443) (-1154.169) -- 0:00:04 Average standard deviation of split frequencies: 0.011365 930500 -- (-1153.744) (-1156.758) [-1155.708] (-1152.760) * (-1152.168) (-1154.741) [-1158.905] (-1152.985) -- 0:00:04 931000 -- [-1154.942] (-1154.316) (-1153.700) (-1152.637) * [-1153.923] (-1155.469) (-1157.669) (-1155.305) -- 0:00:04 931500 -- (-1154.501) [-1154.205] (-1153.610) (-1155.384) * (-1154.285) (-1156.769) [-1154.445] (-1159.401) -- 0:00:04 932000 -- [-1154.506] (-1155.763) (-1155.706) (-1153.878) * (-1154.221) [-1152.649] (-1162.654) (-1156.989) -- 0:00:04 932500 -- (-1154.403) (-1155.169) (-1154.072) [-1152.116] * (-1152.784) (-1153.980) [-1152.200] (-1156.545) -- 0:00:04 933000 -- [-1153.363] (-1155.558) (-1158.668) (-1154.180) * (-1154.094) [-1156.265] (-1153.335) (-1153.333) -- 0:00:04 933500 -- (-1153.692) (-1153.356) (-1157.449) [-1156.006] * (-1152.671) [-1155.816] (-1153.033) (-1153.622) -- 0:00:04 934000 -- (-1154.529) (-1156.056) (-1153.508) [-1155.721] * (-1159.627) (-1153.693) [-1154.286] (-1156.529) -- 0:00:04 934500 -- (-1153.714) (-1154.633) (-1153.144) [-1155.185] * (-1159.106) (-1154.571) [-1153.747] (-1155.243) -- 0:00:04 935000 -- (-1153.185) (-1153.939) [-1156.653] (-1155.825) * (-1155.573) [-1156.027] (-1155.911) (-1154.583) -- 0:00:04 Average standard deviation of split frequencies: 0.011741 935500 -- (-1156.865) (-1156.738) (-1156.526) [-1152.960] * (-1153.435) [-1152.926] (-1153.459) (-1159.215) -- 0:00:03 936000 -- (-1155.275) [-1156.089] (-1158.092) (-1155.051) * (-1154.314) (-1156.691) (-1153.338) [-1157.826] -- 0:00:03 936500 -- [-1156.948] (-1152.749) (-1156.145) (-1153.168) * (-1154.776) (-1154.570) [-1154.801] (-1153.274) -- 0:00:03 937000 -- [-1152.327] (-1152.817) (-1154.898) (-1152.202) * (-1162.103) (-1152.149) (-1155.637) [-1152.502] -- 0:00:03 937500 -- (-1153.697) [-1157.209] (-1154.311) (-1155.850) * (-1153.962) (-1154.247) [-1153.546] (-1153.434) -- 0:00:03 938000 -- (-1153.879) (-1153.644) [-1152.833] (-1153.233) * (-1169.070) [-1157.080] (-1153.720) (-1153.380) -- 0:00:03 938500 -- (-1153.207) (-1156.950) (-1154.379) [-1153.325] * (-1163.030) (-1159.026) (-1155.356) [-1157.414] -- 0:00:03 939000 -- (-1155.281) (-1154.090) [-1154.129] (-1154.942) * [-1152.783] (-1157.981) (-1157.836) (-1156.526) -- 0:00:03 939500 -- (-1155.732) (-1154.636) [-1154.904] (-1154.394) * (-1158.133) [-1156.158] (-1158.083) (-1153.592) -- 0:00:03 940000 -- [-1155.184] (-1159.738) (-1153.237) (-1152.548) * (-1162.455) (-1156.581) (-1152.524) [-1152.143] -- 0:00:03 Average standard deviation of split frequencies: 0.011808 940500 -- (-1154.433) (-1153.911) (-1152.780) [-1153.325] * (-1158.466) [-1154.033] (-1153.192) (-1152.180) -- 0:00:03 941000 -- [-1153.539] (-1152.269) (-1154.210) (-1152.267) * (-1152.930) (-1155.629) (-1155.075) [-1152.594] -- 0:00:03 941500 -- (-1153.533) [-1152.373] (-1155.988) (-1152.249) * (-1154.674) [-1153.901] (-1153.781) (-1155.485) -- 0:00:03 942000 -- (-1153.153) (-1153.366) [-1154.909] (-1152.298) * (-1155.068) (-1154.676) [-1157.511] (-1153.465) -- 0:00:03 942500 -- (-1157.451) (-1153.147) [-1153.889] (-1155.566) * (-1154.875) (-1154.827) (-1155.203) [-1152.899] -- 0:00:03 943000 -- (-1155.200) [-1153.000] (-1152.380) (-1155.092) * [-1153.356] (-1154.544) (-1152.163) (-1155.107) -- 0:00:03 943500 -- [-1154.432] (-1153.576) (-1152.950) (-1154.131) * (-1152.902) (-1155.159) [-1152.154] (-1154.304) -- 0:00:03 944000 -- (-1154.072) (-1153.787) (-1152.644) [-1155.141] * (-1154.343) [-1161.492] (-1152.817) (-1153.147) -- 0:00:03 944500 -- (-1153.693) [-1152.832] (-1152.983) (-1155.504) * [-1153.725] (-1159.751) (-1152.705) (-1154.137) -- 0:00:03 945000 -- (-1158.267) (-1151.895) (-1153.445) [-1155.471] * (-1156.772) (-1154.834) (-1152.819) [-1155.537] -- 0:00:03 Average standard deviation of split frequencies: 0.011804 945500 -- (-1153.742) [-1152.686] (-1155.020) (-1156.556) * (-1155.885) [-1153.285] (-1153.696) (-1155.446) -- 0:00:03 946000 -- [-1152.819] (-1153.665) (-1153.569) (-1154.512) * (-1154.445) (-1152.856) [-1154.315] (-1154.976) -- 0:00:03 946500 -- [-1152.944] (-1157.288) (-1152.958) (-1154.508) * (-1158.160) (-1157.089) (-1158.612) [-1154.839] -- 0:00:03 947000 -- (-1153.771) (-1154.311) [-1153.696] (-1153.840) * (-1153.683) (-1157.107) [-1153.633] (-1153.032) -- 0:00:03 947500 -- [-1156.359] (-1153.372) (-1154.625) (-1154.770) * (-1153.192) (-1155.821) (-1156.369) [-1153.725] -- 0:00:03 948000 -- (-1156.869) (-1155.170) (-1153.338) [-1152.123] * (-1158.851) [-1156.670] (-1152.919) (-1153.422) -- 0:00:03 948500 -- (-1155.260) (-1155.244) [-1153.741] (-1153.140) * (-1157.501) [-1155.245] (-1154.485) (-1153.045) -- 0:00:03 949000 -- (-1155.256) [-1157.179] (-1151.930) (-1156.494) * (-1153.993) (-1156.567) [-1155.277] (-1155.678) -- 0:00:03 949500 -- (-1154.035) (-1153.706) (-1152.101) [-1158.293] * (-1156.275) [-1154.602] (-1157.914) (-1157.914) -- 0:00:03 950000 -- (-1154.804) (-1153.484) (-1151.808) [-1158.912] * (-1153.188) (-1155.360) (-1154.901) [-1154.552] -- 0:00:03 Average standard deviation of split frequencies: 0.012163 950500 -- (-1160.255) (-1156.748) [-1154.241] (-1155.564) * (-1152.643) [-1153.953] (-1155.690) (-1154.283) -- 0:00:03 951000 -- (-1153.083) (-1154.452) [-1155.683] (-1154.990) * (-1155.895) [-1153.559] (-1154.343) (-1155.371) -- 0:00:03 951500 -- (-1157.036) (-1153.920) (-1153.219) [-1157.315] * (-1154.214) [-1154.670] (-1153.878) (-1157.488) -- 0:00:03 952000 -- (-1154.657) (-1152.260) (-1155.248) [-1161.744] * [-1153.546] (-1153.448) (-1154.755) (-1156.216) -- 0:00:02 952500 -- (-1154.230) (-1152.999) [-1154.381] (-1154.198) * (-1153.822) (-1153.303) (-1154.551) [-1155.375] -- 0:00:02 953000 -- (-1156.276) (-1152.707) (-1157.007) [-1156.887] * (-1152.297) [-1157.427] (-1153.563) (-1155.814) -- 0:00:02 953500 -- (-1153.921) (-1153.140) (-1156.652) [-1156.289] * (-1152.558) [-1154.348] (-1152.816) (-1153.757) -- 0:00:02 954000 -- (-1153.492) [-1154.007] (-1153.468) (-1153.908) * (-1152.565) (-1153.840) [-1152.615] (-1152.631) -- 0:00:02 954500 -- [-1153.200] (-1153.221) (-1152.246) (-1154.522) * [-1154.347] (-1155.824) (-1152.424) (-1154.273) -- 0:00:02 955000 -- (-1152.238) [-1154.916] (-1152.263) (-1155.793) * [-1157.975] (-1155.465) (-1153.725) (-1155.080) -- 0:00:02 Average standard deviation of split frequencies: 0.012328 955500 -- (-1152.299) [-1156.588] (-1153.555) (-1152.483) * (-1152.292) [-1154.286] (-1156.237) (-1154.383) -- 0:00:02 956000 -- [-1154.237] (-1156.702) (-1152.818) (-1153.399) * (-1158.099) [-1155.633] (-1160.950) (-1157.699) -- 0:00:02 956500 -- [-1153.488] (-1153.264) (-1153.024) (-1154.070) * (-1157.337) (-1157.048) (-1157.986) [-1156.867] -- 0:00:02 957000 -- [-1153.553] (-1156.328) (-1154.110) (-1154.262) * (-1153.856) [-1153.017] (-1156.922) (-1153.718) -- 0:00:02 957500 -- (-1153.473) (-1157.424) [-1154.316] (-1153.835) * [-1153.298] (-1152.842) (-1155.256) (-1153.872) -- 0:00:02 958000 -- (-1153.924) (-1155.599) [-1154.854] (-1154.958) * (-1157.197) (-1155.361) (-1153.704) [-1155.420] -- 0:00:02 958500 -- (-1153.349) (-1157.111) [-1152.542] (-1155.747) * (-1156.367) (-1156.968) (-1153.738) [-1154.381] -- 0:00:02 959000 -- [-1153.788] (-1156.581) (-1152.577) (-1155.033) * (-1155.992) (-1153.110) (-1153.281) [-1155.762] -- 0:00:02 959500 -- [-1152.415] (-1155.460) (-1154.744) (-1155.577) * (-1152.652) (-1152.956) (-1152.159) [-1157.012] -- 0:00:02 960000 -- (-1152.259) (-1153.214) [-1153.695] (-1153.184) * [-1154.526] (-1152.533) (-1154.816) (-1158.493) -- 0:00:02 Average standard deviation of split frequencies: 0.011838 960500 -- (-1160.577) (-1153.408) (-1154.471) [-1152.692] * (-1154.181) (-1154.161) (-1154.460) [-1153.656] -- 0:00:02 961000 -- (-1157.071) (-1155.151) (-1155.632) [-1156.713] * [-1156.793] (-1153.938) (-1158.602) (-1153.908) -- 0:00:02 961500 -- (-1154.811) (-1152.074) [-1153.381] (-1153.619) * (-1155.198) (-1156.358) [-1154.520] (-1153.091) -- 0:00:02 962000 -- (-1156.388) [-1152.311] (-1152.012) (-1153.051) * (-1152.695) (-1153.641) (-1156.479) [-1155.177] -- 0:00:02 962500 -- (-1155.719) [-1154.112] (-1151.837) (-1155.765) * [-1156.915] (-1153.643) (-1155.139) (-1153.729) -- 0:00:02 963000 -- (-1153.986) (-1153.863) (-1153.947) [-1153.358] * (-1156.218) (-1153.314) [-1152.942] (-1152.541) -- 0:00:02 963500 -- (-1153.417) (-1156.424) [-1152.708] (-1154.922) * (-1152.874) (-1155.989) (-1153.468) [-1153.178] -- 0:00:02 964000 -- (-1158.724) (-1155.120) [-1153.524] (-1152.463) * (-1153.812) [-1155.139] (-1154.039) (-1153.715) -- 0:00:02 964500 -- (-1154.701) [-1155.260] (-1153.092) (-1152.544) * (-1155.749) [-1155.351] (-1154.931) (-1157.675) -- 0:00:02 965000 -- (-1156.419) (-1156.088) [-1154.773] (-1153.234) * (-1153.633) [-1156.943] (-1158.267) (-1154.462) -- 0:00:02 Average standard deviation of split frequencies: 0.011798 965500 -- (-1159.369) (-1157.114) [-1152.280] (-1153.719) * (-1154.953) (-1155.221) [-1155.180] (-1153.063) -- 0:00:02 966000 -- (-1155.686) (-1156.082) [-1152.151] (-1153.834) * (-1155.079) (-1155.415) (-1153.474) [-1152.492] -- 0:00:02 966500 -- (-1157.661) (-1154.283) (-1154.417) [-1154.236] * (-1152.274) (-1155.974) [-1153.608] (-1155.826) -- 0:00:02 967000 -- (-1152.990) (-1156.059) [-1153.505] (-1157.429) * (-1151.791) (-1156.282) [-1153.473] (-1154.350) -- 0:00:02 967500 -- [-1155.759] (-1154.659) (-1153.188) (-1152.169) * [-1152.688] (-1154.939) (-1155.160) (-1155.310) -- 0:00:02 968000 -- (-1153.722) (-1153.393) [-1156.102] (-1151.830) * [-1155.650] (-1153.841) (-1153.341) (-1154.457) -- 0:00:01 968500 -- (-1153.764) (-1154.253) (-1154.334) [-1152.152] * (-1157.555) (-1155.344) (-1153.984) [-1152.854] -- 0:00:01 969000 -- [-1156.541] (-1155.670) (-1152.879) (-1152.640) * (-1155.714) [-1153.889] (-1154.636) (-1154.860) -- 0:00:01 969500 -- (-1153.293) [-1154.818] (-1152.758) (-1154.321) * (-1152.869) (-1152.107) (-1156.644) [-1154.407] -- 0:00:01 970000 -- (-1153.006) (-1152.748) (-1154.412) [-1154.904] * [-1154.066] (-1152.694) (-1155.614) (-1153.060) -- 0:00:01 Average standard deviation of split frequencies: 0.011686 970500 -- [-1153.953] (-1151.967) (-1155.180) (-1162.106) * [-1159.830] (-1154.018) (-1155.105) (-1153.310) -- 0:00:01 971000 -- (-1153.502) (-1153.504) (-1154.117) [-1154.377] * (-1156.002) (-1163.816) (-1155.240) [-1153.997] -- 0:00:01 971500 -- [-1154.049] (-1152.454) (-1156.555) (-1154.454) * (-1156.641) (-1152.716) [-1153.270] (-1153.270) -- 0:00:01 972000 -- [-1153.211] (-1154.039) (-1151.915) (-1153.132) * (-1152.719) [-1157.347] (-1154.756) (-1153.205) -- 0:00:01 972500 -- [-1152.660] (-1155.323) (-1154.585) (-1155.793) * [-1153.372] (-1156.527) (-1156.772) (-1152.559) -- 0:00:01 973000 -- (-1154.387) (-1156.369) [-1153.652] (-1153.095) * [-1155.935] (-1156.333) (-1154.438) (-1155.826) -- 0:00:01 973500 -- (-1155.346) (-1154.613) (-1153.526) [-1155.263] * [-1153.257] (-1154.396) (-1153.016) (-1161.399) -- 0:00:01 974000 -- (-1152.553) (-1152.698) (-1158.873) [-1152.876] * [-1152.893] (-1154.544) (-1156.836) (-1158.885) -- 0:00:01 974500 -- (-1155.809) (-1156.953) [-1157.728] (-1154.216) * [-1152.241] (-1155.803) (-1157.743) (-1153.836) -- 0:00:01 975000 -- (-1152.992) (-1156.480) [-1153.826] (-1152.295) * (-1157.571) (-1154.169) [-1154.062] (-1161.358) -- 0:00:01 Average standard deviation of split frequencies: 0.011713 975500 -- [-1155.399] (-1156.223) (-1152.504) (-1155.735) * (-1156.467) [-1154.503] (-1154.043) (-1157.628) -- 0:00:01 976000 -- (-1153.956) [-1153.030] (-1153.048) (-1152.384) * (-1154.602) [-1155.018] (-1152.366) (-1158.238) -- 0:00:01 976500 -- (-1153.869) (-1157.240) [-1152.889] (-1154.901) * (-1156.072) (-1153.847) (-1153.741) [-1153.288] -- 0:00:01 977000 -- [-1152.256] (-1159.239) (-1154.555) (-1159.775) * (-1155.881) (-1154.427) [-1153.801] (-1156.356) -- 0:00:01 977500 -- (-1153.979) (-1154.432) (-1153.458) [-1153.509] * (-1158.465) (-1153.435) (-1152.465) [-1152.787] -- 0:00:01 978000 -- (-1153.861) (-1155.340) (-1152.343) [-1156.618] * (-1152.961) (-1158.079) (-1155.736) [-1154.102] -- 0:00:01 978500 -- (-1153.501) (-1158.832) (-1155.195) [-1154.778] * (-1152.983) [-1156.986] (-1155.518) (-1155.463) -- 0:00:01 979000 -- [-1152.432] (-1157.853) (-1153.930) (-1152.308) * (-1156.571) [-1154.594] (-1154.397) (-1154.812) -- 0:00:01 979500 -- (-1153.260) (-1154.095) [-1156.145] (-1153.027) * (-1155.625) (-1155.753) (-1160.672) [-1153.899] -- 0:00:01 980000 -- (-1153.353) [-1157.363] (-1160.485) (-1154.776) * (-1155.590) (-1152.081) [-1155.133] (-1152.422) -- 0:00:01 Average standard deviation of split frequencies: 0.011447 980500 -- [-1154.317] (-1154.505) (-1155.286) (-1157.064) * (-1154.604) [-1152.478] (-1152.330) (-1159.055) -- 0:00:01 981000 -- [-1152.966] (-1154.478) (-1155.755) (-1164.189) * (-1154.863) (-1153.267) [-1155.424] (-1155.090) -- 0:00:01 981500 -- (-1154.433) (-1156.122) (-1154.548) [-1160.750] * [-1153.834] (-1155.161) (-1155.117) (-1155.003) -- 0:00:01 982000 -- [-1153.896] (-1158.650) (-1153.279) (-1152.994) * (-1152.179) [-1153.620] (-1153.746) (-1156.161) -- 0:00:01 982500 -- (-1153.786) (-1156.136) (-1157.132) [-1152.496] * [-1152.158] (-1154.546) (-1154.694) (-1156.216) -- 0:00:01 983000 -- [-1155.562] (-1154.401) (-1156.915) (-1152.908) * (-1154.737) (-1158.653) (-1155.334) [-1154.264] -- 0:00:01 983500 -- (-1154.445) (-1153.372) (-1152.725) [-1152.619] * [-1155.077] (-1158.883) (-1157.473) (-1153.401) -- 0:00:01 984000 -- [-1155.785] (-1152.747) (-1154.355) (-1155.726) * (-1152.439) [-1158.834] (-1158.383) (-1152.960) -- 0:00:00 984500 -- (-1154.639) (-1153.465) (-1152.717) [-1153.814] * [-1153.097] (-1153.702) (-1157.137) (-1155.491) -- 0:00:00 985000 -- (-1153.958) (-1157.118) (-1155.971) [-1152.125] * (-1152.841) (-1158.523) (-1154.766) [-1153.301] -- 0:00:00 Average standard deviation of split frequencies: 0.011474 985500 -- [-1153.123] (-1152.807) (-1158.857) (-1154.608) * [-1154.040] (-1154.327) (-1155.054) (-1152.445) -- 0:00:00 986000 -- (-1155.789) [-1152.929] (-1152.844) (-1160.607) * [-1155.422] (-1155.228) (-1155.186) (-1154.463) -- 0:00:00 986500 -- (-1156.154) [-1154.650] (-1156.679) (-1154.152) * [-1154.466] (-1155.612) (-1156.408) (-1153.834) -- 0:00:00 987000 -- [-1156.023] (-1154.592) (-1155.054) (-1153.735) * (-1153.057) (-1156.798) (-1153.133) [-1152.747] -- 0:00:00 987500 -- (-1154.647) (-1153.826) [-1154.574] (-1154.447) * [-1152.286] (-1156.202) (-1156.012) (-1154.631) -- 0:00:00 988000 -- [-1155.427] (-1155.973) (-1154.574) (-1154.161) * [-1153.265] (-1153.382) (-1153.481) (-1153.708) -- 0:00:00 988500 -- [-1152.517] (-1153.603) (-1155.516) (-1153.159) * (-1157.424) (-1152.343) (-1154.932) [-1152.528] -- 0:00:00 989000 -- (-1155.908) [-1152.958] (-1152.479) (-1155.892) * (-1153.240) (-1152.598) (-1153.776) [-1152.016] -- 0:00:00 989500 -- (-1154.962) [-1153.534] (-1162.574) (-1159.148) * (-1153.544) (-1153.085) [-1155.486] (-1153.465) -- 0:00:00 990000 -- (-1152.966) (-1153.603) (-1157.233) [-1155.242] * (-1152.567) (-1153.400) (-1156.485) [-1153.267] -- 0:00:00 Average standard deviation of split frequencies: 0.011510 990500 -- (-1154.195) (-1156.100) [-1153.172] (-1153.300) * (-1155.947) (-1153.589) (-1155.618) [-1152.414] -- 0:00:00 991000 -- [-1154.616] (-1153.117) (-1153.409) (-1153.988) * (-1152.426) (-1152.632) [-1152.563] (-1156.222) -- 0:00:00 991500 -- (-1158.190) (-1153.420) (-1154.457) [-1155.437] * [-1154.281] (-1154.463) (-1153.593) (-1152.079) -- 0:00:00 992000 -- [-1156.389] (-1155.398) (-1154.849) (-1154.227) * (-1153.948) (-1153.941) [-1153.079] (-1154.930) -- 0:00:00 992500 -- (-1156.353) (-1155.833) [-1155.444] (-1154.722) * (-1154.245) [-1154.335] (-1153.173) (-1153.262) -- 0:00:00 993000 -- (-1157.034) [-1154.352] (-1152.852) (-1152.729) * (-1153.338) [-1151.984] (-1154.372) (-1153.765) -- 0:00:00 993500 -- (-1153.421) [-1155.181] (-1154.368) (-1152.963) * [-1153.687] (-1154.402) (-1156.337) (-1157.204) -- 0:00:00 994000 -- [-1157.262] (-1156.338) (-1152.864) (-1153.507) * (-1152.764) (-1154.958) (-1154.113) [-1154.627] -- 0:00:00 994500 -- (-1153.379) (-1153.696) (-1154.180) [-1154.456] * (-1153.021) (-1156.061) [-1156.550] (-1154.805) -- 0:00:00 995000 -- (-1156.153) [-1152.946] (-1152.852) (-1155.564) * (-1153.938) [-1155.611] (-1153.273) (-1155.062) -- 0:00:00 Average standard deviation of split frequencies: 0.011359 995500 -- (-1156.468) [-1155.778] (-1154.370) (-1156.366) * (-1161.056) [-1158.926] (-1153.037) (-1154.621) -- 0:00:00 996000 -- (-1155.278) (-1154.334) (-1156.567) [-1154.010] * (-1161.996) (-1155.586) (-1153.182) [-1155.540] -- 0:00:00 996500 -- (-1153.707) (-1155.208) (-1153.232) [-1156.795] * (-1156.071) (-1153.768) [-1154.799] (-1154.982) -- 0:00:00 997000 -- (-1156.797) (-1153.541) [-1153.091] (-1155.217) * [-1152.642] (-1155.256) (-1153.625) (-1154.453) -- 0:00:00 997500 -- (-1155.524) (-1157.423) [-1152.440] (-1154.304) * (-1156.737) [-1153.608] (-1156.482) (-1158.708) -- 0:00:00 998000 -- [-1155.018] (-1152.705) (-1153.565) (-1153.912) * (-1154.142) [-1160.730] (-1154.894) (-1152.702) -- 0:00:00 998500 -- [-1155.315] (-1157.341) (-1161.668) (-1152.624) * (-1160.172) (-1157.665) (-1156.849) [-1155.181] -- 0:00:00 999000 -- (-1153.750) (-1158.747) [-1153.694] (-1153.315) * (-1158.797) (-1158.459) [-1159.747] (-1158.379) -- 0:00:00 999500 -- (-1153.438) (-1153.084) [-1154.756] (-1154.480) * (-1153.287) (-1158.012) [-1157.110] (-1152.637) -- 0:00:00 1000000 -- (-1152.223) (-1153.327) (-1154.551) [-1157.738] * (-1156.854) (-1152.832) (-1153.133) [-1154.653] -- 0:00:00 Average standard deviation of split frequencies: 0.011424 Analysis completed in 1 mins 2 seconds Analysis used 60.95 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1151.74 Likelihood of best state for "cold" chain of run 2 was -1151.74 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 76.5 % ( 68 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.7 % ( 24 %) Dirichlet(Pi{all}) 28.1 % ( 21 %) Slider(Pi{all}) 78.8 % ( 56 %) Multiplier(Alpha{1,2}) 77.9 % ( 51 %) Multiplier(Alpha{3}) 20.6 % ( 21 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 71 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 98 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 26 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.5 % ( 24 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.0 % ( 69 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.4 % ( 29 %) Dirichlet(Pi{all}) 28.7 % ( 27 %) Slider(Pi{all}) 78.9 % ( 58 %) Multiplier(Alpha{1,2}) 78.1 % ( 50 %) Multiplier(Alpha{3}) 19.0 % ( 30 %) Slider(Pinvar{all}) 98.7 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 73 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 22 %) Multiplier(V{all}) 97.4 % (100 %) Nodeslider(V{all}) 30.5 % ( 26 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166327 0.82 0.67 3 | 166944 166678 0.84 4 | 166745 167016 166290 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166806 0.83 0.67 3 | 166097 166553 0.84 4 | 166940 166900 166704 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1153.23 | 1 | | 2 | | 2 1 1 | | 2 2 | | 2 2 2 2 21 1 2 | | 1 2 *1 1 1 2 | | 11 2 11 21 * 2 2 2 | | 2 1 2 1 2 1 * 1 2 1 1 1 *2 | | 2 12 2 22 *1 2 1 1 1 | |2* 22 1 1 1 1 2 2 1 * | | 1* 1 11 2212 1 * * 2 | |1 2 1 2 1 1 2 2 1 1 | | 2 1 2 1 1 1 2 2 *| | 1 2 | | 2 2 * | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1154.97 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1153.42 -1157.69 2 -1153.40 -1156.71 -------------------------------------- TOTAL -1153.41 -1157.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896026 0.094207 0.338453 1.478087 0.859785 1303.77 1387.33 1.000 r(A<->C){all} 0.161656 0.017686 0.000049 0.422531 0.130231 176.34 214.88 1.002 r(A<->G){all} 0.160169 0.019602 0.000085 0.451797 0.122339 192.11 247.83 1.001 r(A<->T){all} 0.182843 0.022294 0.000138 0.484219 0.149126 216.92 235.54 1.004 r(C<->G){all} 0.166066 0.019052 0.000084 0.443760 0.128517 235.06 264.17 1.000 r(C<->T){all} 0.167495 0.018780 0.000012 0.447214 0.133750 246.50 281.39 1.001 r(G<->T){all} 0.161772 0.019263 0.000028 0.440192 0.123410 86.29 142.48 1.001 pi(A){all} 0.169461 0.000171 0.144092 0.195315 0.169428 1289.05 1348.36 1.000 pi(C){all} 0.247407 0.000216 0.218621 0.275997 0.247302 1237.07 1251.88 1.000 pi(G){all} 0.352822 0.000270 0.319259 0.383655 0.352768 1196.58 1225.65 1.001 pi(T){all} 0.230310 0.000201 0.202588 0.257286 0.230074 1249.71 1375.36 1.000 alpha{1,2} 0.423408 0.237398 0.000213 1.373515 0.248138 1102.48 1265.27 1.000 alpha{3} 0.473635 0.270507 0.000288 1.501013 0.299038 1257.08 1277.42 1.001 pinvar{all} 0.998239 0.000005 0.994316 0.999999 0.998906 1186.96 1272.74 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*.*** 8 -- ....** 9 -- ...*.* 10 -- .**... 11 -- ..**.. 12 -- .***.* 13 -- ..**** 14 -- .*...* 15 -- ..*.*. 16 -- ..*..* 17 -- .*..*. 18 -- .*.*.. 19 -- ...**. 20 -- .****. 21 -- .**.** 22 -- ...*** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 474 0.157895 0.012248 0.149234 0.166556 2 8 450 0.149900 0.008480 0.143904 0.155896 2 9 447 0.148901 0.011777 0.140573 0.157229 2 10 441 0.146902 0.011777 0.138574 0.155230 2 11 438 0.145903 0.010364 0.138574 0.153231 2 12 433 0.144237 0.008009 0.138574 0.149900 2 13 432 0.143904 0.006595 0.139241 0.148568 2 14 424 0.141239 0.015075 0.130580 0.151899 2 15 424 0.141239 0.016959 0.129247 0.153231 2 16 423 0.140906 0.014604 0.130580 0.151233 2 17 421 0.140240 0.004240 0.137242 0.143238 2 18 420 0.139907 0.014133 0.129913 0.149900 2 19 410 0.136576 0.010364 0.129247 0.143904 2 20 409 0.136243 0.016488 0.124584 0.147901 2 21 395 0.131579 0.009893 0.124584 0.138574 2 22 279 0.092938 0.011777 0.084610 0.101266 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.100158 0.009501 0.000004 0.305035 0.069065 1.000 2 length{all}[2] 0.098999 0.009925 0.000055 0.301487 0.066737 1.000 2 length{all}[3] 0.099684 0.010084 0.000005 0.306867 0.069799 1.000 2 length{all}[4] 0.096660 0.008967 0.000001 0.278438 0.068849 1.000 2 length{all}[5] 0.100353 0.010410 0.000004 0.296059 0.068814 1.000 2 length{all}[6] 0.099100 0.010024 0.000006 0.296331 0.067285 1.000 2 length{all}[7] 0.091382 0.008742 0.000207 0.274215 0.062657 1.000 2 length{all}[8] 0.095943 0.007880 0.000273 0.266090 0.068291 0.999 2 length{all}[9] 0.103583 0.011067 0.000019 0.322655 0.072855 0.998 2 length{all}[10] 0.110190 0.012529 0.000498 0.332441 0.075464 0.998 2 length{all}[11] 0.095791 0.008199 0.000582 0.264732 0.071776 1.001 2 length{all}[12] 0.097353 0.009289 0.000181 0.267257 0.064500 0.998 2 length{all}[13] 0.102390 0.012668 0.000062 0.302319 0.070664 0.998 2 length{all}[14] 0.097180 0.008876 0.000329 0.301957 0.063519 0.999 2 length{all}[15] 0.092267 0.009001 0.000048 0.274024 0.067489 0.998 2 length{all}[16] 0.098250 0.009487 0.000352 0.308364 0.068538 1.003 2 length{all}[17] 0.107914 0.010573 0.000026 0.324381 0.076991 1.003 2 length{all}[18] 0.103084 0.011460 0.000058 0.332462 0.074203 1.000 2 length{all}[19] 0.101027 0.010200 0.000002 0.292548 0.069246 1.001 2 length{all}[20] 0.100209 0.010990 0.000115 0.313667 0.060817 0.999 2 length{all}[21] 0.101476 0.011485 0.000531 0.298233 0.063995 0.998 2 length{all}[22] 0.096074 0.007778 0.000613 0.254292 0.070466 0.997 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.011424 Maximum standard deviation of split frequencies = 0.016959 Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999 Maximum PSRF for parameter values = 1.003 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |--------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |----------------------------------------------------------------------- C4 (4) | |----------------------------------------------------------------------- C5 (5) | \--------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 47 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 852 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 58 patterns at 284 / 284 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 58 patterns at 284 / 284 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 56608 bytes for conP 5104 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.051990 0.089808 0.088306 0.027547 0.056940 0.101008 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1224.214950 Iterating by ming2 Initial: fx= 1224.214950 x= 0.05199 0.08981 0.08831 0.02755 0.05694 0.10101 0.30000 1.30000 1 h-m-p 0.0000 0.0001 680.3548 ++ 1178.557039 m 0.0001 13 | 1/8 2 h-m-p 0.0013 0.0067 48.6911 -----------.. | 1/8 3 h-m-p 0.0000 0.0001 623.3203 ++ 1144.399471 m 0.0001 44 | 2/8 4 h-m-p 0.0016 0.0124 30.2404 -----------.. | 2/8 5 h-m-p 0.0000 0.0000 559.4129 ++ 1138.832397 m 0.0000 75 | 3/8 6 h-m-p 0.0004 0.0208 20.9836 ----------.. | 3/8 7 h-m-p 0.0000 0.0001 484.0874 ++ 1112.193026 m 0.0001 105 | 4/8 8 h-m-p 0.0032 0.0453 13.8739 ------------.. | 4/8 9 h-m-p 0.0000 0.0000 397.4311 ++ 1111.335183 m 0.0000 137 | 5/8 10 h-m-p 0.0004 0.1903 8.5767 ----------.. | 5/8 11 h-m-p 0.0000 0.0000 280.8077 ++ 1108.132707 m 0.0000 167 | 6/8 12 h-m-p 0.0880 8.0000 0.0000 ++++ 1108.132707 m 8.0000 180 | 6/8 13 h-m-p 0.1608 8.0000 0.0002 ---Y 1108.132707 0 0.0006 196 | 6/8 14 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132707 m 8.0000 212 | 6/8 15 h-m-p 0.0031 1.5271 0.1967 -------Y 1108.132707 0 0.0000 232 | 6/8 16 h-m-p 0.0160 8.0000 0.0000 -C 1108.132707 0 0.0010 246 | 6/8 17 h-m-p 0.0160 8.0000 0.0000 C 1108.132707 0 0.0040 259 Out.. lnL = -1108.132707 260 lfun, 260 eigenQcodon, 1560 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.033026 0.097262 0.015130 0.012401 0.058175 0.074637 0.300302 0.543462 0.429232 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 8.966244 np = 9 lnL0 = -1188.321722 Iterating by ming2 Initial: fx= 1188.321722 x= 0.03303 0.09726 0.01513 0.01240 0.05817 0.07464 0.30030 0.54346 0.42923 1 h-m-p 0.0000 0.0000 667.1029 ++ 1168.142001 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0001 250.6269 ++ 1164.376371 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0001 328.3293 ++ 1148.976119 m 0.0001 38 | 3/9 4 h-m-p 0.0001 0.0003 458.2749 ++ 1123.670930 m 0.0003 50 | 4/9 5 h-m-p 0.0000 0.0000 91201.0799 ++ 1114.043789 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 6417.9338 ++ 1108.132672 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 1108.132672 m 8.0000 86 | 6/9 8 h-m-p 0.0160 8.0000 0.0808 ----------N 1108.132672 0 0.0000 111 | 6/9 9 h-m-p 0.0160 8.0000 0.0003 +++++ 1108.132672 m 8.0000 129 | 6/9 10 h-m-p 0.0069 3.0237 0.2917 ---------Y 1108.132672 0 0.0000 153 | 6/9 11 h-m-p 0.0160 8.0000 0.0003 +++++ 1108.132671 m 8.0000 171 | 6/9 12 h-m-p 0.0060 1.8576 0.3736 --------Y 1108.132671 0 0.0000 194 | 6/9 13 h-m-p 0.0160 8.0000 0.0003 +++++ 1108.132671 m 8.0000 212 | 6/9 14 h-m-p 0.0051 1.6033 0.4308 ---------C 1108.132671 0 0.0000 236 | 6/9 15 h-m-p 0.0160 8.0000 0.0057 +++++ 1108.132668 m 8.0000 254 | 6/9 16 h-m-p 0.0988 1.1141 0.4654 ----------Y 1108.132668 0 0.0000 279 | 6/9 17 h-m-p 0.0160 8.0000 0.0002 +++++ 1108.132667 m 8.0000 297 | 6/9 18 h-m-p 0.0042 1.0630 0.4381 ----------Y 1108.132667 0 0.0000 322 | 6/9 19 h-m-p 0.0160 8.0000 0.0023 -------------.. | 6/9 20 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132667 m 8.0000 366 | 6/9 21 h-m-p 0.0086 4.2806 0.2407 -----------Y 1108.132667 0 0.0000 392 | 6/9 22 h-m-p 0.0160 8.0000 0.0002 +++++ 1108.132667 m 8.0000 410 | 6/9 23 h-m-p 0.0063 3.1580 0.2787 -----------C 1108.132667 0 0.0000 436 | 6/9 24 h-m-p 0.0160 8.0000 0.0006 +++++ 1108.132667 m 8.0000 454 | 6/9 25 h-m-p 0.0132 2.1379 0.3560 ---------C 1108.132667 0 0.0000 478 | 6/9 26 h-m-p 0.0160 8.0000 0.0001 -----C 1108.132667 0 0.0000 498 | 6/9 27 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132667 m 8.0000 516 | 6/9 28 h-m-p 0.0045 2.2257 0.3396 --------C 1108.132667 0 0.0000 539 | 6/9 29 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132667 m 8.0000 557 | 6/9 30 h-m-p 0.0050 2.5185 0.3006 ---------C 1108.132667 0 0.0000 581 | 6/9 31 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132667 m 8.0000 599 | 6/9 32 h-m-p 0.0052 2.6214 0.2924 ----------N 1108.132667 0 0.0000 624 | 6/9 33 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132667 m 8.0000 642 | 6/9 34 h-m-p 0.0054 2.6770 0.2880 ---------Y 1108.132667 0 0.0000 666 | 6/9 35 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9 36 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132666 m 8.0000 710 | 6/9 37 h-m-p 0.0089 4.4391 0.2351 ---------C 1108.132666 0 0.0000 734 | 6/9 38 h-m-p 0.0160 8.0000 0.0007 +++++ 1108.132666 m 8.0000 752 | 6/9 39 h-m-p 0.0235 4.0020 0.2370 -------------.. | 6/9 40 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132666 m 8.0000 796 | 6/9 41 h-m-p 0.0091 4.5550 0.2306 -----------N 1108.132666 0 0.0000 822 | 6/9 42 h-m-p 0.0160 8.0000 0.0007 +++++ 1108.132665 m 8.0000 840 | 6/9 43 h-m-p 0.0230 4.0434 0.2362 -----------Y 1108.132665 0 0.0000 866 | 6/9 44 h-m-p 0.0160 8.0000 0.0006 +++++ 1108.132664 m 8.0000 884 | 6/9 45 h-m-p 0.0169 2.8135 0.2774 -----------Y 1108.132664 0 0.0000 910 | 6/9 46 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132664 m 8.0000 928 | 6/9 47 h-m-p 0.0039 1.9526 0.3933 ---------C 1108.132664 0 0.0000 952 | 6/9 48 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132664 m 8.0000 970 | 6/9 49 h-m-p 0.0061 3.0644 0.2602 ----------Y 1108.132664 0 0.0000 995 | 6/9 50 h-m-p 0.0160 8.0000 0.0000 ------Y 1108.132664 0 0.0000 1016 | 6/9 51 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132664 m 8.0000 1034 | 6/9 52 h-m-p 0.0049 2.4524 0.2091 -------Y 1108.132664 0 0.0000 1056 | 6/9 53 h-m-p 0.0160 8.0000 0.0003 -------Y 1108.132664 0 0.0000 1078 | 6/9 54 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132664 m 8.0000 1096 | 6/9 55 h-m-p 0.0048 2.4191 0.4532 ----------Y 1108.132664 0 0.0000 1121 | 6/9 56 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132664 m 8.0000 1139 | 6/9 57 h-m-p 0.0000 0.0103 2.2549 +++++ 1108.132662 m 0.0103 1157 | 7/9 58 h-m-p 0.0836 8.0000 0.0911 --------------.. | 7/9 59 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132662 m 8.0000 1198 | 7/9 60 h-m-p 0.0056 2.8148 0.3144 ---------Y 1108.132662 0 0.0000 1221 | 7/9 61 h-m-p 0.0160 8.0000 0.0002 +++++ 1108.132661 m 8.0000 1238 | 7/9 62 h-m-p 0.0041 2.0468 0.3825 ------------.. | 7/9 63 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132661 m 8.0000 1279 | 7/9 64 h-m-p 0.0056 2.8020 0.3166 ---------Y 1108.132661 0 0.0000 1302 | 7/9 65 h-m-p 0.0160 8.0000 0.0006 +++++ 1108.132661 m 8.0000 1319 | 7/9 66 h-m-p 0.0150 2.4411 0.3204 -------------.. | 7/9 67 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132661 m 8.0000 1361 | 7/9 68 h-m-p 0.0058 2.9184 0.3060 ----------C 1108.132661 0 0.0000 1385 | 7/9 69 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132661 m 8.0000 1402 | 7/9 70 h-m-p 0.0020 1.0209 0.5396 -----------C 1108.132661 0 0.0000 1427 | 7/9 71 h-m-p 0.0160 8.0000 0.0002 +++++ 1108.132660 m 8.0000 1444 | 7/9 72 h-m-p 0.0049 2.1125 0.3747 -----------N 1108.132660 0 0.0000 1469 | 7/9 73 h-m-p 0.0160 8.0000 0.0000 --C 1108.132660 0 0.0003 1485 | 7/9 74 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132660 m 8.0000 1502 | 7/9 75 h-m-p 0.0046 2.2955 0.3389 -----------Y 1108.132660 0 0.0000 1527 | 7/9 76 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132660 m 8.0000 1544 | 7/9 77 h-m-p 0.0053 2.6654 0.2923 ------------.. | 7/9 78 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132660 m 8.0000 1585 | 7/9 79 h-m-p 0.0059 2.9264 0.3065 ----------Y 1108.132660 0 0.0000 1609 | 7/9 80 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132660 m 8.0000 1626 | 7/9 81 h-m-p 0.0003 0.1475 2.3978 ------C 1108.132660 0 0.0000 1646 | 7/9 82 h-m-p 0.0160 8.0000 0.0000 --------Y 1108.132660 0 0.0000 1666 | 7/9 83 h-m-p 0.0160 8.0000 0.0004 -------------.. | 7/9 84 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132660 m 8.0000 1708 | 7/9 85 h-m-p 0.0058 2.9139 0.3083 -----------N 1108.132660 0 0.0000 1733 | 7/9 86 h-m-p 0.0160 8.0000 0.0005 +++++ 1108.132660 m 8.0000 1750 | 7/9 87 h-m-p 0.0112 2.3632 0.3315 -----------N 1108.132660 0 0.0000 1775 | 7/9 88 h-m-p 0.0160 8.0000 0.0000 ----C 1108.132660 0 0.0000 1793 | 7/9 89 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132660 m 8.0000 1810 | 7/9 90 h-m-p 0.0043 2.1335 0.3673 ---------C 1108.132660 0 0.0000 1833 | 7/9 91 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132660 m 8.0000 1850 | 7/9 92 h-m-p 0.0047 2.3292 0.3368 ----------Y 1108.132660 0 0.0000 1874 | 7/9 93 h-m-p 0.0160 8.0000 0.0001 -----Y 1108.132660 0 0.0000 1893 | 7/9 94 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132659 m 8.0000 1910 | 7/9 95 h-m-p 0.0046 2.3185 0.3385 ------------.. | 7/9 96 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132659 m 8.0000 1951 | 7/9 97 h-m-p 0.0060 2.9847 0.3030 --------C 1108.132659 0 0.0000 1973 | 7/9 98 h-m-p 0.0160 8.0000 0.0001 ----C 1108.132659 0 0.0000 1991 | 7/9 99 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132659 m 8.0000 2008 | 7/9 100 h-m-p 0.0049 2.4724 0.3192 --------Y 1108.132659 0 0.0000 2030 | 7/9 101 h-m-p 0.0160 8.0000 0.0025 -------N 1108.132659 0 0.0000 2051 | 7/9 102 h-m-p 0.0160 8.0000 0.0009 +++++ 1108.132658 m 8.0000 2068 | 7/9 103 h-m-p 0.0217 2.3980 0.3308 ---------Y 1108.132658 0 0.0000 2091 | 7/9 104 h-m-p 0.0160 8.0000 0.0000 ----Y 1108.132658 0 0.0000 2109 | 7/9 105 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132658 m 8.0000 2126 | 7/9 106 h-m-p 0.0046 2.3003 0.3499 --------Y 1108.132658 0 0.0000 2148 | 7/9 107 h-m-p 0.0160 8.0000 0.0001 ----------C 1108.132658 0 0.0000 2172 | 7/9 108 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132658 m 8.0000 2189 | 7/9 109 h-m-p 0.0054 2.7157 0.2947 ----------Y 1108.132658 0 0.0000 2213 | 7/9 110 h-m-p 0.0160 8.0000 0.0000 ---C 1108.132658 0 0.0001 2230 | 7/9 111 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132658 m 8.0000 2247 | 7/9 112 h-m-p 0.0051 2.5511 0.3138 -----------C 1108.132658 0 0.0000 2272 | 7/9 113 h-m-p 0.0160 8.0000 0.0000 +++++ 1108.132658 m 8.0000 2289 | 7/9 114 h-m-p 0.0056 2.8214 0.2837 -----------N 1108.132658 0 0.0000 2314 | 7/9 115 h-m-p 0.0160 8.0000 0.0000 ------Y 1108.132658 0 0.0000 2334 | 7/9 116 h-m-p 0.0160 8.0000 0.0000 ------Y 1108.132658 0 0.0000 2354 Out.. lnL = -1108.132658 2355 lfun, 7065 eigenQcodon, 28260 P(t) Time used: 0:08 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.051910 0.078298 0.092759 0.088981 0.014730 0.096977 0.259699 1.739703 0.267280 0.370227 1.489275 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.793876 np = 11 lnL0 = -1222.138802 Iterating by ming2 Initial: fx= 1222.138802 x= 0.05191 0.07830 0.09276 0.08898 0.01473 0.09698 0.25970 1.73970 0.26728 0.37023 1.48928 1 h-m-p 0.0000 0.0001 635.5740 ++ 1199.348741 m 0.0001 16 | 1/11 2 h-m-p 0.0001 0.0004 410.3721 ++ 1148.893998 m 0.0004 30 | 2/11 3 h-m-p 0.0000 0.0000 3181.1934 ++ 1120.883517 m 0.0000 44 | 3/11 4 h-m-p 0.0001 0.0006 181.0264 ++ 1110.923177 m 0.0006 58 | 4/11 5 h-m-p 0.0000 0.0000 1441.2260 ++ 1109.372361 m 0.0000 72 | 5/11 6 h-m-p 0.0029 0.1121 3.9730 ------------.. | 5/11 7 h-m-p 0.0000 0.0000 394.4642 ++ 1109.055787 m 0.0000 110 | 6/11 8 h-m-p 0.0002 0.0813 3.1718 ----------.. | 6/11 9 h-m-p 0.0000 0.0000 278.9942 ++ 1108.132672 m 0.0000 146 | 7/11 10 h-m-p 0.0197 8.0000 0.0000 +++++ 1108.132672 m 8.0000 163 | 7/11 11 h-m-p 0.0160 8.0000 0.0230 +++++ 1108.132671 m 8.0000 184 | 7/11 12 h-m-p 0.0385 0.1926 2.1101 ++ 1108.132669 m 0.1926 202 | 8/11 13 h-m-p 0.1823 1.0104 0.5046 ++ 1108.132652 m 1.0104 216 | 9/11 14 h-m-p 0.6619 8.0000 0.6209 +C 1108.132649 0 2.2525 234 | 9/11 15 h-m-p 1.6000 8.0000 0.1530 Y 1108.132649 0 1.1362 250 | 9/11 16 h-m-p 1.6000 8.0000 0.0048 +Y 1108.132649 0 4.7948 267 | 9/11 17 h-m-p 1.6000 8.0000 0.0006 ++ 1108.132649 m 8.0000 283 | 9/11 18 h-m-p 0.0160 8.0000 0.4152 ++++Y 1108.132646 0 2.7718 303 | 9/11 19 h-m-p 1.6000 8.0000 0.1300 ++ 1108.132618 m 8.0000 319 | 9/11 20 h-m-p 0.2142 8.0000 4.8551 +++ 1108.132585 m 8.0000 336 | 9/11 21 h-m-p 1.6000 8.0000 0.0000 N 1108.132585 0 1.6000 350 | 9/11 22 h-m-p 0.0160 8.0000 0.0000 N 1108.132585 0 0.0160 366 Out.. lnL = -1108.132585 367 lfun, 1468 eigenQcodon, 6606 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1108.172164 S = -1108.133384 -0.014941 Calculating f(w|X), posterior probabilities of site classes. did 10 / 58 patterns 0:10 did 20 / 58 patterns 0:10 did 30 / 58 patterns 0:10 did 40 / 58 patterns 0:10 did 50 / 58 patterns 0:10 did 58 / 58 patterns 0:10 Time used: 0:10 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.026806 0.091047 0.058395 0.027375 0.108861 0.051067 0.000100 0.722546 1.713325 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 15.960072 np = 9 lnL0 = -1205.820905 Iterating by ming2 Initial: fx= 1205.820905 x= 0.02681 0.09105 0.05840 0.02738 0.10886 0.05107 0.00011 0.72255 1.71332 1 h-m-p 0.0000 0.0000 637.8350 ++ 1205.167150 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0134 53.9821 +++++ 1185.530172 m 0.0134 29 | 2/9 3 h-m-p 0.0000 0.0002 1718.9017 ++ 1115.732017 m 0.0002 41 | 3/9 4 h-m-p 0.0000 0.0000 120.1940 ++ 1115.712616 m 0.0000 53 | 4/9 5 h-m-p 0.0000 0.0011 17.3231 ++++ 1111.483849 m 0.0011 67 | 5/9 6 h-m-p 0.0000 0.0000 271.9271 ++ 1109.056808 m 0.0000 79 | 6/9 7 h-m-p 0.0000 0.0002 12.3736 ++ 1108.532597 m 0.0002 91 | 7/9 8 h-m-p 0.0160 8.0000 7.8984 -------------.. | 7/9 9 h-m-p 0.0000 0.0000 275.9601 ++ 1108.132585 m 0.0000 126 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 N 1108.132585 0 1.6000 138 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 Y 1108.132585 0 0.0160 151 Out.. lnL = -1108.132585 152 lfun, 1672 eigenQcodon, 9120 P(t) Time used: 0:12 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.072890 0.057528 0.104017 0.053714 0.107597 0.019488 0.000100 0.900000 1.189444 1.917008 1.299966 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 12.785015 np = 11 lnL0 = -1218.891925 Iterating by ming2 Initial: fx= 1218.891925 x= 0.07289 0.05753 0.10402 0.05371 0.10760 0.01949 0.00011 0.90000 1.18944 1.91701 1.29997 1 h-m-p 0.0000 0.0000 626.5039 ++ 1218.237442 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 277.8536 +++ 1187.921432 m 0.0005 31 | 2/11 3 h-m-p 0.0001 0.0004 295.2730 ++ 1140.930218 m 0.0004 45 | 3/11 4 h-m-p 0.0001 0.0005 90.4500 ++ 1138.383714 m 0.0005 59 | 4/11 5 h-m-p 0.0000 0.0000 6004.1701 ++ 1130.668035 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0000 16923.9207 ++ 1110.546554 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0001 3660.8942 ++ 1108.132697 m 0.0001 101 | 7/11 8 h-m-p 1.6000 8.0000 0.0013 --------Y 1108.132697 0 0.0000 123 | 7/11 9 h-m-p 0.0160 8.0000 0.0001 +++++ 1108.132697 m 8.0000 144 | 7/11 10 h-m-p 0.0036 1.7864 0.6417 --------Y 1108.132697 0 0.0000 170 | 7/11 11 h-m-p 0.0160 8.0000 0.0002 +++++ 1108.132697 m 8.0000 191 | 7/11 12 h-m-p 0.0036 1.7983 0.7138 -----------Y 1108.132697 0 0.0000 220 | 7/11 13 h-m-p 0.0160 8.0000 0.0007 +++++ 1108.132697 m 8.0000 241 | 7/11 14 h-m-p 0.0081 1.8366 0.6512 ----------Y 1108.132697 0 0.0000 269 | 7/11 15 h-m-p 0.0160 8.0000 0.0002 --Y 1108.132697 0 0.0003 289 | 7/11 16 h-m-p 0.0160 8.0000 0.0003 ---Y 1108.132697 0 0.0001 310 Out.. lnL = -1108.132697 311 lfun, 3732 eigenQcodon, 20526 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1108.144288 S = -1108.128288 -0.007029 Calculating f(w|X), posterior probabilities of site classes. did 10 / 58 patterns 0:18 did 20 / 58 patterns 0:18 did 30 / 58 patterns 0:19 did 40 / 58 patterns 0:19 did 50 / 58 patterns 0:19 did 58 / 58 patterns 0:19 Time used: 0:19 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=284 NC_011896_1_WP_010907608_1_230_MLBR_RS01130 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG NC_002677_1_NP_301284_1_156_folP VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG NZ_CP029543_1_WP_010907608_1_230_folP VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG NZ_AP014567_1_WP_010907608_1_239_folP VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ************************************************** NC_011896_1_WP_010907608_1_230_MLBR_RS01130 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG NC_002677_1_NP_301284_1_156_folP ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG NZ_CP029543_1_WP_010907608_1_230_folP ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG NZ_AP014567_1_WP_010907608_1_239_folP ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ************************************************** NC_011896_1_WP_010907608_1_230_MLBR_RS01130 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV NC_002677_1_NP_301284_1_156_folP ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV NZ_CP029543_1_WP_010907608_1_230_folP ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV NZ_AP014567_1_WP_010907608_1_239_folP ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV ************************************************** NC_011896_1_WP_010907608_1_230_MLBR_RS01130 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV NC_002677_1_NP_301284_1_156_folP AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV NZ_CP029543_1_WP_010907608_1_230_folP AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV NZ_AP014567_1_WP_010907608_1_239_folP AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ************************************************** NC_011896_1_WP_010907608_1_230_MLBR_RS01130 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW NC_002677_1_NP_301284_1_156_folP ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW NZ_CP029543_1_WP_010907608_1_230_folP ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW NZ_AP014567_1_WP_010907608_1_239_folP ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW ************************************************** NC_011896_1_WP_010907608_1_230_MLBR_RS01130 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG NC_002677_1_NP_301284_1_156_folP GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG NZ_CP029543_1_WP_010907608_1_230_folP GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG NZ_AP014567_1_WP_010907608_1_239_folP GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG **********************************
>NC_011896_1_WP_010907608_1_230_MLBR_RS01130 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >NC_002677_1_NP_301284_1_156_folP GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >NZ_CP029543_1_WP_010907608_1_230_folP GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC >NZ_AP014567_1_WP_010907608_1_239_folP GTGAGTTTGGCGCCAGTGCAGGTTATTGGGGTTTTGAACGTCACTGACAA TTCGTTCTCAGATGGCGGACGTTACCTTGATCCTGACGATGCTGTCCAGC ACGGCCTGGCAATGGTCGCGGAAGGCGCGGCGATTGTCGACGTCGGTGGC GAATCGACCCGGCCCGGTGCCATTAGGACCGATCCTCGAGTTGAACTCTC TCGTATCGTTCCTGTCGTAAAAGAACTTGCAGCACAGGGGATTACAGTAA GTATCGATACTACGCGCGCTGATGTTGCACGGGCGGCGCTGCAAAGCGGC GCACGGATCGTCAACGATGTGTCTGGTGGGCGAGCAGATCCCGCGATGGC TCCTCTGGTGGCTGAAGCCGGTGTTGCGTGGGTGTTGATGCACTGGCGAC TGATGTCGGCTGAACGGCCGTATGAGGCTCCGAATTACCGCGACGTGGTG GCTGAAGTGCGTGCCGACCTACTGGCTGGTGTCGATCAGGCTGTGGCCGC AGGTGTTGATCCTGGGAGTCTAGTGATCGATCCCGGGCTTGGATTCGCCA AGACGGGACAGCACAATTGGGCGCTGCTGAATGCGTTACCGGAGTTGGTG GCTACTGGGGTCCCGATTCTACTTGGCGCCTCGCGTAAACGGTTCCTGGG TAGGTTATTAGCTGGGGCTGATGGCGCGGTACGACCGCCGGACGGACGTG AGACGGCGACCGCGGTGATTTCCGCACTTGCTGCCCTACACGGGGCTTGG GGTGTTCGGGTGCACGATGTGCGTGCCTCGGTCGACGCACTCAAGGTCGT CGGGGCTTGGCTGCATGCTGGGCCGCAGATTGAAAAGGTTAGATGTGATG GC
>NC_011896_1_WP_010907608_1_230_MLBR_RS01130 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >NC_002677_1_NP_301284_1_156_folP VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >NZ_CP029543_1_WP_010907608_1_230_folP VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG >NZ_AP014567_1_WP_010907608_1_239_folP VSLAPVQVIGVLNVTDNSFSDGGRYLDPDDAVQHGLAMVAEGAAIVDVGG ESTRPGAIRTDPRVELSRIVPVVKELAAQGITVSIDTTRADVARAALQSG ARIVNDVSGGRADPAMAPLVAEAGVAWVLMHWRLMSAERPYEAPNYRDVV AEVRADLLAGVDQAVAAGVDPGSLVIDPGLGFAKTGQHNWALLNALPELV ATGVPILLGASRKRFLGRLLAGADGAVRPPDGRETATAVISALAALHGAW GVRVHDVRASVDALKVVGAWLHAGPQIEKVRCDG
#NEXUS [ID: 0952736372] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907608_1_230_MLBR_RS01130 NC_002677_1_NP_301284_1_156_folP NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 NZ_CP029543_1_WP_010907608_1_230_folP NZ_AP014567_1_WP_010907608_1_239_folP ; end; begin trees; translate 1 NC_011896_1_WP_010907608_1_230_MLBR_RS01130, 2 NC_002677_1_NP_301284_1_156_folP, 3 NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800, 4 NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705, 5 NZ_CP029543_1_WP_010907608_1_230_folP, 6 NZ_AP014567_1_WP_010907608_1_239_folP ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06906503,2:0.06673676,3:0.06979891,4:0.06884852,5:0.06881405,6:0.06728539); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06906503,2:0.06673676,3:0.06979891,4:0.06884852,5:0.06881405,6:0.06728539); end;
Estimated marginal likelihoods for runs sampled in files "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1153.42 -1157.69 2 -1153.40 -1156.71 -------------------------------------- TOTAL -1153.41 -1157.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/folP/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896026 0.094207 0.338453 1.478087 0.859785 1303.77 1387.33 1.000 r(A<->C){all} 0.161656 0.017686 0.000049 0.422531 0.130231 176.34 214.88 1.002 r(A<->G){all} 0.160169 0.019602 0.000085 0.451797 0.122339 192.11 247.83 1.001 r(A<->T){all} 0.182843 0.022294 0.000138 0.484219 0.149126 216.92 235.54 1.004 r(C<->G){all} 0.166066 0.019052 0.000084 0.443760 0.128517 235.06 264.17 1.000 r(C<->T){all} 0.167495 0.018780 0.000012 0.447214 0.133750 246.50 281.39 1.001 r(G<->T){all} 0.161772 0.019263 0.000028 0.440192 0.123410 86.29 142.48 1.001 pi(A){all} 0.169461 0.000171 0.144092 0.195315 0.169428 1289.05 1348.36 1.000 pi(C){all} 0.247407 0.000216 0.218621 0.275997 0.247302 1237.07 1251.88 1.000 pi(G){all} 0.352822 0.000270 0.319259 0.383655 0.352768 1196.58 1225.65 1.001 pi(T){all} 0.230310 0.000201 0.202588 0.257286 0.230074 1249.71 1375.36 1.000 alpha{1,2} 0.423408 0.237398 0.000213 1.373515 0.248138 1102.48 1265.27 1.000 alpha{3} 0.473635 0.270507 0.000288 1.501013 0.299038 1257.08 1277.42 1.001 pinvar{all} 0.998239 0.000005 0.994316 0.999999 0.998906 1186.96 1272.74 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/folP/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 284 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1 TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0 Leu TTA 3 3 3 3 3 3 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 4 4 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 5 5 5 5 5 5 | Pro CCT 5 5 5 5 5 5 | His CAT 1 1 1 1 1 1 | Arg CGT 6 6 6 6 6 6 CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 5 5 5 5 5 5 | CGC 2 2 2 2 2 2 CTA 4 4 4 4 4 4 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 4 4 4 4 4 4 CTG 9 9 9 9 9 9 | CCG 7 7 7 7 7 7 | CAG 6 6 6 6 6 6 | CGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 7 7 7 7 7 7 | Thr ACT 3 3 3 3 3 3 | Asn AAT 4 4 4 4 4 4 | Ser AGT 3 3 3 3 3 3 ATC 4 4 4 4 4 4 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1 ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1 Met ATG 4 4 4 4 4 4 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 9 9 9 9 9 9 | Ala GCT 16 16 16 16 16 16 | Asp GAT 14 14 14 14 14 14 | Gly GGT 8 8 8 8 8 8 GTC 12 12 12 12 12 12 | GCC 8 8 8 8 8 8 | GAC 7 7 7 7 7 7 | GGC 8 8 8 8 8 8 GTA 3 3 3 3 3 3 | GCA 9 9 9 9 9 9 | Glu GAA 8 8 8 8 8 8 | GGA 4 4 4 4 4 4 GTG 14 14 14 14 14 14 | GCG 13 13 13 13 13 13 | GAG 3 3 3 3 3 3 | GGG 10 10 10 10 10 10 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907608_1_230_MLBR_RS01130 position 1: T:0.09859 C:0.23592 A:0.15141 G:0.51408 position 2: T:0.29225 C:0.28521 A:0.20775 G:0.21479 position 3: T:0.29930 C:0.22183 A:0.14789 G:0.33099 Average T:0.23005 C:0.24765 A:0.16901 G:0.35329 #2: NC_002677_1_NP_301284_1_156_folP position 1: T:0.09859 C:0.23592 A:0.15141 G:0.51408 position 2: T:0.29225 C:0.28521 A:0.20775 G:0.21479 position 3: T:0.29930 C:0.22183 A:0.14789 G:0.33099 Average T:0.23005 C:0.24765 A:0.16901 G:0.35329 #3: NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800 position 1: T:0.09859 C:0.23592 A:0.15141 G:0.51408 position 2: T:0.29225 C:0.28521 A:0.20775 G:0.21479 position 3: T:0.29930 C:0.22183 A:0.14789 G:0.33099 Average T:0.23005 C:0.24765 A:0.16901 G:0.35329 #4: NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705 position 1: T:0.09859 C:0.23592 A:0.15141 G:0.51408 position 2: T:0.29225 C:0.28521 A:0.20775 G:0.21479 position 3: T:0.29930 C:0.22183 A:0.14789 G:0.33099 Average T:0.23005 C:0.24765 A:0.16901 G:0.35329 #5: NZ_CP029543_1_WP_010907608_1_230_folP position 1: T:0.09859 C:0.23592 A:0.15141 G:0.51408 position 2: T:0.29225 C:0.28521 A:0.20775 G:0.21479 position 3: T:0.29930 C:0.22183 A:0.14789 G:0.33099 Average T:0.23005 C:0.24765 A:0.16901 G:0.35329 #6: NZ_AP014567_1_WP_010907608_1_239_folP position 1: T:0.09859 C:0.23592 A:0.15141 G:0.51408 position 2: T:0.29225 C:0.28521 A:0.20775 G:0.21479 position 3: T:0.29930 C:0.22183 A:0.14789 G:0.33099 Average T:0.23005 C:0.24765 A:0.16901 G:0.35329 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 6 TTC 18 | TCC 6 | TAC 12 | TGC 0 Leu L TTA 18 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 30 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 30 | Pro P CCT 30 | His H CAT 6 | Arg R CGT 36 CTC 12 | CCC 18 | CAC 30 | CGC 12 CTA 24 | CCA 6 | Gln Q CAA 6 | CGA 24 CTG 54 | CCG 42 | CAG 36 | CGG 36 ------------------------------------------------------------------------------ Ile I ATT 42 | Thr T ACT 18 | Asn N AAT 24 | Ser S AGT 18 ATC 24 | ACC 18 | AAC 12 | AGC 6 ATA 0 | ACA 6 | Lys K AAA 12 | Arg R AGA 6 Met M ATG 24 | ACG 18 | AAG 18 | AGG 12 ------------------------------------------------------------------------------ Val V GTT 54 | Ala A GCT 96 | Asp D GAT 84 | Gly G GGT 48 GTC 72 | GCC 48 | GAC 42 | GGC 48 GTA 18 | GCA 54 | Glu E GAA 48 | GGA 24 GTG 84 | GCG 78 | GAG 18 | GGG 60 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.09859 C:0.23592 A:0.15141 G:0.51408 position 2: T:0.29225 C:0.28521 A:0.20775 G:0.21479 position 3: T:0.29930 C:0.22183 A:0.14789 G:0.33099 Average T:0.23005 C:0.24765 A:0.16901 G:0.35329 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1108.132707 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300302 1.299966 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907608_1_230_MLBR_RS01130: 0.000004, NC_002677_1_NP_301284_1_156_folP: 0.000004, NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800: 0.000004, NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705: 0.000004, NZ_CP029543_1_WP_010907608_1_230_folP: 0.000004, NZ_AP014567_1_WP_010907608_1_239_folP: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.30030 omega (dN/dS) = 1.29997 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 591.2 260.8 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 591.2 260.8 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 591.2 260.8 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 591.2 260.8 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 591.2 260.8 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 591.2 260.8 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1108.132658 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.259699 0.793776 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907608_1_230_MLBR_RS01130: 0.000004, NC_002677_1_NP_301284_1_156_folP: 0.000004, NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800: 0.000004, NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705: 0.000004, NZ_CP029543_1_WP_010907608_1_230_folP: 0.000004, NZ_AP014567_1_WP_010907608_1_239_folP: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.25970 MLEs of dN/dS (w) for site classes (K=2) p: 0.79378 0.20622 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 592.0 260.0 0.2062 0.0000 0.0000 0.0 0.0 7..2 0.000 592.0 260.0 0.2062 0.0000 0.0000 0.0 0.0 7..3 0.000 592.0 260.0 0.2062 0.0000 0.0000 0.0 0.0 7..4 0.000 592.0 260.0 0.2062 0.0000 0.0000 0.0 0.0 7..5 0.000 592.0 260.0 0.2062 0.0000 0.0000 0.0 0.0 7..6 0.000 592.0 260.0 0.2062 0.0000 0.0000 0.0 0.0 Time used: 0:08 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1108.132585 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907608_1_230_MLBR_RS01130: 0.000004, NC_002677_1_NP_301284_1_156_folP: 0.000004, NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800: 0.000004, NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705: 0.000004, NZ_CP029543_1_WP_010907608_1_230_folP: 0.000004, NZ_AP014567_1_WP_010907608_1_239_folP: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907608_1_230_MLBR_RS01130) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:10 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1108.132585 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.315115 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907608_1_230_MLBR_RS01130: 0.000004, NC_002677_1_NP_301284_1_156_folP: 0.000004, NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800: 0.000004, NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705: 0.000004, NZ_CP029543_1_WP_010907608_1_230_folP: 0.000004, NZ_AP014567_1_WP_010907608_1_239_folP: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.31512 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 597.8 254.2 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:12 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1108.132697 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.633600 0.614340 2.173854 2.157122 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907608_1_230_MLBR_RS01130: 0.000004, NC_002677_1_NP_301284_1_156_folP: 0.000004, NZ_LVXE01000009_1_WP_010907608_1_2875_A3216_RS04800: 0.000004, NZ_LYPH01000016_1_WP_010907608_1_574_A8144_RS02705: 0.000004, NZ_CP029543_1_WP_010907608_1_230_folP: 0.000004, NZ_AP014567_1_WP_010907608_1_239_folP: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.63360 p = 0.61434 q = 2.17385 (p1 = 0.36640) w = 2.15712 MLEs of dN/dS (w) for site classes (K=11) p: 0.06336 0.06336 0.06336 0.06336 0.06336 0.06336 0.06336 0.06336 0.06336 0.06336 0.36640 w: 0.00320 0.01937 0.04534 0.08048 0.12532 0.18136 0.25149 0.34131 0.46360 0.66387 2.15712 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 597.8 254.2 0.9282 0.0000 0.0000 0.0 0.0 7..2 0.000 597.8 254.2 0.9282 0.0000 0.0000 0.0 0.0 7..3 0.000 597.8 254.2 0.9282 0.0000 0.0000 0.0 0.0 7..4 0.000 597.8 254.2 0.9282 0.0000 0.0000 0.0 0.0 7..5 0.000 597.8 254.2 0.9282 0.0000 0.0000 0.0 0.0 7..6 0.000 597.8 254.2 0.9282 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907608_1_230_MLBR_RS01130) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907608_1_230_MLBR_RS01130) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099 Time used: 0:19
Model 1: NearlyNeutral -1108.132658 Model 2: PositiveSelection -1108.132585 Model 0: one-ratio -1108.132707 Model 7: beta -1108.132585 Model 8: beta&w>1 -1108.132697 Model 0 vs 1 9.799999997994746E-5 Model 2 vs 1 1.459999998587591E-4 Model 8 vs 7 2.2399999988920172E-4